(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE404

ASFUM1_4.PE404       Location/Qualifiers
FT   CDS_pept        join(complement(1594050..1594958),
FT                   complement(1593736..1593987),complement(1592712..1593680))
FT                   /codon_start=1
FT                   /gene_family="HOG000161576" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750027"
FT                   /orf_name="AFUA_4G06190"
FT                   /product="Fungal specific transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="protein kinase regulator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="EAL90167.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG054253"
FT                   /db_xref="HOGENOM:HBG324365"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051ED90"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL7"
FT                   /transl_table=1
FT                   /translation="MTFEFLWRENDCAIGRYAPNCCNNNFKDSEYVLSPLSLIWLTLLS
FT                   VRQLTSVVRDREFRSMKDQITTLQEQVNSLFTSLNDLRNQRSSLDSPNLEDLSRDGSQS
FT                   VFTSMHAATVRPRVRHLRFHGPTSSAFNFDVARSSLQTMGIAPAEEVMNDDMTTAQATP
FT                   AASPPAQQAVFTQSIHPTKDPIWAIKREEALRLCHVYEEEVGIMYPLVDIEKVTNQVNL
FT                   LYTFMEAALRTGFAQRAFPGPDSLLDDNTILLKMILAITLIVEGSGRSDLGQRLFLSVK
FT                   PIIEAKLWGPIDIKTIQLFGMVATYHFHTDDDAMAYRVIGFAARMCLELGLHRREALMK
FT                   SFPNEDQWADVTKVFWTIYSLDRRWSLGTGLPFVIQDEDVDPNLPEPDGSLPYLRCMIS
FT                   YNRISSKIWYSGLGSEGTTDIRRDEIGYLDYQVLQWYKQVPDALKFYPGDSPKHGETVS
FT                   RGLRRLRVLLYLRMNQLRILIYRPVLHSSASIAEDNGHAQTVVDVAKDTVRVLTQLNHT
FT                   SDIYRTQQITFNYFLVAALAVLFLAVCHAPNEFNRQVRDEFYMALDLINGFSTKSYVSK
FT                   RLWKTIKGLRMVGERLGVLARPFGSDSNDPHSTAAVAMAGLAGHSIENLSVYGPMNGVN
FT                   ELGNSPLNGLQMSQELTNLFEAVGGFSSFIASGTAPEGIPGFVNHDRELQNTGEGLSGI
FT                   FGDDGELSRIIRELF"
     atgacgtttg agtttttatg gagagaaaat gactgtgcga taggccgata cgcccccaat        60
     tgctgcaaca ataacttcaa ggattccgag tatgttctat ctcccttgtc tctgatatgg       120
     cttaccttgc tgtcggtaag gcagctgaca agtgtggtac gggacaggga gttccgttcg       180
     atgaaagacc agatcacaac tctgcaggaa caggtgaaca gtctcttcac tagtttgaat       240
     gatcttcgga atcaaagatc atctttggac tcgccgaatc tggaggacct ctctcgggat       300
     ggctcacagt cggtctttac gtcgatgcac gcggctaccg tcagacctcg cgtaagacat       360
     ctgcggtttc acggtcccac tagctccgcc ttcaattttg atgtcgctag atccagtctt       420
     cagaccatgg gcattgcacc cgccgaagag gtcatgaacg acgacatgac aacggcccaa       480
     gccacgccgg ccgcatcgcc gcctgctcag caggctgtat tcacacagtc catacatcca       540
     accaaagatc caatatgggc aatcaaacgg gaggaagctc tacgactctg ccatgtctat       600
     gaggaagaag tcggtattat gtatccgctt gtggatattg agaaggttac caatcaagtc       660
     aacctgctct atactttcat ggaggctgca ttgcgaactg gcttcgcgca gcgagcattc       720
     ccgggcccag actctctcct tgatgataat acaattctcc tcaagatgat tctcgccata       780
     acgttgattg tggaggggag cgggcgaagt gatctgggtc aacgtttatt cttgagtgtc       840
     aaaccaatca ttgaggctaa gctttgggga ccgatcgaca tcaagaccat ccagctcttt       900
     ggcatggtgg caacttacca tttccacacg gatgacgatg cgatggccta ccgagtgata       960
     ggattcgctg cacgtatgtg ccttgaactg ggtctgcacc gacgggaggc gttgatgaaa      1020
     tcctttccga acgaggatca atgggccgac gtcaccaagg tcttctggac gatctacagt      1080
     ttggatagac gctggagtct tggtaccggg ctaccctttg tcattcaaga tgaggatgtc      1140
     gaccctaacc tccccgagcc tgacggatcg ctgccttatt tgaggtgtat gatctcatat      1200
     aatcgtataa gctcaaagat atggtattcc ggacttggct ctgagggcac gacagacata      1260
     cgccgggatg agatcgggta tctggactac caggttctcc agtggtacaa gcaggttccc      1320
     gatgcgttga aattctaccc tggcgactct ccaaagcatg gcgagacggt aagccggggg      1380
     ttgcgtcgac tacgggtact actgtacttg cgcatgaatc agcttcggat tctcatctat      1440
     cggcccgtac tacattcttc tgcgagtatc gccgaagaca acggtcatgc tcaaaccgtg      1500
     gtagatgttg ccaaagatac agttcgagtg ctcactcagc ttaaccatac gtctgacatc      1560
     taccgcactc aacaaattac cttcaactac ttccttgtcg ccgctctcgc ggtgctcttt      1620
     ctggccgtat gtcacgcgcc aaacgaattc aaccgtcagg tgcgagatga gttctacatg      1680
     gcactcgatc tcatcaacgg atttagtaca aaatcttacg tgtcaaagcg gctctggaag      1740
     acgatcaagg ggctgagaat ggttggggaa cggctgggcg tgctggcgcg cccgttcggc      1800
     tcggactcga acgaccccca ttcaacggct gctgtcgcca tggcgggcct ggcgggccat      1860
     tcaatcgaga atctgtctgt ctatggaccg atgaacgggg tcaatgaact gggaaacagt      1920
     ccgttgaacg gactgcagat gagtcaagag ctcaccaacc tgttcgaggc tgttggaggg      1980
     tttagcagct tcattgcatc tggtacagca cctgaaggta tacccgggtt tgtaaatcat      2040
     gatagagagc ttcaaaacac gggcgaggga ctttcaggga tttttggcga tgatggcgag      2100
     ctgtcccgga tcatcagaga gctcttttaa                                       2130
//

If you have problems or comments...

PBIL Back to PBIL home page