(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE408

ASFUM1_4.PE408       Location/Qualifiers
FT   CDS_pept        join(complement(1602693..1603023),
FT                   complement(1601898..1602120),complement(1601087..1601822),
FT                   complement(1600632..1601012))
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055340"
FT                   /orf_name="AFUA_4G06230"
FT                   /product="General amino acid permease (Agp2), putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL90163.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG054249"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051FE9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM1"
FT                   /transl_table=1
FT                   /translation="MSRPDPDTSVHQTSLPTAISSDRSSHLADDFNLATANLTKRNGCP
FT                   ITYSEKATVVEDGEESIGGTLSKPTFDHTHRKLKPRHIQLIGIGGTIGTALYVQVGKSL
FT                   MKGGPGSLAEMVIYLPISSPFIRFAGRYVDEAFGVAAGYNFFVFEAALVPFEITACNMI
FT                   INYWSDVIPVSGVIVIVLVLYILLNVFAVQWYGESEFWLALSKVLLSIGLILFTFIVML
FT                   GGNPKGDRFGFRYWNEPGAFAEYYKTGDLGRWLGFLACLIQASFTIAGPDYVSMAAGEA
FT                   ANPRGVLPRTYNGIFYRLTAFFVLGVLCIGILVPYNDPTLAEAFAKGLPGAAASPYVVA
FT                   MDRLGIPILPHIVNAMILLAAFSAGNSYVYCASRSLYGLALDGKAPRLFTKCTKRGVPI
FT                   YCVTVVMLIALLAFLQVSNSASVVLDWFVNLVTASQLINFSVVTFTYTRFWKAMIAQGI
FT                   PRESLPYKSWWQPYTAYVALVSTTVMTFVGGYTVFLPGNWDIPTFLFSYTMIGVFPVLY
FT                   FGWKIVHRTQVKKPEEVDLLTGLDEIDEYERHYVPEKPR"
     atgtcaaggc ctgacccaga cacgagtgtc catcaaacat cattgccgac ggctatcagc        60
     agtgataggt cgtcccacct ggccgacgac ttcaatttgg ccacagccaa tttgaccaaa       120
     agaaatggct gtcctataac ttactcagag aaggccactg ttgtcgagga tggtgaagaa       180
     tcaataggag gcacattgtc gaagccgact tttgatcata cgcaccggaa gctgaagccc       240
     agacatattc agcttatcgg tatcgggggt acgattggta cagcactcta tgtccaggtc       300
     ggtaaaagtt tgatgaaggg tggccctggc agtctggctg agatggtcat ctacctgcca       360
     atctcatcgc cctttattcg atttgccggc cgctatgtcg atgaagcctt tggtgttgcc       420
     gccggctaca acttcttcgt ctttgaggct gccctagtgc cctttgagat caccgcgtgt       480
     aatatgatca taaactactg gagcgacgtt atcccagtga gcggggtcat cgtcatcgtg       540
     ctggtccttt acatactcct caacgtcttc gcagtgcaat ggtacggcga atccgagttt       600
     tggcttgcgc tttcgaaagt attactcagc attgggttga ttctcttcac attcattgtg       660
     atgctgggcg gcaacccaaa gggagatcga ttcgggttcc gatactggaa cgagccggga       720
     gcctttgcgg agtattacaa aacgggtgat cttggacgat ggctcggttt ccttgcatgc       780
     ctgatccagg ccagtttcac cattgcagga cccgattatg tgtcgatggc agctggagag       840
     gcagccaacc cccgcggagt cttgcctagg acatataacg gtatattcta tcgactcaca       900
     gctttcttcg ttttgggtgt gctgtgtatc ggcattcttg tcccctacaa tgatcctact       960
     ctggccgaag ccttcgccaa gggcttgccg ggcgccgctg catcgcctta tgttgttgct      1020
     atggacagac tcgggatccc tatcctgccc cacattgtca acgccatgat cctgctggca      1080
     gctttcagtg ccgggaatag ttatgtttat tgcgccagca gaagccttta cgggcttgct      1140
     ctggacggca aggcaccccg attgttcact aagtgcacta agcggggtgt accgatctac      1200
     tgtgtcacag ttgtcatgtt gattgcactt ctagccttcc tccaagtatc aaacagcgca      1260
     tctgtcgtcc tggattggtt cgttaatctg gtaactgctt ctcagcttat caacttttcc      1320
     gtcgtcacct ttacctatac ccgtttttgg aaagctatga tagcccaagg tattccacga      1380
     gaatcgctcc catacaagag ttggtggcaa ccctatactg cctatgttgc gctggtttcc      1440
     acgacagtca tgacttttgt aggcggctat actgtctttc tgcctgggaa ttgggatatc      1500
     ccgacctttc tcttctctta tacgatgatt ggagtgtttc cagtcctgta ctttggttgg      1560
     aagattgtac accgcacaca ggtgaaaaaa ccggaagaag tggatctctt gacaggactc      1620
     gacgagatcg acgagtatga gagacattac gttcccgaaa agccaaggta a               1671
//

If you have problems or comments...

PBIL Back to PBIL home page