(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE409

ASFUM1_4.PE409       Location/Qualifiers
FT   CDS_pept        join(1605771..1605879,1605945..1606040,1606124..1606302)
FT                   /codon_start=1
FT                   /gene_family="HOG000187840" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750030"
FT                   /orf_name="AFUA_4G06240"
FT                   /product="Progesterone binding protein, putative "
FT                   /function="heme binding"
FT                   /protein_id="EAL90162.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG054247"
FT                   /db_xref="HOGENOM:HBG715794"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI000051E465"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM2"
FT                   /transl_table=1
FT                   /translation="MVEHEQEPKRFEPKVPVQLDPPKDDPITMEELSKCDGTDPSRPTL
FT                   VAIKGIVFDVSKNPAYGPNGQYRVFAGKDPSRALACSSLKPEDCRPDWYDLDDKEKTVL
FT                   SEWFTFFSKRYNIVGKVKDATNY"
     atggtggaac acgagcaaga acccaagcgc ttcgagccaa aggtccctgt tcagctggat        60
     cctcccaagg atgaccccat cactatggag gaattgtcca aatgcgacgg cacggatccc       120
     agccggccaa ctctcgtcgc gattaaggga attgtgtttg atgtgagcaa gaatccagct       180
     tatggcccca atggccagta tcgcgttttc gctggaaagg atccctcccg ggcccttgcc       240
     tgctcgtctc tgaagcctga ggattgcagg ccggattggt atgatttgga tgataaagag       300
     aagacggtgc tgagtgaatg gtttaccttc ttcagcaaga gatacaatat cgtcgggaag       360
     gtgaaggatg ctacaaacta ctag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page