(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE411

ASFUM1_4.PE411       Location/Qualifiers
FT   CDS_pept        1608936..1609961
FT                   /codon_start=1
FT                   /gene_family="HOG000187852" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902018"
FT                   /orf_name="AFUA_4G06260"
FT                   /product="Mating-type switch/DNA repair protein
FT                   Swi10/Rad10, putative"
FT                   /function="damaged DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL90160.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG054245"
FT                   /db_xref="HOGENOM:HBG324360"
FT                   /db_xref="InterPro:IPR004579"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniParc:UPI000051F780"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM4"
FT                   /transl_table=1
FT                   /translation="MAKDIDTNNADPDHGLPERSATPRAAGGTPNSATAQSTAPKVQQP
FT                   KPQALANRTGPSAILVSTRQKGNPILNHIKLLPWEYADIPADYVVGATTCALFLSLKYH
FT                   RLHPEYIYSRIKALGGKYMLRIILVMVDIENHEDSLKELSKTSIINNYTLMLCWSAPEA
FT                   AHYLELYKSSENAQPTAIRTQQAQSYKESLVEFVTTPRSINKSDAASLISTFGSLQNAI
FT                   NAQPEQISAVPGWGEKKVRQWTNAVREDFRVENAKKAKAPERNIEHDQNPSGLGIVSQT
FT                   GPSNTADEDEAALYLSEAGQRSGVDAKKGAPEVDTPRQSNQEEMSEGISAALARLRENG
FT                   G"
     atggctaagg acatcgatac taataacgct gatccagacc atggccttcc tgaaaggagc        60
     gccacccctc gggctgcagg gggcactccg aattcagcta ctgctcaatc cacggccccc       120
     aaggttcaac aaccaaaacc acaggcactt gccaaccgaa ccggtccctc cgcgattctt       180
     gtttcgacca ggcaaaaggg caatccaata ctgaaccaca tcaaattgtt gccctgggag       240
     tatgcagata tacccgccga ctatgtcgtt ggagcgacca catgtgcgct gttcttatcg       300
     ttgaaatacc accggttaca ccctgaatac atatactctc ggataaaggc tcttgggggg       360
     aaatacatgc tccggattat tttggtaatg gtcgatatcg aaaatcacga agatagtttg       420
     aaggaactct caaagacctc gatcatcaat aattacactc tgatgctctg ctggtcggct       480
     ccggaagcag ctcactatct cgaactatat aagtcgtccg aaaacgctca accgaccgcg       540
     atccgcaccc agcaagccca gtcttacaag gagtctctgg tggagtttgt tacaactcct       600
     agaagtatca acaaatctga tgcagcgagt ctgatatcca cgttcgggag tctacaaaac       660
     gctatcaacg cccagccgga acagatcagt gccgtgcccg gctggggcga aaagaaagta       720
     cgtcaatgga ccaatgcagt aagggaagac tttcgggtgg aaaatgcgaa gaaagcgaag       780
     gcacctgaga ggaacattga gcatgaccaa aatccttcag gcctcggcat tgtgagccag       840
     acagggccct caaatacggc tgacgaagat gaagcagcct tgtacctttc ggaagcggga       900
     cagaggagtg gggtggatgc gaaaaaagga gccccagaag tcgacactcc acggcaatcc       960
     aatcaagagg aaatgagtga aggcattagc gcagcccttg cgagacttcg ggaaaacgga      1020
     ggttga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page