(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE412

ASFUM1_4.PE412       Location/Qualifiers
FT   CDS_pept        1610995..1612092
FT                   /codon_start=1
FT                   /gene_family="HOG000048508" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260072"
FT                   /orf_name="AFUA_4G06270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90159.1"
FT                   /db_xref="HOGENOM:HBG054244"
FT                   /db_xref="UniParc:UPI000051F786"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM5"
FT                   /transl_table=1
FT                   /translation="MGDEDSMNSCSERQAYQDVPISNGVSLSGVLPVRRSPGGHAGDMI
FT                   GSSRHPSARSVQQAQIPQSKNFEIVLVTDNESRRQVRRHAMRQYMRQRRLDSIARLETP
FT                   RLPIGGWVNRQVLSEASSSSIPPSPVEIPVKDTSPEEEKSSLVKDGEPCTPVSWTGPLM
FT                   PLASKSSKVKTEEPSSPSFPNVSYTLSDPRSSPGHGAVEDPFSCYPIPVSHSDHELIQH
FT                   CKFFLGSPYSHTDHADLDTSARGASARTILISLSGGLHCKVIVTYPSMMYKFADSVANN
FT                   PMMEIFRQLALHDNLSFQAMLAIASKHRAGVEGKADSVQSLTHKMRALRLINERIHTDS
FT                   QGLQDGTIYAVATMAVIEVITFPMH"
     atgggagacg aggatagcat gaattcatgc tcagaaagac aggcctatca ggatgtgcca        60
     atttcaaatg gagtcagtct ttcaggtgta ctgcctgtgc gccggtctcc tggtggtcat       120
     gcgggggata tgataggatc gtcgaggcac ccatctgcta ggtcggttca gcaagcacag       180
     atcccgcagt ccaaaaactt cgagattgtc ctcgttacag ataacgagtc acggcgtcag       240
     gtccgccgcc atgcaatgcg gcaatatatg cgtcagcggc gcttggacag cattgctcgt       300
     ctggagacgc ctcgcttgcc aattggtggt tgggtcaacc gccaggtact atcggaagct       360
     tcatcatcca gcattccacc ctctccagtt gaaatccctg tcaaagacac ttctccagag       420
     gaggagaagt catctctagt aaaagatggg gagccatgca ccccagtaag ttggacaggg       480
     ccactgatgc ccttggcgtc gaaatcatcc aaagtcaaaa ctgaagaacc gtcctctcct       540
     tccttcccca acgttagcta tacactatca gatcctcgtt ccagccctgg tcacggggcc       600
     gtggaggatc catttagctg ttatccaatc cctgttagtc actctgacca tgagttaatt       660
     caacactgta agttcttcct tggaagcccg tattcccata cagatcacgc cgatcttgat       720
     accagtgcaa gaggggcgtc tgccagaaca atcttgatct cgttgtctgg tggcttacac       780
     tgcaaagtta ttgtgacata tccatccatg atgtataaat ttgccgattc cgtcgcgaac       840
     aacccaatga tggagatttt tcgacagctt gcgctgcacg acaatctttc attccaagcg       900
     atgcttgcta ttgcctcaaa gcaccgagct ggagtggaag gcaaggcgga ctctgttcaa       960
     agcctcactc ataagatgcg ggcacttcga ttaataaacg agcgaataca caccgactcc      1020
     caaggcctgc aagatggtac aatatacgcc gtagccacaa tggcagttat tgaggtgata      1080
     actttcccta tgcattga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page