(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE415

ASFUM1_4.PE415       Location/Qualifiers
FT   CDS_pept        join(complement(1618003..1618031),
FT                   complement(1616828..1617947))
FT                   /codon_start=1
FT                   /gene_family="HOG000187885" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260074"
FT                   /orf_name="AFUA_4G06300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90156.1"
FT                   /db_xref="HOGENOM:HBG054241"
FT                   /db_xref="HOGENOM:HBG324356"
FT                   /db_xref="UniParc:UPI0000520307"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM8"
FT                   /transl_table=1
FT                   /translation="MVELGISFATIKSLLIFFAPVIIPRAINLYRSLRVAVASRPTPRP
FT                   LPQATRRALNVLFFAILLCFLLSLPFNPHAPSPSIFTLTRSRINTPTDVIFSRLARFRP
FT                   DNTLSETDHLLRSKFTSVVARRVYLRYGPDALTSCEYCSLDNLKTYLLYYLPFNTLIPH
FT                   ILHMVLVGLVTSAPFAGREAASWRNKFTVAGLALAAIDIYIVSTYDPVLSASAAVRAGM
FT                   VPPSSLYHQTTLLRPLVFAVFDGICALLIYVTATNRFFFTPPSQADQVDQLVSTSLTSL
FT                   AGASSKLHAVSVTRNAVVRDKVLKDRDDAYWRTVVAMGAGNTDGDASVAPSSIWEEEEV
FT                   VRAMSRAMAGQGGVDLAKLGVSAAEYVNGVTAGLDDVDPPER"
     atggttgaac ttgggatatc gttcgcgacc atcaagtctt tattgatctt ctttgctccc        60
     gtcatcattc ctcgggccat caacttgtac cgcagtctcc gagttgctgt cgcatcacgt       120
     cccacacctc gtccgctccc tcaggctacc cgccgcgccc tcaatgtcct cttcttcgcc       180
     atcctgctgt gtttccttct cagcctcccg ttcaaccctc atgccccttc tccaagtata       240
     tttaccctga cgcgatcgcg catcaacacc ccgaccgatg tcatttttag caggctggca       300
     cggttccggc cagataatac cttgagcgaa acagatcatt tgctgcgatc caagtttacc       360
     tcggtggtgg cgcggcgggt gtacctgcgc tacgggcccg atgcgttgac gtcctgcgag       420
     tattgctcgc ttgacaacct gaaaacatac cttctctact atctcccctt caacacatta       480
     atccctcata tcttgcatat ggtcctcgtg ggcttggtga cctcggcacc ctttgccggc       540
     cgagaagccg ccagctggcg caacaaattt accgtcgcgg ggttggcttt ggctgccatc       600
     gacatctaca ttgtctcgac atacgacccc gttctgtctg cctcggctgc tgtacgagcg       660
     ggcatggtgc cgccatcgag cttgtatcac caaaccaccc tgctccgtcc gctggtcttt       720
     gcggtctttg acgggatctg cgccctgcta atctatgtaa ccgccaccaa ccgattcttc       780
     ttcacgcctc cctcgcaggc cgatcaagtc gaccagctgg tctcgacttc gctaacgtca       840
     ttggctggag ctagctcgaa attgcatgcg gtgagcgtga cgcgaaatgc cgtggtcaga       900
     gataaggtct tgaaggaccg ggatgatgcg tattggcgga cggttgtcgc gatgggcgct       960
     ggtaacacgg atggcgatgc ttcagtggct ccgagcagta tctgggagga agaggaagtg      1020
     gtgcgagcca tgtcccgggc gatggcggga caaggaggag tagatttggc caagctgggt      1080
     gtcagtgcgg ctgaatatgt caatggcgtc acggcaggct tagatgatgt tgatcccccg      1140
     gagagataa                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page