(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE416

ASFUM1_4.PE416       Location/Qualifiers
FT   CDS_pept        join(complement(1619096..1619282),
FT                   complement(1618779..1619035))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055342"
FT                   /orf_name="AFUA_4G06310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90155.1"
FT                   /db_xref="HOGENOM:HBG054240"
FT                   /db_xref="UniParc:UPI000051FA01"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM9"
FT                   /transl_table=1
FT                   /translation="MASLKESLAGPGFVILNAIRVFNIIVFLDIIAASIVMIVKISLLS
FT                   SFFFFQAVSHVMAAGISIFLILSELPFFRGYFDRNWPLLGQDSGFVTLAVAMLILGMGV
FT                   LGDLNTPATSQESLGLAFWRIVVSAGILAMVMSVVNLVSVSRP"
     atggcttcat tgaaagagtc cttggctggt ccaggatttg tgatcttgaa cgctataagg        60
     gtattcaata tcatcgtctt cctagacatc atcgctgcca gcattgtgat gatagtgaag       120
     atctctcttt tgagcagctt tttcttcttc caagccgttt cccatgtcat ggctgcagga       180
     atcagcatct ttcttatact ctcagaatta cccttcttcc gcgggtactt cgaccgcaat       240
     tggcctttgc taggccaaga ttccggcttc gtcacactag ctgtggcaat gcttatactt       300
     ggaatggggg tcttgggcga tctgaatacg cctgccacga gtcaggaatc acttggcctt       360
     gcattctgga ggattgtggt atccgcaggt attctggcta tggttatgag tgttgtcaat       420
     ctggtgtcgg taagtcgacc ttaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page