(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE419

ASFUM1_4.PE419       Location/Qualifiers
FT   CDS_pept        join(1623645..1623731,1623831..1624017,1624109..1624437)
FT                   /codon_start=1
FT                   /gene_family="HOG000187923" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260075"
FT                   /gene_name="get1"
FT                   /orf_name="AFUA_4G06340"
FT                   /product="Protein get1"
FT                   /biological_process="transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL90152.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG054236"
FT                   /db_xref="HOGENOM:HBG737110"
FT                   /db_xref="InterPro:IPR007514"
FT                   /db_xref="UniParc:UPI000051F024"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNN2"
FT                   /transl_table=1
FT                   /translation="MLSLILTIFFVHVAIYLVNTVGATTIDTLLWILYLKLPTSTSRNA
FT                   RQQSRLKREVVQLKREMNNTSSQDEFAKWAKLRRKHDKAMDEYEAMNKKLTAQKTSFDW
FT                   SVKIARWLSTNGLKIFLQFYYSKTPVFALPAGWFPFYVEWVLSFPRAPRGSVSVQVWNS
FT                   VCATAIAVMAEIVTSMLLQLRSRSASPASTAKAQKAQ"
     atgctatcgc tcattctgac gatattcttt gtccacgtcg ccatttactt ggtgaatact        60
     gtcggagcaa ctaccattga tactctgcta tggattctct acctcaagct ccctacatcg       120
     acatcgagga atgcacgcca gcagagccga ctgaagcgcg aagtcgtcca gctcaagcgc       180
     gagatgaaca acaccagctc gcaagatgag tttgcaaagt gggctaagtt gaggaggaag       240
     catgacaaag ctatggatga atatgaggca atgaacaaga aactcacggc acagaaaacc       300
     tcgttcgact ggagtgtcaa gatcgctcgg tggctcagca ccaacggtct taagatcttt       360
     ctgcagtttt actactccaa gactcctgtc tttgcgcttc cagcaggctg gtttcccttc       420
     tacgttgaat gggtactgtc attccctcga gcgcctcgtg gatcggtgag cgtccaagtt       480
     tggaacagtg tctgcgcgac agcgattgcc gtcatggcag agattgttac ctccatgttg       540
     ctgcagttga gaagtcggag cgcaagccct gcttcgacag caaaggccca aaaggcgcaa       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page