(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE42

ASFUM1_4.PE42        Location/Qualifiers
FT   CDS_pept        join(complement(148505..148802),complement(139243..148454))
FT                   /codon_start=1
FT                   /gene_family="HOG000217133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273693"
FT                   /orf_name="AFUA_4G00530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84365.1"
FT                   /db_xref="HOGENOM:HBG054082"
FT                   /db_xref="HOGENOM:HBG324255"
FT                   /db_xref="InterPro:IPR022099"
FT                   /db_xref="InterPro:IPR022105"
FT                   /db_xref="UniParc:UPI000051EB28"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W976"
FT                   /transl_table=1
FT                   /translation="MPFMSSQKMCLEANVYLVHHVFLPPKLPQEDDYDPEYELVLLEKC
FT                   IEALEQFKGYVSGPEADSIAAAALMITRLAQIFGPHGDVDEKKFRNALAQLYTEGGILP
FT                   VYVKCQNAAVLMTRDDDAIRIETFELSARNEAVMTTIGRLKRQFPGPTLSMDLETFNES
FT                   GLQTTIAQTFAKLSHQPVAGTHAKVKKAGQMHDEDRDTTHPRMVTEFVTAFLRPLCTSV
FT                   VCSQMEKNTREEVMWLDSRSPWRRSSLWLLIRVALQLVLHRRAVREETADDLYKQFMVY
FT                   FMSRIVSASPSTICSEHLHTMISKISRRLVKLGTPDNRGWIAHVREALKSAIKILEKRW
FT                   HKIIARNGCHGHTQHVATLDFGSDIYYTLPELDNYLAEIDQRRIVQAVNDFLPQSILVE
FT                   CPSTDLPLHLDFTDPEYKAYNLAAFEHWVACSLETWLETHISDEGTCNRVGTLLKNYYE
FT                   IAITPYASNPEALSVMLLTVLELWIACDKSATRIHQILWDYDACIPVELFESLLLPFRS
FT                   QMARLDRAESYLRLRKQRTIHFGPGVFQDYGTPACFAVRYFDQSETHQRLLSEIEESAW
FT                   QEREDKKAELRRKRQQCADLYALCDTMDCTYEEVIVDRRFNFRETRHSGSCQRCAYQRQ
FT                   ADSMKVSVHEWPLPSNRLQAKSTVFELNVPRPFGCWRDITMFFLVDVLHIQYISRDEPR
FT                   AEHTLQNYGGLSPFYTAVQGVGRVGLLSQNKPHERTHRLKKKIINVTEDDVCVNNGLLL
FT                   RYFDFSMRTFVGGFKMSDEIANLCMYKLPKRSTDLQQFLFRPLGNPDGPSPNTVIASQD
FT                   CCPVGMSLEEYRSLCTMPLGVEIQWQNILRQLAMPSIDLKKAETCIFILQIINQAGPST
FT                   ASRVTRTAHDILNDTAFTTALLGRVYDIAARLEENWEMAQGLSALSALVLRILALSPSA
FT                   DVREICLTTLQHLRKVAFAWVKIVTEKASSTTDDRRRSDLLMRSGQLALICATTFDAED
FT                   IVLVRMLENPSDTAVLLQCCMLINDTRRFLCEGSGSSPLIPILFRRWQVLCYRCLPVLR
FT                   QNILQRADSSLDIAIGQIWVTYRAGSSWKASPEAPICWLVTSLPSQSEHGVDLPVHYNL
FT                   LTGDLLVNGLPLARLPSEYERHDTYRTLFGQSSLEVMPSVIPGMDFTCRKKYMGHTVSF
FT                   SRRKVTGCEDFDLCIQATEAGCTWEFIPPRLLMGSFPDAFLTGCVHWYNVHNDYVEFRP
FT                   IDKPWISSTSNWRLRKTSAHDPWRLAKDTLFLVSVKSRTAEVIAAILQPIEKPSQLHCT
FT                   FDSTTSSLGIELPRLRLRFTLQRRSSAIRSREYQGMFIDPDQSLDALVGLRNRLILRHE
FT                   SGGDRVVLIPEGRVTWFKDHGHIAVEIGWQARSTLHPYTVDDQLGRLTDNGSLHSRSLL
FT                   CYLHALTSYCLPDPLTGRTGTEQALTILRSASMRSFDRLHPKASIILAKIAELTPERHY
FT                   YPSNERVMQTVRWDKHLGFLAQHDSFYREVTAIFDHDNRMKMFHPNEQVNQPPLPHIVP
FT                   DLLRRNEIRSSSFRVAGFGAEAHTVEYDRPYKGLDQNRHSARFYRAYRLCKILYEGIPS
FT                   ALETSHVDLLSELWQFLSQTHVVHAASSPVDSSRIQYDAGWILEPMTFVASHWCSLHQL
FT                   LCSRDTGMSKFQVMVWLATLAFSESSNMVVLEVLASLYVIPEMANPTPASRGQFQLWHG
FT                   YEVNEAMLGSRIHQSAALSHTPESNLHPRHNENMRVFRSRKKRIAKMNRTLALQTFIRG
FT                   LKARWPIRSPATPPEEAGPRFGDYYATPEAMTQAGQLFQIWFDNLEFREYLSDLSSLFV
FT                   SQTVHHVQMPPVCLPGEVKQTTTRRGYICIDDLLGFEPMLDMERPRLSSLLSSHPECED
FT                   PAPRLMALVDSLERQSKSQYERRYVEHLRGSIGSLQQKKRRDYITMNSSQLEAALLDYL
FT                   HHCETYCERLYDAMRMRLTHFDGTLDSTQNSLPLETLAGIGNWPRISPYLLVEQLTHQR
FT                   WYLLPERWKASIVEYGCAITALQRARRLTTLVRSPDDLIRELQNPGHTNWDPYQYPESL
FT                   LLEIENSMLIREVQEQIARRMRDISPGTNAVMQLNMGEGKSSVIVPMVVAHLADGSRLV
FT                   RVVVAKPQSRQMLQMLVSKLGGLLGRPVYLLPVSRSLRLTVADTDAIFHLCQKCMEEGG
FT                   VLLVQPEHLLSLKLMCLESFVTGRGAVGGSLLQTLEFFTQYAQDVVDESDENFSAKFEL
FT                   IYTMGTQRQLELTPQRWVIVQELLNIMRMIAPSVKKDYPRSLEVEECSVGGFPRIRLLQ
FT                   KDAELELLQRVATHICEHGIDSLPISRQSKTARQAVRAYILKQELSSEEISSVEDTGPA
FT                   GFWTETTKNPLLLLRGLFAGGILSFCFGQKRWRVNYGPDHSRNPPTRLSVPYRAKDCPA
FT                   PRSEFSHPDVVNLLTCLNYYYAGLSDEELFLALDHLVKSDQAEIEYQAWVVDCPSLPDT
FT                   YRQLGGVNLEDRQHCVKQIFPWFRSAKGAIDYFLAHVVFPRELREFPDKLSASGWDIGE
FT                   LRTQPTVGFSGTNDSRQTLPLSVEQLDLPEQNHTNALVLDYLLRPENSVALSPARPQAS
FT                   TLDAKGLLDMVMGLEPPVQVILDVGAQILELSSLEVAEYWLNLIPDNTQTQAVIFVNEN
FT                   DEICVLDRNRRVELLQVSPFGKQLGACLVFLDEAHTRGIDLKLPATYRAAVTLGAGITK
FT                   DKLVQGKTAGNRGMNRNAKLTAHSACMRMRKLGKGQSVVFCIPDEIRFKILALPHKCSR
FT                   SDIDVADVLCWAVSETWVDIRRSMPLWAAQGKRYIQQCRLWEAASQDGKVQLSFSRASE
FT                   FLEPESQSLDDRYRPRRGEATVLHHQSDESTPMCLISERCRDFDGLSFGTAQLQEEQER
FT                   ELAPEIEQERQIERPPPAEPKQHCLHADLLTFVSTGILKEHSSAVRPAFEALRNTSAAR
FT                   YLDVSQFPPGLRVTTDFATTIQFREGSSSLSDAYQRPVQWVLTHSIYDSTSGKRNASHV
FT                   IIISPYEAMHLLPEVRRSTGATIHLYAPRQHLSFVPLDRLDLYNIPSRADPIDIPDDLK
FT                   IQLNLFAGQLYIASYDEYLRLCDTLGVASAATPDNLSVAADGFILRGNVTGKSTFSQSP
FT                   LKFLQVLLSQIRKDGQDISKTHIGKLLDGRLLEARNFDSAIEELTLARLSIRSHPE"
     atgcccttca tgtcgtcaca aaagatgtgt ttagaggcaa atgtgtattt agtgcaccat        60
     gtttttcttc ctccgaaact tcctcaggag gacgattacg accccgaata cgaactcgtg       120
     ctgcttgaga agtgcattga agcgctcgag cagttcaaag gttatgtttc gggcccagaa       180
     gcagacagta ttgctgctgc tgcacttatg attactcgat tggctcaaat atttgggcca       240
     cacggtgacg tggatgaaaa gaagttccga aacgctttag cacagctgta taccgagggt       300
     ggaattctgc cagtatatgt gaaatgtcag aatgctgccg tcctgatgac gagggatgac       360
     gatgcaatcc gcattgagac tttcgagctg tctgctcgca acgaagcggt catgacaaca       420
     attggccgac tcaagcgtca gttcccgggc ccgacgcttt cgatggacct ggaaactttc       480
     aatgagtctg ggctccagac caccatcgca cagacatttg ctaaactgag tcaccagcca       540
     gttgcgggga ctcatgccaa agtgaagaaa gccggccaga tgcacgatga ggatcgagac       600
     acaactcacc cgaggatggt caccgagttt gtaactgcat tcttgcgtcc tttgtgcacc       660
     agtgttgtct gttctcagat ggaaaaaaat acccgggagg aagtaatgtg gctcgacagc       720
     cggtctccct ggagaagatc ctctctgtgg ctactgattc gagtcgcact tcagcttgtg       780
     ctgcatcgca gggcagtccg tgaagagaca gctgatgacc tttataagca gtttatggta       840
     tatttcatga gtaggattgt cagtgcgtca cccagtacca tatgcagtga gcatctccat       900
     accatgatat ccaagatatc gcggcgccta gtcaaacttg gcacaccaga taatcgaggg       960
     tggattgctc atgtccggga agccctcaaa tctgcgatca aaattcttga gaagagatgg      1020
     cacaagatca tagcgcgaaa tggctgtcat ggccacacgc agcacgttgc aacattggat      1080
     tttggcagtg atatctatta tacccttccc gagctcgata actacctagc ggagattgat      1140
     caacgacgta tcgtgcaagc agtgaatgat ttcctgccac agtcaatcct cgtggaatgt      1200
     ccaagcacag atcttccgct ccatttggac ttcacggatc ccgaatacaa ggcctacaat      1260
     ctagccgcct ttgaacactg ggttgcttgc agccttgaaa cttggctaga gactcatatc      1320
     agtgacgaag gtacatgcaa tcgagtgggt acgctcctga agaactacta tgagatcgct      1380
     atcacgccct atgcttctaa cccagaagca ttatcggtaa tgttgctaac cgtcttggag      1440
     ctgtggattg catgcgacaa gtcggcgacc cgaattcacc aaattctctg ggattacgat      1500
     gcctgcattc cagtggaact gttcgagtca cttctactgc cgtttcgatc tcaaatggca      1560
     agacttgatc gtgccgagtc ttacctgcgg ctgcgcaagc agcgcacgat ccattttggg      1620
     ccaggcgtat ttcaagatta tggaacacca gcttgtttcg ctgtcaggta tttcgaccag      1680
     tctgagaccc atcagagact gctcagcgag atcgaggagt ccgcttggca ggagagagaa      1740
     gacaagaagg ctgaacttcg tcgaaagcgt caacaatgtg cagatttgta cgccttgtgt      1800
     gataccatgg attgcactta cgaagaagtc atcgttgaca ggcgcttcaa cttccgggag      1860
     actcgacata gtggctcctg ccaacgatgc gcgtatcagc gccaagcgga ctcgatgaag      1920
     gtgagcgtcc acgaatggcc acttcccagt aatcgtttgc aagcaaagtc cacggtgttc      1980
     gagctgaacg tacctcgccc ctttggatgt tggcgggata tcaccatgtt ctttctcgtt      2040
     gatgtcctgc acattcaata tatctccaga gacgaaccga gggccgaaca cacgctccag      2100
     aattacggcg gcctgtcgcc tttttatact gctgttcaag gcgtcgggcg agtcggcctt      2160
     ctatcacaga ataaaccgca cgaacggaca catcggctga aaaagaaaat catcaacgtg      2220
     acagaagatg acgtctgcgt caacaacggc ctgcttctcc ggtatttcga tttctcgatg      2280
     cggacgttcg tcgggggctt taagatgtcg gacgaaattg caaacttatg catgtataag      2340
     ttaccaaaaa gaagtacgga cctacagcag tttctatttc ggccattggg caatccagat      2400
     gggccatcgc ccaatacagt tatcgcatcg caggattgct gcccggtggg gatgtcgctt      2460
     gaggagtaca gatccctgtg taccatgcca ctcggagtcg agatccagtg gcaaaatatc      2520
     cttcgccagc tggccatgcc gtcgatcgat ctcaagaagg cagagacttg catctttatc      2580
     ctgcagatca tcaaccaagc tggcccgtca accgcgagcc gggttacgag gacggcacat      2640
     gacatcttaa acgacaccgc gtttacgacc gcgctgttag gacgagttta cgacatcgcg      2700
     gcgagactag aggagaattg ggaaatggca caagggctca gcgctctgag tgccttggta      2760
     ctcagaattt tggctctatc gccctccgca gacgtgcggg agatatgcct cactacgctt      2820
     cagcatctcc gcaaagtcgc ctttgcctgg gtcaagatcg ttaccgagaa agccagctct      2880
     acgactgacg acagacgcag aagcgacctg ctgatgcgga gcggtcaact agcgttaata      2940
     tgcgccacaa cgttcgatgc cgaagacatc gtcttggttc gaatgctgga gaatccatcc      3000
     gatactgcag ttttacttca atgttgtatg ctcataaacg acacacggcg tttcctgtgc      3060
     gagggatccg gctcctcccc tttaatcccg atcctttttc gtcgctggca agtcctgtgt      3120
     tatcgctgtt tgccggtcct gaggcaaaat atcctccagc gcgcggactc gtcgctggat      3180
     atcgctatcg gacagatatg ggtgacgtat cgcgctgggt cctcttggaa ggcatcccca      3240
     gaggcgccaa tctgttggct tgtcactagt ctcccaagcc agtccgagca tggggtcgat      3300
     ctgcccgttc attataacct gctaactggg gatcttctcg tcaacggcct tcccttggct      3360
     cgactgccct cggaatatga gagacatgac acctacagaa cccttttcgg acaatcctca      3420
     ctggaggtga tgccgagtgt gatcccgggg atggatttca cctgtcgaaa gaaatacatg      3480
     ggacacactg tgagcttctc gaggagaaag gtgacgggct gtgaggactt tgatttgtgc      3540
     attcaagcga cagaagcggg ctgcacctgg gaatttatac ctcccagact tctgatgggt      3600
     tccttccctg acgcttttct gacgggctgc gtgcactggt acaacgttca caatgactat      3660
     gtggaattcc ggcccataga caagccttgg atatcatcca cttccaattg gaggcttcgg      3720
     aagaccagcg cgcacgaccc ctggcggcta gccaaggaca ctttattctt ggtcagcgtg      3780
     aaaagtcgaa ccgcagaagt gattgccgcc atcttgcagc cgatcgaaaa gccgtcccaa      3840
     ttgcactgca ctttcgattc caccacttcc agtctaggaa tcgaacttcc ccgtcttcgg      3900
     ctacggttta cactccaacg gcggagttcc gcaatccggt cgcgagagta tcagggcatg      3960
     ttcattgacc ctgaccagtc actggatgcg ttggtcggcc tgcgcaacag gctcatcctg      4020
     cgtcatgaaa gcggcgggga tcgagtggtc ctaataccgg aaggacgcgt tacctggttt      4080
     aaagatcacg gccacattgc cgtggagatc ggctggcagg cgagaagtac cctccaccct      4140
     tatacagtgg acgatcagct cggccgcctg accgacaatg gtagcttgca cagtagatca      4200
     cttctgtgct atttacatgc cctaacgtca tactgccttc cagacccgct tactgggaga      4260
     acagggaccg agcaggctct caccatcctt cggtccgcat caatgcgctc attcgaccgg      4320
     cttcacccga aagcaagtat aattctcgcc aaaattgcag agctgacacc ggagaggcat      4380
     tattatccat ccaatgagcg agttatgcag accgttcgct gggacaagca cctcgggttc      4440
     ctcgcccagc atgatagttt ctaccgagag gtcacggcaa tttttgatca cgacaaccgg      4500
     atgaagatgt ttcatccgaa tgagcaggtg aaccaacccc cgttgcctca tatagttccc      4560
     gatttgctga gacggaacga aattcggtcg tcctcttttc gtgttgctgg ctttggggcg      4620
     gaggctcaca cggttgaata tgaccggccc tacaaaggtc ttgatcagaa tcgtcactcg      4680
     gccagattct accgtgccta ccgcctgtgc aaaatcctct atgaggggat cccctcagcc      4740
     ctggagacct cacatgtgga cttgctttca gaactctggc agtttctctc tcaaacccac      4800
     gttgtccacg cagccagttc cccagtcgac agtagcagga tacagtacga tgcaggatgg      4860
     atactggagc cgatgacctt tgtagctagt cactggtgta gccttcatca actgctctgc      4920
     tcaagggaca ctggcatgag taagttccaa gtcatggtat ggttggcaac cttggcattc      4980
     tccgagagct ccaatatggt cgtccttgaa gttcttgctt cactctacgt gatcccagag      5040
     atggcgaacc ccacgccagc ttctcgcgga cagtttcagc tttggcacgg atatgaggtg      5100
     aatgaggcaa tgttgggctc tcggatccat cagtcagctg ctctctcgca caccccagaa      5160
     tccaatctac atccccgaca caatgagaat atgcgggtgt tcagatcccg aaagaaaaga      5220
     atcgcaaaaa tgaaccggac attggctctt cagacattca tacggggctt aaaagcgcga      5280
     tggccgatcc gatctcctgc aacacccccc gaggaagcgg gcccaaggtt tggagactac      5340
     tacgcaacac ccgaagccat gactcaggct ggtcagcttt ttcaaatatg gtttgataat      5400
     ctcgagtttc gagaatatct ctcagatctc tcgtctctct tcgtcagcca aacagtccat      5460
     catgtccaga tgccccctgt ctgcctccca ggtgaagtga aacagacaac cacacgccgg      5520
     ggatacatct gcatagacga cctgcttggt tttgagccaa tgctggacat ggagcgtcca      5580
     cgcttaagta gtctcctgag tagccacccc gagtgtgagg acccagcacc tcgcctcatg      5640
     gcccttgtcg attctttaga acgacagtca aagtcccaat atgagcgccg atatgtcgag      5700
     catctccggg gcagtattgg ttccctacag cagaagaaaa gaagggatta tattacaatg      5760
     aactctagcc aactggaggc agctcttctc gactaccttc atcattgtga aacgtactgt      5820
     gagcgcctgt acgacgccat gaggatgcgt ttgacgcatt ttgacggaac gcttgatagc      5880
     acccaaaata gtctaccgtt ggaaacgttg gccggcatcg gtaattggcc gagaatctca      5940
     ccatatcttc tggttgagca actgacgcac caacgatggt atcttctgcc cgagcgatgg      6000
     aaagccagca tcgtcgagta tgggtgtgca atcacagcac ttcagcgagc aagacggtta      6060
     accaccctag ttcgttcccc tgacgatttg attcgggaac tccagaaccc gggccatacc      6120
     aactgggatc cgtaccagta ccccgagtcc ctgctgttgg aaattgaaaa tagcatgttg      6180
     ataagagagg tccaggaaca gattgctcgg agaatgagag acatcagtcc cggcacgaac      6240
     gcagtcatgc agctgaatat gggggaggga aaatcatcgg tgattgtgcc gatggtggtt      6300
     gcccaccttg cagacggatc acgtctggtg cgcgtagtcg ttgcgaaacc ccaatcccga      6360
     cagatgctgc agatgctggt ctcaaaatta gggggattgt tgggtcgacc agtctacctt      6420
     ctgccagtct cgcgctccct gaggttaacg gtggcggaca ccgatgccat attccacctg      6480
     tgccagaaat gcatggagga gggaggcgtt ctgctagtcc aacccgagca cctattatcg      6540
     ttgaaactga tgtgcctcga gagcttcgtc acggggagag gggcagttgg gggttccctg      6600
     cttcagactc tcgagttttt cacccagtac gcacaggatg tggtcgatga gagtgacgag      6660
     aacttcagcg ccaagttcga gctcatctat accatgggga ctcagcgcca gttggagctc      6720
     accccgcaaa gatgggtgat cgtgcaggag ctgctcaata tcatgaggat gatagcgccg      6780
     agtgtcaaga aggactatcc caggtcacta gaggtggaag agtgttcggt ggggggcttt      6840
     cctcggataa gactgctgca aaaagacgcg gagctagaac tgttgcaacg ggtcgctacg      6900
     cacatatgcg aacacggcat tgattctctg ccgatttctc gacagtcaaa aacagcgaga      6960
     caggctgtac gtgcgtacat tctgaagcag gagttaagct cggaagagat ctcgtccgtc      7020
     gaggacacag gcccagcagg gttctggacc gaaacaacaa agaatccgct acttctgtta      7080
     cgcggccttt ttgccggagg aatcctatcc ttttgtttcg gccagaaacg atggcgggtg      7140
     aactatgggc ctgatcactc acgaaatccc ccaacgagac tttcagtccc ttatcgagcc      7200
     aaggactgcc cggcgccccg gtctgaattc agccaccccg acgtggtcaa cctgctgaca      7260
     tgtctgaatt actactatgc cggcctcagc gatgaggagc tgtttctggc cttggatcat      7320
     cttgtcaagt ccgatcaagc cgagatcgag taccaggcat gggtggtcga ttgtccgtcc      7380
     ctcccggaca cttaccgtca attgggcggg gtcaaccttg aagatcgaca gcactgcgtg      7440
     aaacagatat tcccctggtt tcgctctgcg aaaggtgcaa ttgattattt tctggcccac      7500
     gttgtttttc caagggaatt gcgagagttt ccagacaagc tctctgcatc gggatgggat      7560
     atcggtgaac tcagaaccca gccaacagtt ggattcagcg gaacgaacga ttcgcggcag      7620
     acccttcccc tgagcgtaga gcagttggat ctcccggagc aaaatcatac gaacgcgttg      7680
     gttctggatt accttttgag gcccgagaac tcggtagcgc tctctcccgc acggccgcaa      7740
     gcctcgacgt tggacgccaa ggggttgctg gacatggtta tgggattaga gccaccagtc      7800
     caggtgatcc tcgatgtcgg cgcgcagata ctggaactca gcagtttgga ggttgcagag      7860
     tactggttaa atctgatacc agacaacact cagactcagg cggtgatttt cgtcaatgag      7920
     aatgatgaga tatgtgttct tgaccggaac agacgggtag agctgctgca ggtctcgccc      7980
     tttggaaagc agcttggtgc atgtttggtc ttccttgatg aggcgcacac gagagggatt      8040
     gacttgaagc tgcccgcgac gtatcgagca gctgttactt taggcgcagg cattacgaag      8100
     gacaaattgg tccaaggtaa gacggctgga aaccgaggga tgaatcggaa tgcaaagcta      8160
     acggcgcatt cagcgtgcat gagaatgagg aagctaggga aaggccagtc cgttgttttc      8220
     tgcattccag atgagatcag gttcaagatc ctggccctcc cccataagtg cagccggtca      8280
     gatattgatg tcgccgacgt tctctgctgg gcggtgtcgg agacctgggt tgatatacgg      8340
     cgaagtatgc ccctgtgggc ggcacagggt aaacgatata tacaacaatg cagactatgg      8400
     gaggccgcta gccaagacgg taaagtgcag ctttcattta gcagggcttc cgaatttctc      8460
     gaaccagaat ctcagtctct agatgatcgg tatcggccac gtcgcgggga ggcgacggta      8520
     ttgcaccatc agtctgatga aagtacgcca atgtgtctta tttctgaacg atgccgggac      8580
     tttgatggct tgagtttcgg gacagcacag ctacaagaag aacaagagcg cgagcttgcc      8640
     ccggaaatcg aacaggaacg ccaaattgag cggcctcctc cagccgagcc taagcaacat      8700
     tgtcttcatg cggacctcct tacgttcgtg tcgaccggca tactcaagga gcactccagc      8760
     gctgtccggc ctgcctttga ggccctcagg aatacgtcgg ccgcccgtta tctagacgtg      8820
     tctcagtttc ccccgggatt acgagttaca accgactttg ccactaccat tcaattccgg      8880
     gaggggtctt ctagcttgtc tgatgcatac cagcgccctg tccaatgggt cttaacccac      8940
     tctatctacg attctacctc cggaaaacga aatgcaagtc acgtcataat tataagcccc      9000
     tacgaggcca tgcatctgct gccagaagtc cgacgatcga caggggccac gattcatctg      9060
     tacgcgccac gtcagcacct gagcttcgtg cctctcgatc ggttggacct gtacaatatt      9120
     cctagccgtg ctgaccctat tgatatacca gacgacctga agatacagtt gaatctgttc      9180
     gcgggtcagt tgtatattgc ctcgtacgat gagtacctca gactgtgtga cactcttggg      9240
     gtcgcctctg ctgcaacgcc agataatctc agtgtagccg ctgacgggtt cattctacgg      9300
     ggcaatgtga ctggaaagtc gaccttcagt cagagccccc ttaaattctt gcaagtcctc      9360
     ctgtcacaaa tcaggaaaga cggccaagat atcagcaaga ctcacattgg caaacttttg      9420
     gacggccgac ttctcgaagc acgcaacttt gattccgcaa tcgaagagct tacgctcgcg      9480
     aggttgagta ttcgaagcca tccggagtaa                                       9510
//

If you have problems or comments...

PBIL Back to PBIL home page