(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE420

ASFUM1_4.PE420       Location/Qualifiers
FT   CDS_pept        join(complement(1627096..1627225),
FT                   complement(1626368..1627037),complement(1625570..1626299))
FT                   /codon_start=1
FT                   /gene_family="HOG000187934" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260076"
FT                   /orf_name="AFUA_4G06350"
FT                   /product="Ribosomal biogenesis protein Gar2 "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="EAL90151.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG054235"
FT                   /db_xref="HOGENOM:HBG324351"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051FC51"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNN3"
FT                   /transl_table=1
FT                   /translation="MGDQKKSFPHLVFGKGLIAVLQPSIQHTTTRNMAPDKKDKKRKAA
FT                   TTVTADSPAKKTKKVEAKPSEAPKETPKSILKKNKKDGPATEQNSTSKVKVNGEPTRQV
FT                   KPRKRAADFLSDDESEPEVVASEPKADTEEKKQPSKKKSKKEDGTPAPATKAKTSATAA
FT                   KPKATKAKKPEPVVEESDDEDNQQVPVVSDDSSEDEEDDTLDDQTAALIKGFESSGDED
FT                   ESGDEGFDPDQPVPKIPDSKKAKRKILKKQKKHDEPEVPGTVYVGRIPHGFYEHQMRAY
FT                   FSQFGDITRLRLSRNRITGRSKHYAFVEFASSTVAKIVAETMDNYLMYGHILKCKYVPS
FT                   DQLHPEVWKGANRRFKRTPWNRIEKKRLEKGKTREQWSERIEREQKRRLAKAEKLKALG
FT                   YEYELPQLKSVDEVPVQEETKAIEAADTTADEPKKAIEAPSAQESKEETTVDETPKKLK
FT                   KEKKASQSTPKQGTPKQDGEKASTKKGVNGAAASPATKAGTKDKKAKKVKA"
     atgggagacc aaaaaaaaag tttcccgcac cttgtttttg gtaagggcct gattgcggtg        60
     cttcaaccta gcatacaaca cacaacaacc agaaatatgg cgcctgataa aaaggacaaa       120
     aagcgcaagg ctgccaccac agtaaccgca gactcgcccg caaagaagac caaaaaggtc       180
     gaggccaagc cgagcgaagc ccccaaagaa acccccaagt ctatactgaa gaagaacaag       240
     aaggatggcc ctgctacaga gcaaaattcc acttccaaag tgaaggtcaa tggcgagccg       300
     acaagacagg tcaagcctcg caagcgtgcg gcggatttcc tcagcgacga cgagagtgag       360
     ccggaagttg ttgcatccga acccaaggcc gataccgagg agaagaagca gcccagtaag       420
     aagaagtcga agaaggagga cggcactcct gcgcccgcta caaaagccaa gacaagcgct       480
     actgctgcga agcccaaggc gaccaaggcg aagaagcctg agccggtcgt cgaagagtcg       540
     gacgatgagg ataaccagca ggtccctgtt gtctccgatg atagctctga agacgaagaa       600
     gatgatacac tagacgatca gaccgccgct ttgatcaagg gtttcgagag cagcggcgac       660
     gaggacgaat ccggggacga aggatttgat cctgaccagc cagttcccaa gatccccgat       720
     tccaagaagg ccaagcgcaa gatcttgaag aagcaaaaga agcacgatga gcccgaagtt       780
     cccggaacgg tttatgttgg acgtatcccc cacggtttct acgaacatca gatgcgcgct       840
     tacttttccc aattcggcga cattactcgc ctgcgtctct cccgtaaccg catcaccggt       900
     cgctcaaagc actacgcttt cgtagagttc gcctcgagca ctgttgccaa gattgtcgcg       960
     gagactatgg acaactacct gatgtatggc catatcctga aatgcaaata cgttccctcc      1020
     gatcaactgc acccagaggt ctggaagggt gccaacagac gattcaagcg caccccgtgg      1080
     aaccgcatcg agaagaagag gctggaaaag ggcaagacga gggaacaatg gtcggagcgc      1140
     attgagcggg aacagaagag acgtcttgca aaggccgaga agctgaaggc tctgggttat      1200
     gagtatgagc ttccccagct gaagagcgtc gacgaagttc ctgtccaaga agagaccaag      1260
     gcgattgaag ctgccgatac gactgccgat gagcccaaga aggctatcga ggcaccctcg      1320
     gcgcaggagt ccaaggagga gactaccgtg gacgagactc ctaagaagtt gaagaaggag      1380
     aagaaggcaa gccaatcgac tcctaagcag gggacgccca agcaggatgg cgaaaaggcg      1440
     tcaacgaaaa agggagtgaa tggagctgcc gcttcaccgg ctacaaaggc tgggaccaag      1500
     gacaagaagg ctaagaaggt gaaggcgtag                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page