(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE421

ASFUM1_4.PE421       Location/Qualifiers
FT   CDS_pept        join(1627348..1627449,1627499..1627693,1627751..1627862,
FT                   1627919..1628025)
FT                   /codon_start=1
FT                   /gene_family="HOG000187945" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750031"
FT                   /orf_name="AFUA_4G06360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90150.1"
FT                   /db_xref="HOGENOM:HBG054234"
FT                   /db_xref="InterPro:IPR010304"
FT                   /db_xref="UniParc:UPI000051F01B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNN4"
FT                   /transl_table=1
FT                   /translation="MGKAKNANRPLTQEEIWDDSALVQSWDEAVEEYKLYHSIHAKGED
FT                   VEDVLREAEAAERAGLDQDRQQPDEAADAMEDDDAVATTASTAAEQSSSMQVPDAVEEH
FT                   AAATDQQPSGMKHPTQPAPAGAAAMPYAALAQVQDEGLKNLMMAWYFAGYYTGLYQGQQ
FT                   QASQNNNS"
     atggggaaag caaagaatgc gaataggccc ctgacacaag aagaaatatg ggacgattcc        60
     gccctcgttc aaagctggga tgaagcagtc gaagagtaca aattgtatca cagcatacat       120
     gccaaaggtg aggatgttga agatgttctg agagaagctg aggctgcgga gcgtgccggg       180
     ttggatcagg acagacagca gcctgatgaa gctgccgatg ccatggagga tgatgacgct       240
     gtggcaacga cagcatcgac tgcagcagaa caaagctcat caatgcaagt accagatgct       300
     gtagaggagc acgcggcagc gactgatcag cagccgtccg ggatgaaaca tccaactcag       360
     cctgctccgg cgggagcagc tgcgatgcca tatgctgctt tagcacaagt ccaggatgaa       420
     gggttgaaga atctgatgat ggcctggtat tttgccggtt actacaccgg tctatatcaa       480
     gggcaacaac aagcgagcca gaacaacaat tcatga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page