(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE423

ASFUM1_4.PE423       Location/Qualifiers
FT   CDS_pept        join(complement(1631871..1632364),
FT                   complement(1630929..1631811))
FT                   /codon_start=1
FT                   /gene_family="HOG000221741" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260077"
FT                   /orf_name="AFUA_4G06380"
FT                   /product="Sterol carrier protein, putative "
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase
FT                   activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="EAL90148.1"
FT                   /db_xref="GO:0004315"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="HOGENOM:HBG054232"
FT                   /db_xref="HOGENOM:HBG567272"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniParc:UPI000051F77F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNN6"
FT                   /transl_table=1
FT                   /translation="MGKKQVAPAYVLGVGMTKFIKPRGKVDYHELGFEAGVKAMLDAHI
FT                   NYDDVDQGIACYVYGDSTCGQRVFYQFGLTNIPIYNVNNNCSTGSTGLAMARTMVSHGA
FT                   ADCVLVIGFEKMSPGSLQSVYNDRANPTGLFGMMMAETRGITNAPGAAQMFGNAGREYM
FT                   EKYGAKNEDFAEIARINHEHSKRNPYSQFQDEYTLEQILKAPMIHEPLTKLQCCPTSDG
FT                   GAAAVIVSQAFLDARPHLKDQAILIAGQQIATDTSTLYNRSSIDLMGFGMTRYACRAAT
FT                   AEAGVNVKDIKVCELHDCFSANEMITIDALELCEPGKAHEMVRKGDITYGGKMVINPSG
FT                   GLISKGHPLGATGLAQCSELVWHLRGWANNRLVQGTDVALQHNLGLGGAVVVTVYKRAD
FT                   GKVAAAVPSDVVAKITGLGYNPAVEAKGFTAEQAKSVLSRKHNDQWALGDTQERVLARF
FT                   "
     atgggaaaga agcaagtagc gcccgcctat gtcctaggcg tgggcatgac caagtttatc        60
     aagcctcgtg ggaaggtcga ctaccatgaa ctcggattcg aggctggtgt caaggctatg       120
     ctggacgctc acatcaatta cgatgatgtc gaccaaggta ttgcatgcta cgtgtacggc       180
     gatagtacct gcggtcagcg tgtcttctac caattcggtc tgaccaacat ccccatctac       240
     aatgtcaata acaactgctc gaccggctca acgggtctgg ccatggctcg caccatggtc       300
     tcccacggcg ctgcggactg tgttcttgtt attggtttcg agaagatgag ccctggaagc       360
     ttgcagtcgg tctacaacga ccgggctaat ccgactggtc tctttggtat gatgatggcc       420
     gagacgaggg gcatcactaa cgcccccggt gctgcacaga tgtttggcaa tgctggccgg       480
     gagtacatgg agaagtatgg tgccaagaat gaagacttcg cggaaatcgc tcgtatcaac       540
     catgaacact ccaagcgcaa cccctactcg caattccagg atgaatacac gctcgagcag       600
     atcctcaagg cgcctatgat tcatgagccc ctcaccaagc tgcagtgctg tccaacctcg       660
     gacgggggtg ctgccgctgt gatcgtctcc caggcattcc tagacgcccg tccccacctc       720
     aaagaccagg caatcctgat cgcaggtcag cagattgcaa cggacacatc cactctctac       780
     aaccgaagct caatcgacct gatgggcttt gggatgaccc gctacgcctg tcgggcggcc       840
     actgctgagg ctggcgtcaa cgttaaggac atcaaggtct gcgaactgca cgattgcttc       900
     tctgccaatg agatgatcac gattgacgca ctcgagctct gtgagcctgg taaggcgcac       960
     gagatggttc gcaaaggtga tatcacctat ggaggcaaaa tggtcatcaa tccctccggc      1020
     ggtctcatct ccaagggtca tcccttgggt gctaccggtc ttgcgcagtg ttctgaactg      1080
     gtctggcacc tgcgcggatg ggccaacaac cgattggtcc agggaacaga tgtggcactg      1140
     cagcacaacc ttggcttggg tggtgcagtc gtcgtgactg tatataagcg tgcggacgga      1200
     aaggttgcgg ctgcagttcc ttcagacgtt gtcgcgaaga tcactggact gggatacaat      1260
     ccagccgtcg aggcaaaggg cttcacagcc gagcaagcta aatcggtcct tagcaggaag      1320
     cacaacgacc agtgggcact gggtgacact caggagagag tgctcgcacg cttctaa         1377
//

If you have problems or comments...

PBIL Back to PBIL home page