(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE428

ASFUM1_4.PE428       Location/Qualifiers
FT   CDS_pept        join(complement(1644035..1644201),
FT                   complement(1643738..1643957))
FT                   /codon_start=1
FT                   /gene_family="HOG000048509" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055344"
FT                   /orf_name="AFUA_4G06430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90143.1"
FT                   /db_xref="HOGENOM:HBG054227"
FT                   /db_xref="UniParc:UPI000051F77E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP1"
FT                   /transl_table=1
FT                   /translation="MMDKGYLLRSEDASQGAEESGQGMMTCTCALQKTRSRRSVSNGVK
FT                   GQWATGRQFGPADEEMIDFPGFCGLFFGCTSGGDGYSGLAWRLRLTLTLTLTLTLTLGL
FT                   GLGLGLGLGLGLDPYNPPHSGGTE"
     atgatggaca agggttatct actccgtagc gaggatgcta gtcaaggggc tgaagaatcg        60
     ggtcagggga tgatgacctg cacctgcgca ctgcagaaga ctaggtctag gaggtccgtc       120
     tcaaatggag taaaaggcca gtgggccaca ggacggcagt tcggtccagc agatgaagaa       180
     atgatcgact tccccggatt ctgcggactc ttctttggct gtacgtccgg aggagatgga       240
     tactctggac tcgcctggag actgagactg acactgacac tgacactgac actgacactg       300
     acactgggac tgggactggg actgggactg ggactgggac tgggactgga tccgtacaac       360
     cccccgcact ccggtggcac agaataa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page