(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE429

ASFUM1_4.PE429       Location/Qualifiers
FT   CDS_pept        complement(1646627..1648819)
FT                   /codon_start=1
FT                   /gene_family="HOG000188000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902021"
FT                   /orf_name="AFUA_4G06460"
FT                   /product="Pentafunctional AROM polypeptide, putative "
FT                   /EC_number="4.2.1.10"
FT                   /function="3-dehydroquinate dehydratase activity "
FT                   /protein_id="EAL90141.1"
FT                   /db_xref="GO:0003855"
FT                   /db_xref="HOGENOM:HBG054224"
FT                   /db_xref="HOGENOM:HBG324343"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000051F01A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP3"
FT                   /transl_table=1
FT                   /translation="MMQTAIHQPMAMTILADTAPSVTNNSASAPSPANGAHPPLATAVS
FT                   ANSAVAAAPPSVPADPPRTVVVVYRSGQDSIVHLVAEVLGKPWTTETSLSTLVTGSNAV
FT                   VVGILAAELARSLDECDPSTLIVINTHCVDDGSSPDEALTDRCDYEFLYSHSPFLRRDL
FT                   TRFLSLILGQTRPHEDLKTKTRTNFISTTFPDVHAALPNLDILSVGSDAVEIRVDLLVE
FT                   PSPQGVVSPVPSLRYVGQQVMLLRQHTELPIIFTTRCTKENGKFPMDDPMLFYRYLRRA
FT                   IQWGCEYIDVELWLPEEIRRRLAEQKGHSVIMSAFHDFSGTWKWTSPEAARIFAESARY
FT                   ADIVKMIAMVHTIEANYELEYFRSTVKARGAGDSSPLLSAVNMGQMGQLSRALNTVFSP
FT                   ITHPLLPMIAAPGQLTAAEINEAMHIMGALPKRDLYVIGSFRATPQSMFMEKCFNELSL
FT                   PHTLTSIDRGPKGTIEGVIMQPSFGGASVNPPISAATPYIPAVSEAARAIGLVDTIVVG
FT                   ESQSQSQSQSQSQSQSQSQSQPHGPPTARTLIGENATWKGIRATLTRDYVPSAYRGRAA
FT                   IILAGSESDASAAIYALRSLGVGSIYTVGFRATGPLAAGLEPFTSIQSVKLVEQPFVMV
FT                   SALPPEKSLLVQPLLRHYRSNGRTSPRSTRGKVYLDLTASSGERKGDPVGVAVNAGWTA
FT                   YGIDEVTAWTTVETMRLLVGQNVPFDFVRMASGRIY"
     atgatgcaga cagccattca tcagcccatg gcgatgacca ttcttgctga taccgctcct        60
     tctgtgacca acaacagcgc cagcgctccg tcgccagcga atggtgctca tcccccactg       120
     gcgacggctg tctcggccaa ttcagccgtt gccgccgctc ccccgtcggt ccccgcggat       180
     cctccgagga cggtggtggt agtttacagg tccggccagg actccattgt gcacttggtc       240
     gccgaggttc tgggcaaacc atggaccacg gaaacgtcgc tgtccaccct ggtgacgggc       300
     agtaatgccg tggtggtggg gattctggcc gccgagctgg cgcgcagtct cgacgagtgc       360
     gacccgtcga ctttgatcgt gatcaacacg cactgtgtgg acgacggctc gtcgccggac       420
     gaggcgctca ccgatcgctg cgactacgag tttctgtact cgcacagccc gtttctgcgg       480
     cgcgatctga cgcgcttcct gtcgttgatc ctgggccaga cgcggccgca cgaggatctc       540
     aagaccaaga cccgcaccaa cttcatctcg acgacgttcc cggatgtgca tgcggcgctg       600
     ccgaacctgg acatcttgtc ggtcgggtcg gatgcggtgg agatccgggt ggatctgctg       660
     gtcgagccgt cgccgcaggg ggtcgtcagc cccgtgccga gcctgcggta cgtgggccag       720
     caggtgatgc tgctgcggca gcacacggag ctgccgatca tcttcacgac gcgctgcacc       780
     aaggagaacg gcaagttccc catggacgat ccgatgctgt tctaccggta cctgcggcgg       840
     gcgatccagt gggggtgcga gtacatcgac gtggagctgt ggctgcccga ggagatccgg       900
     cggcggctgg ccgagcaaaa gggccacagc gtgatcatgt cggcgttcca tgacttctcg       960
     ggcacgtgga agtggacgtc gcccgaggcg gcgcgcatct tcgcggagag cgcccggtac      1020
     gcggatatcg tcaagatgat cgccatggtc cacacgatcg aggccaacta cgagctggag      1080
     tacttccggt cgacggtcaa ggcgcgcggg gcgggcgact cgtccccgct gctgtcggcg      1140
     gtcaacatgg gccagatggg tcagctgtcg cgcgcgctca acacggtctt ctcgcccatc      1200
     acgcacccgc tgctgccgat gattgcggcc ccggggcagc tgaccgcggc cgagatcaac      1260
     gaggcgatgc acatcatggg cgccctgccg aagcgcgatc tctacgtgat cgggtcgttc      1320
     cgggcgacgc cgcagtccat gttcatggag aagtgtttta acgagctgag cctgccgcac      1380
     acgctgacgt ccatcgaccg cggccccaag ggcacgatcg aaggcgtgat catgcagccc      1440
     agcttcggcg gcgcctcggt caacccgccc atctcggccg cgacgccgta cattcccgcc      1500
     gtcagcgagg ccgcgcgggc gatcgggttg gtggatacca ttgtcgtggg ggagtcacag      1560
     tcgcagtcac agtcgcagtc gcaatcgcaa tcacaatcgc aatcgcaatc gcaaccgcac      1620
     ggaccaccaa cggcgagaac gttaattggg gagaacgcca cgtggaaggg aattcgggcg      1680
     acgctcacac gcgactacgt gccgtcagcc taccgaggcc gggcggcgat catcctagca      1740
     gggtcggaaa gcgatgcatc ggcggcgatc tatgcgctgc gcagtctcgg ggtgggctcg      1800
     atctacactg tgggattccg ggcgaccgga ccgctggcgg cgggactgga gccctttacc      1860
     tcgatccagt cggtcaagct ggtcgagcag ccatttgtga tggtgtccgc gctgccgccg      1920
     gagaagtcgc tcctggtgca gccgctgctg cgacactacc gcagcaacgg gcgcacatcc      1980
     ccgcggtcga cgcggggcaa agtgtatctg gacctgacgg cgagctcggg ggagcgcaag      2040
     ggggatccgg ttggggtagc ggtgaatgcg ggctggacgg cgtacgggat cgacgaggtg      2100
     acggcatgga cgacggtgga aacgatgcgg ctgctggtgg gacagaatgt gccgtttgat      2160
     tttgtgcgca tggcttcggg aagaatttat tag                                   2193
//

If you have problems or comments...

PBIL Back to PBIL home page