(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE430

ASFUM1_4.PE430       Location/Qualifiers
FT   CDS_pept        join(complement(1654195..1654825),
FT                   complement(1651798..1654113),complement(1651487..1651741),
FT                   complement(1651283..1651422))
FT                   /codon_start=1
FT                   /gene_family="HOG000188011" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750032"
FT                   /orf_name="AFUA_4G06480"
FT                   /product="DDENN domain protein"
FT                   /protein_id="EAL90140.1"
FT                   /db_xref="HOGENOM:HBG054223"
FT                   /db_xref="HOGENOM:HBG324342"
FT                   /db_xref="InterPro:IPR001194"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR005112"
FT                   /db_xref="InterPro:IPR005113"
FT                   /db_xref="UniParc:UPI000051FC6C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP4"
FT                   /transl_table=1
FT                   /translation="MPYSSTPEASTTPLADYFWIAGVDGTEVLETFRRLGDEYRANSAT
FT                   SPGPALTDTIEEDADAEEAHDSRFDGLSRPNSTLPGWNSFQRFSMRSENAAEGNANGSN
FT                   SNRSSLTIKGAQSPRGSSFLEDFDFDKALFKFASERDSFLSDLSLSAGAITPASRPRSR
FT                   LRTQKITAEETPSQPSSLLRSGIGSVRRHMAFRDMNSMKRQPSVARQASIRTSRRLSNY
FT                   NSVIPAPQPLEFSPTMHPLKRRFEPVLLDRYPTKGMTEELKQRGTFPDYVPMFAFPNDI
FT                   NIVSSDQRPRSTWHGFTMTTDNGSRLHAICVIIWIPLNQRAAEELEKRCEEWRKENMTD
FT                   EERELAASLGERLASERAKLSRLLAKLPTVVSGSESREQLEDEISAVEEKIGLMTDLLR
FT                   PVRHGAASKIEGLTDGETGFWIPRAYGILGREENMTSFWKEWLKAIIVPMTDGGVQRVP
FT                   PSSPRMGVWQPLERYVMNLCTEAFSPNSSKTQVELAVRELRLFARKEAVNELPGSRNTD
FT                   LYALFRTLSLSNIIILFEYALTESRIIFLSSHTSMLYLATRALVDLLFPLQWTGVLIPV
FT                   LPARLIQALEAPCPYIVGIERRYEKVELPSDDFVLVDLDADVIESTVQPTPLPRHQRRK
FT                   LLSLLQLAAPHHSRCAVPTGPPAYAIETFPFDAFMSENPSIFNARAQSTQLAKYVSLNS
FT                   SAFGQQSVLPTTFQPLIFNAYLYARNEQAASRGFSSKGSDRPSTGSTSKTGSPPSPRDH
FT                   SPTSGHFPPSSRNDSGMALQASLREKRSGHFDASSRRSSSFGMEMRPGVPRRPSAPFLG
FT                   HAPNLSVTTLNTEYNSGSTYAPSVYAQSTVAASTIVPQSVAQPIHNAEGTCWVEGHCLQ
FT                   VVPADDKAVCAVCDERAEDGMYRCSACKTLVHNRCALQICLVCPAAFHPEQVRAAFVRC
FT                   FASLFYTYKKFLQPATGDKKKAGLTYSFNMEAFLKSLPSEHAEYIAVLQHTQGFNEFIG
FT                   ERERVNPKSKDPRLALFDEIVLSKRNRGRSSLFSSRTTTDFLSDTSNHLWRTASATSFP
FT                   PSSRGQQTLSGDYTRIVTRAPAKLDTSLMKEPRMINGAPRVSKTANNARRKPLPNLMNG
FT                   LAISPP"
     atgccttact cttccacccc cgaggcgtca accacgcctc ttgcggacta cttttggata        60
     gctggcgtgg atggcacaga ggtactagag acctttcgaa ggttgggcga tgaatacagg       120
     gcaaacagcg ccacttctcc tggtcccgct ctcacagata ccattgagga ggatgcggac       180
     gctgaggagg ctcacgactc ccgtttcgac gggctctcga gacccaattc gactttgccc       240
     ggctggaact catttcagcg gttctccatg cgctcggaaa acgccgccga gggaaacgcg       300
     aacggctcca acagcaatcg aagcagcctg acgatcaagg gtgcgcaatc ccctcggggc       360
     tcgtcgtttc tggaggactt tgacttcgac aaggcgctgt tcaagttcgc gtccgagaga       420
     gactcgttcc tgtccgacct gagcctcagt gccggggcca tcacgcccgc ctcacgcccc       480
     cggtcgcggt tgcgcacgca gaagatcacc gccgaggaga ctccatcaca gccgtcgagc       540
     ctactacgat ctgggatcgg tagcgtacga cgacacatgg ccttccggga tatgaacagt       600
     atgaagcggc agccgtcggt tgcccgtcaa gcttccattc gtacttcacg gcgtctcagc       660
     aattacaact ctgtcatccc cgctccgcaa cccctagaat tctcccccac catgcaccct       720
     ctgaagcggc gattcgagcc cgttcttctc gatcgatatc caacaaaagg tatgacggag       780
     gagctgaagc agcgcggaac cttcccggat tacgtcccga tgtttgcctt tcccaatgat       840
     atcaatatcg tgtcttccga ccagcggcct cgatccacgt ggcatgggtt caccatgacg       900
     actgacaacg ggtcccgact gcatgcaatc tgcgtaatca tctggatccc tctgaaccaa       960
     cgagcggccg aagagttgga gaagcgctgt gaagagtgga ggaaagagaa catgacggac      1020
     gaggagcgag agctggcagc gagtctcggg gaacggctgg cctccgagcg ggccaagctg      1080
     tcacggctcc tggcgaagct tcccaccgtc gtgtccgggt cggagtcgag agaacagttg      1140
     gaggatgaga tcagcgcggt ggaagagaag attggactca tgaccgatct gctccggccg      1200
     gtgcgccacg gggcggcgtc aaagatcgaa ggcttgaccg acggagaaac cggtttctgg      1260
     atcccccgcg catatggcat tttggggcgt gaggagaaca tgactagctt ctggaaggag      1320
     tggttgaagg ccatcattgt ccccatgacc gacggcggcg ttcagcgagt cccccccagc      1380
     tcgccgcgca tgggcgtctg gcaacccttg gagcgatacg tgatgaatct gtgcaccgag      1440
     gcattcagcc ccaactcgtc caagacgcag gtcgagctgg ccgtccggga gctgcgcctc      1500
     ttcgcacgca aggaggcggt caatgagctg cccgggtccc gaaacacgga tctctatgcg      1560
     ttgttccgga cgctgtccct gtcaaacatc atcattttgt tcgagtacgc cctgaccgag      1620
     tcccgcatca tctttctctc gtcccacacg tcgatgctct acctggccac cagagccctc      1680
     gtcgacctgc tcttcccgct ccagtggacc ggtgtgctga ttcccgtgct cccagcacgg      1740
     ttgatccagg ccctggaggc cccctgtccg tacattgtgg ggatcgagcg tcgatatgag      1800
     aaggtcgaat tgccgtccga tgactttgtc ctggtggatc tggatgccga cgtgatcgag      1860
     agcacagtgc agccgacgcc cctgccgcgt catcagcgcc ggaagctgct gtcgctgctc      1920
     cagctggccg ctccccacca cagtcggtgc gcggtcccca ctggccctcc agcttacgca      1980
     atcgagacgt tccccttcga tgcctttatg tcggaaaacc cgtccatctt caacgcccgg      2040
     gcgcagtcca cgcaactggc caagtatgtc agtctcaatt cgagtgcgtt tggtcaacag      2100
     tctgtgctgc cgactacgtt ccagccactc atcttcaacg cgtatctgta tgcacgtaac      2160
     gagcaagcgg cgtccagggg cttctcatcc aaaggctccg accgaccgag caccgggtcc      2220
     acgtccaaga ccgggtcacc cccttccccg agggaccatt caccgacctc gggccacttc      2280
     ccgcccagct cccggaacga ttcgggaatg gctctgcagg cttcgctgcg ggagaaacgg      2340
     tcgggccatt ttgatgcctc atcccggcga agctcgtcct ttggcatgga gatgaggccg      2400
     ggtgttccga gacggccgag tgctcctttc cttggtcatg cgcccaacct gtcagtcacc      2460
     acgttgaaca cggaatacaa ctcgggctcc acctatgcac cgtccgtcta tgctcagtcc      2520
     acggtggcag cctcgacgat cgtgccgcag tctgtcgcgc agcccatcca caatgccgag      2580
     ggcacgtgct gggttgaggg ccactgcctc caggtggtcc cggccgatga caaggccgtc      2640
     tgtgccgtgt gcgatgagcg agcggaggac ggcatgtacc gatgcagtgc ctgcaagact      2700
     ctggtgcaca accggtgcgc tctccagatc tgtctggttt gtccggcagc gttccacccg      2760
     gagcaggttc gggccgcctt tgtcagatgt ttcgccagcc tgttttacac gtacaagaag      2820
     ttccttcaac cggccacggg cgacaagaaa aaggcgggtc tgacgtacag ctttaatatg      2880
     gaagcctttt tgaaaagcct gcctagcgag catgcggagt acattgcggt cctgcagcac      2940
     acacaaggtt ttaacgagtt cattggggaa agagaaaggg tgaatcccaa gtcaaaggac      3000
     ccccgactgg ccttgttcga tgagattgtc ctgtcgaaac ggaaccgggg ccgctcttcg      3060
     ctgttttcta gccgtaccac gacggatttc ctatccgata cctcgaacca tctctggcga      3120
     acagccagtg ccacttcgtt tccaccgagc agcaggggtc agcagactct ttcaggggat      3180
     tacactcgca ttgtcactag agccccagcc aagctcgaca ccagcctgat gaaggaaccg      3240
     cgcatgatca atggagcgcc gcgagtgtca aagacggcca acaatgctcg tcggaagcca      3300
     cttcctaatc ttatgaacgg gcttgctatc tcccctccgt ga                         3342
//

If you have problems or comments...

PBIL Back to PBIL home page