(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE431

ASFUM1_4.PE431       Location/Qualifiers
FT   CDS_pept        join(complement(1660622..1660868),
FT                   complement(1658235..1660570),complement(1658031..1658198))
FT                   /codon_start=1
FT                   /gene_family="HOG000188023" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206603"
FT                   /orf_name="AFUA_4G06490"
FT                   /product="DNA mismatch repair protein (Mlh3), putative "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="EAL90139.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG054222"
FT                   /db_xref="HOGENOM:HBG324341"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="UniParc:UPI000051E479"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP5"
FT                   /transl_table=1
FT                   /translation="MPSEDSRIEPLPPEVVAKIKSSTSIINLNRVVVELVKNALDANAR
FT                   TVSVTVDFHRGGCVVEDDGDGIPPAEFESDGGLGKAHHTSKLYSARAVYGRRGLFLASL
FT                   ASLSLLTVISHHVRYNSTNSVIFHHSTPIARFIPAPSSHQLSCSSHGTRVIVNDLFGNM
FT                   PVRVKSRALALQKPDEFERQWDDLRRLLVSLILANDHLTKLVVSTAGKERKLMIRPHVG
FT                   RPGIRGDLDLKRIASILMQAGLIESQNSDSWNYVSASVPGISLRAAVSLVPSPTRKVQF
FT                   ISIGIDPVYPRNSTDLLYSEINRLFALSDFGAVEAAPVSSDGHPGPRFTSKAVNKWPMF
FT                   YIRIDVDDPRELFEEGHEVVPESNQSVQRLIDVLVAMMSEFLKQHGLRPRAGRQTKDVS
FT                   RSASVESPGAGRSNFAKSVSSRDRSSIAEEALAGQLKLPTFRRLTSTNTTSDFATWSRV
FT                   KCAREPPASKHELAGGLKKAHSGPAWESGDRESLSLCLETDDSSVGNNLDLEVTENDGS
FT                   DADASIPWTDPHTGYSHLINARTGQAINVRSPSTEITVDERPRSAGTIQTLRALDRSRP
FT                   RSAISSTSHNIWVESLLRRWENPAFRRPERPITAISDGESHRNMSDNGLIRPFDCSRGS
FT                   YGLDDFGLAKFRGRLSKSHLATANVIAQVDRKFILVKLADGRSSRSALVLIDQHAADER
FT                   CRIESLFGAMFADGHRQVQSIRIDPITFDIPLMEAALFGKHADSFASWGVGYTVERKSS
FT                   ARAALVVVTSLPTLIAERCRLEPDLVSDMIRGEIWKHEENGQGALALSDQRAQRSKVHR
FT                   DELGVETEGNWVDRLTSCPQGIIDLLNSRACRTAIMFNDMLTAEECKSLCAHGRPSMVP
FT                   ILDVRESEEFLGKSIECEYEYEREDGRRQLDFLEAFRSWQGLGGN"
     atgccttcag aggacagcag aatagagcca cttccgccgg aagttgtggc gaagattaaa        60
     tcttctacat ccattatcaa tctaaacaga gtggttgtgg aactcgtcaa gaatgcgctg       120
     gatgcaaatg cacgtacggt ctcggtaacg gttgatttcc accgcggggg atgtgttgtt       180
     gaggatgacg gggatggaat acccccagca gagtttgagt cggatggagg actagggaaa       240
     gcacatcata cctcgaaatt atattcagca agagctgtct acggtcgtag agggctattc       300
     ctcgcttctc tggcttctct ttcactgttg acggtgattt cacaccatgt ccgctacaac       360
     agcaccaaca gtgtcatttt ccatcattcg actccgatcg cacgcttcat tccagcacca       420
     tcatcgcatc agttgagttg cagcagtcat gggacacgcg ttattgtcaa tgacttgttt       480
     ggcaatatgc ccgtacgcgt gaaaagtcga gccctggccc ttcagaaacc cgacgagttc       540
     gagcggcagt gggatgatct ccggagacta ctcgtttctt tgatattggc gaatgaccat       600
     ctcactaaac tggtggtctc taccgctgga aaagagagga aactcatgat tcgcccacac       660
     gttggacgtc caggaataag aggagacttg gatctcaaac gcatcgcttc tatacttatg       720
     caggccggtc tgatcgaatc gcaaaattct gatagctgga attatgtgtc agcaagcgtc       780
     cctggcattt cgttgcgcgc cgctgtatcc cttgtaccta gccccacgag gaaggttcag       840
     tttatctcca ttgggattga cccagtctac ccgcgaaata gcacggacct gctctatagt       900
     gaaatcaacc gcttgtttgc tttgtccgat tttggtgcgg ttgaagcggc ccctgtaagc       960
     agcgatggac acccaggtcc taggtttaca agcaaggcag tgaacaaatg gccgatgttc      1020
     tacattcgca tagacgtcga cgaccctaga gaactctttg aggaaggcca tgaggtggta      1080
     ccggagtcaa accagtctgt ccagcgtctt atagatgtgc ttgtggccat gatgagcgag      1140
     ttcttgaaac aacatggcct acgaccacgt gcagggcgac agacgaaaga tgtgtctagg      1200
     tccgcgagtg ttgagtcgcc aggggccggc aggtccaact ttgcgaaatc ggtatcttca      1260
     cgcgacagat cttccattgc tgaagaagcc ttggcagggc agttgaagct gccgaccttt      1320
     cgaaggctaa cgtcaacgaa cactacttca gattttgcga cttggtctag ggtcaaatgt      1380
     gcgagagagc cgcctgctag taaacatgaa ttggccggtg ggttgaagaa agcgcattca      1440
     gggcctgctt gggagtccgg cgatagagaa tcgctatcat tatgtctaga gacagatgat      1500
     tcatcggtcg gtaacaattt ggatctggag gttactgaaa acgacgggtc ggatgccgat      1560
     gcgtcgatac catggactga cccccatact ggatattctc atttgatcaa tgcaagaacg      1620
     ggccaagcaa ttaatgtcag gtcaccatct actgaaatta cagtcgacga gcgcccccga      1680
     tctgctggaa caattcagac actgcgagcg ctcgataggt caaggccaag gtcggcaatc      1740
     tcaagcacaa gtcataatat ctgggtcgag agcctcttga gaagatggga aaaccctgct      1800
     ttccgtcgac cggaaaggcc aataaccgcg attagcgacg gtgaaagtca cagaaacatg      1860
     agtgataatg gtctcattcg gccttttgac tgctcaagag ggtcttacgg attggatgat      1920
     tttggattgg cgaaattccg aggccgatta agcaagagtc atctagcgac ggccaacgtc      1980
     attgcacagg tggatcgaaa gtttatcctc gtaaagctcg ccgatggccg tagctcacgg      2040
     tcggccttgg tcttgattga tcagcatgct gcggatgaac gatgtcgaat tgagagcctt      2100
     tttggagcca tgttcgctga cggtcatcgc caagttcaaa gcatcaggat tgaccctatt      2160
     actttcgata tcccgctcat ggaagccgct ctttttggaa agcatgccga ctcttttgca      2220
     tcttggggtg ttgggtacac tgtcgagcgg aaatcatcag ctagagctgc cctcgttgta      2280
     gtgacttcac ttcccacgct gattgccgag cggtgtcgat tagaacccga cctggtcagc      2340
     gacatgatcc gcggcgagat atggaaacat gaagagaacg gacagggagc tttggctctt      2400
     agcgatcaac gagcccagag atccaaggtg catcgggacg agttgggggt tgagactgag      2460
     ggtaactggg tggaccgatt gacgagttgc cctcagggga taattgactt gctgaactct      2520
     cgggcatgca gaacagcaat catgttcaat gatatgctga cagccgagga gtgcaaaagt      2580
     ctttgcgctc atggacggcc gtctatggtc ccgattcttg atgtgaggga aagtgaggag      2640
     ttcttaggaa agagtattga atgcgaatat gaatatgaaa gggaagacgg tcgacgacag      2700
     ctggattttc tcgaggcttt tcgatcttgg cagggtcttg gtggcaactg a               2751
//

If you have problems or comments...

PBIL Back to PBIL home page