(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE433

ASFUM1_4.PE433       Location/Qualifiers
FT   CDS_pept        join(complement(1665777..1665896),
FT                   complement(1664459..1665712))
FT                   /codon_start=1
FT                   /gene_family="HOG000188045" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055345"
FT                   /orf_name="AFUA_4G06510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90137.1"
FT                   /db_xref="HOGENOM:HBG054220"
FT                   /db_xref="UniParc:UPI00005207E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP7"
FT                   /transl_table=1
FT                   /translation="MREASKQTVAVIGSGMAGLVAAFLLHRDSKGRYRVEVFEKQDQLS
FT                   LDSASYTLEAATDELPHRVDIPMRAFDDNYHINLKRMYDFLGIDYVSPKFLYSLSRICP
FT                   SSGKREPPYFIHSSSNHQVPPIRPRSRSRMDWIAETLYLTVCYFWFIVCCFVIGPKGKS
FT                   VSCGDESFRRYLERIRLPQYFSRRYLLPLLSSMTTCSHAELLDFPAIDVVDYATRTYRQ
FT                   PHYTVVGGVHRVQARISDGLAIRLHSTVTAVEAAGTRCRITWIDSQNDKVSSAEYDHVI
FT                   MAVTPDVVAAIFKPLEKPLRSIPTVKGDCIVHCDTSILPDGGLLCTEAKKALEPPEIMY
FT                   MVSDNNSTESVHIHRSSVMVTNFPIEPINSNKIIHRARLTRVLRTVRSREVVNRIFSAS
FT                   QSQNTLSEKEQLWRNGDGNVWLVGAWCWDGMVLLEGCIVSAMRVAACLGVDIPWSKEE"
     atgcgcgagg cttcaaaaca aaccgtcgct gtcatcggtt ctgggatggc aggcctggtg        60
     gcggcgttcc ttctccaccg cgacagcaaa gggagataca gggtggaagt gtttgaaaag       120
     caagaccaat tgtcattaga ttcagcatca tacaccctgg aagcggccac cgatgaactc       180
     cctcaccgcg tcgatatacc gatgcgcgcg ttcgatgata actatcacat caacttgaag       240
     cgaatgtacg acttccttgg tatcgattac gtatcgccca agtttcttta ttccctatcc       300
     cgaatttgtc cttccagcgg aaagagagag cctccttatt ttattcactc atccagcaac       360
     caccaagtac caccgatccg tcctagatcc cggagtcgca tggactggat tgccgaaacg       420
     ttatatttga cagtttgcta cttctggttc attgtgtgct gttttgttat tgggccgaaa       480
     ggaaaatctg tgtcctgtgg ggacgaatcg ttccgacgct accttgagcg gatacgattg       540
     cctcagtatt tctccaggcg ctatctattg ccgttactgt caagcatgac cacttgttcg       600
     catgctgagc ttctcgattt tccagctatt gatgtcgtag actacgcgac gagaacatac       660
     cgtcagccgc attacactgt cgtgggcggc gttcatcgtg ttcaggcaag aatatccgac       720
     ggactagcca ttaggcttca ctcaactgtc actgctgtcg aggctgctgg aacgaggtgt       780
     cgtatcacat ggatcgattc ccagaatgac aaagtgtcct cagcagaata cgatcatgtt       840
     atcatggctg tcactcctga tgtagtggct gctatattca agccgctaga gaaacctcta       900
     cggtcaatcc ccaccgttaa aggagactgc attgttcatt gcgatacatc tattcttcct       960
     gatggcggtt tgctatgtac agaagctaag aaagcactgg agccgccgga gattatgtat      1020
     atggtttccg acaacaactc aaccgaatct gtccacatcc atcgttcttc tgtcatggtg      1080
     acaaattttc caattgagcc catcaattcg aacaaaataa ttcaccgcgc acgtctgact      1140
     cgggtattac ggactgtgag gagtagagaa gtggtgaaca gaatattttc cgcgagccag      1200
     tcccaaaaca ccctctcgga aaaagaacaa ttgtggcgca atggggatgg gaacgtgtgg      1260
     cttgttggcg catggtgctg ggatggcatg gtgcttcttg aaggatgtat tgtgtccgcc      1320
     atgagggttg cagcatgcct gggtgtcgat ataccgtggt caaaggaaga atga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page