(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE434

ASFUM1_4.PE434       Location/Qualifiers
FT   CDS_pept        join(1669026..1669059,1669118..1670427)
FT                   /codon_start=1
FT                   /gene_family="HOG000188034" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750033"
FT                   /orf_name="AFUA_4G06520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90136.2"
FT                   /db_xref="HOGENOM:HBG054219"
FT                   /db_xref="HOGENOM:HBG324338"
FT                   /db_xref="UniParc:UPI0000F51C34"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP8"
FT                   /transl_table=1
FT                   /translation="MATADVPARTHVRSGRRHPFSSWMKRLTGLKGSSTDSGTIRWSHK
FT                   RHDAHKNKRNNKNNPYPLSGTTNVVREYSSDFVPSVSDTNAANGPRSCSYSEPSIACSG
FT                   HDNQVPATSAKSTAPTISTNGDTAISEAAYSKSGTMATAGGGISSQGGGEGSTFSSPAP
FT                   SVRSLTTTLTTVQSAAPSIHFYNVQSTHQGLAHANSTHSNASQQVQFSQPFPSSPATAV
FT                   PPHLVPHGHSHTYSTATANNILTDNASILTLASSSKRRRRNSLDTNASVRALAPSSVFG
FT                   GSRESLPLSVLSANVGEPSNTSTFSTPGVLNRPSMVGLASAERISVYSASGAIASGERG
FT                   SYHNKPNPGAGDGASVKSAAYSHSRNDSYAASISGGMGVAIASGSVNQPMTGRVSRRSS
FT                   GWGEITGDECDREKEDKEERPAELKEEDSFDDVPEGTTETTTTVTTKN"
     atggccacag ctgatgtccc tgcgcggact catgttcgca gtggacgtcg ccacccattt        60
     tctagctgga tgaagagact taccggtctg aagggctcct cgaccgattc gggcacaatt       120
     cgctggtccc ataaacgtca tgacgctcac aagaacaaga gaaacaataa gaacaaccct       180
     tacccgctct ccggtaccac gaacgttgtc agggaataca gcagtgattt cgtgccctcc       240
     gtatcggata caaatgctgc gaatgggcca cgatcgtgct catatagtga accttccatt       300
     gcctgttccg gacacgacaa tcaggtgcct gcgacaagtg caaagtcaac ggctccgacc       360
     atctcaacga atggggacac cgccatctca gaggcagcat attccaagtc aggaacgatg       420
     gcgacagcag gaggagggat tagctctcag ggcggaggcg aaggaagcac cttctcttcg       480
     cccgcgccgt cggtccgttc gttgacaact accttgacta ccgtgcaatc cgccgcgcca       540
     tccatccact tctacaacgt gcaaagtaca catcagggcc tagcacatgc gaactcgacg       600
     cacagcaacg cgagtcaaca agtacaattt tcccagccat ttccttcctc ccccgcgacc       660
     gcagtgccac cccaccttgt ccctcacggt cactcccata catacagcac tgcgactgcc       720
     aacaatatcc ttactgacaa tgcatccatc ctcacccttg cttcgtcttc aaaacggcgc       780
     cgcaggaact cgctggatac gaacgcatcg gtccgcgctc tcgcgccgtc ctctgtattt       840
     ggtgggagtc gggagagcct gccactgagc gtgctcagtg caaatgttgg agagccatcc       900
     aacacgtcca cattcagtac acccggggta ctcaatcgtc ctagcatggt gggtcttgct       960
     agcgcggaac ggattagtgt atactcagcg tctggtgcga tcgcgagcgg cgagcgaggg      1020
     agctaccata acaagccgaa tccaggcgcg ggggatggtg caagtgtcaa gagtgcagcg      1080
     tattcgcaca gtcgcaacga cagctatgcg gcgagcatct caggcgggat gggtgtcgcg      1140
     atcgccagcg ggtccgtcaa tcagcccatg acggggaggg tcagtcgtcg cagctcaggg      1200
     tggggtgaga taactggcga tgaatgcgac cgggagaaag aggacaagga agagcggcca      1260
     gcagaattga aagaggagga ctcctttgat gatgtgcctg aagggacgac tgagacgaca      1320
     acgactgtga cgacaaagaa ttga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page