(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE435

ASFUM1_4.PE435       Location/Qualifiers
FT   CDS_pept        join(complement(1674221..1674518),
FT                   complement(1673002..1673621))
FT                   /codon_start=1
FT                   /gene_family="HOG000188067" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260082"
FT                   /orf_name="AFUA_4G06530"
FT                   /product="BZIP transcription factor (MetR), putative "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL90135.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG054218"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI000051FEB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP9"
FT                   /transl_table=1
FT                   /translation="MSGYNGRRAPNFSQYLEDLNAIPSPYDQALQQQQRQDTFNLDAEL
FT                   SLFTNTEFFDFDNLGDLNLPSFDAVNEDSAKTTDQQHGGPAAHNPDMEFLDLLGDGFGN
FT                   MPDFSAANLNSINSQFPAQDTQFSTIPSIPSGLSNAPFNANPTPSQSSSSAASPAGPAT
FT                   SPIAAQAPSATTAAGPKRKNTQKPAPMSVEEAARIAAEEDKRRRNTAASARFRVKKKLR
FT                   EQALEKTVKETTEKNAALEARVTALELENQWLKNLITEKNGKSAEETKKSETDIANMFK
FT                   KFLSSQKADAERSSSESKIGVGTA"
     atgtccggtt acaacggccg ccgtgcgccc aacttctctc aatacctcga ggatttgaat        60
     gccattccct cgccgtacga ccaggccttg cagcagcaac agagacaaga tactttcaac       120
     ctcgatgctg aactctcatt gttcacaaat accgagttct tcgatttcga caatctcgga       180
     gacctcaacc tgccttcgtt tgatgccgtg aatgaagaca gtgcaaagac aacggaccag       240
     cagcatggag gacctgctgc ccacaatccc gatatggagt ttctggatct tctaggggat       300
     ggtttcggca acatgcccga tttttcggca gccaacttga actcgatcaa ttctcagttt       360
     ccggctcaag atacgcaatt ctcaacgatc ccatcaattc cttcagggct ttcaaatgca       420
     cccttcaacg ccaaccccac gccgagtcag tcgagctcgt ctgcagcatc gcccgctggc       480
     ccagctacca gcccaatagc tgctcaagcc ccctctgcaa caactgcggc gggacccaag       540
     cgcaagaaca cgcaaaagcc ggcacctatg agcgtggagg aggcagcccg cattgctgcg       600
     gaggaggaca agcgtcggcg gaacacggct gctagcgcgc gattccgcgt caagaagaag       660
     ctccgggaac aagcgctgga gaagacagtc aaggagacca ccgagaagaa tgccgctctt       720
     gaggcccgcg tgaccgcgct ggagctggag aatcaatggc tgaagaacct gatcacagag       780
     aagaacggca aatcggcgga ggagaccaag aagtccgaga ccgacattgc aaacatgttc       840
     aagaagttcc tttcgtctca gaaggccgac gctgaacgga gtagttccga gtccaagatc       900
     ggtgttggca ctgcgtga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page