(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE436

ASFUM1_4.PE436       Location/Qualifiers
FT   CDS_pept        1677281..1678693
FT                   /codon_start=1
FT                   /gene_family="HOG000188100" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902022"
FT                   /orf_name="AFUA_4G06540"
FT                   /product="CHL4 family chromosome segregation protein,
FT                   putative"
FT                   /protein_id="EAL90134.1"
FT                   /db_xref="HOGENOM:HBG054217"
FT                   /db_xref="HOGENOM:HBG324336"
FT                   /db_xref="InterPro:IPR007902"
FT                   /db_xref="UniParc:UPI000051E464"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ0"
FT                   /transl_table=1
FT                   /translation="MARPKAIRAPTAASLPNTLRLPSSTSSLIKSFSRLSRHALLDLVF
FT                   QWLDDRNAQLFPPYLQKDEIENPADDKLSPYPAAETIEDVRNAYQDLQDRKGGKREVID
FT                   RILEGDWRHGITLRQLAMVDIRYMEDHPASLRWTAFELSRIGMDGTQSAGATTPDVSAC
FT                   LPRIHATTFLSNLQQQISPLVKAHYHLVRSSSLPLSFLRILVTSSPYQNPRQPPEALMD
FT                   SSRVMYVAFPDSCPFIYTSIATSPVAKSNTTTNHAVATDARSLQRIVRDALPKALSRPQ
FT                   ERYALKATSLTAKNLQALLALRGPGRSNVAHGAFSIFADAVLEGSPLDPRPSDTISPRE
FT                   HFYQDLDKENENQEDGNTSKETEPSSHVAKKRKLAVHSRFGTTGTLSSAPLDRLDVRLL
FT                   DPADDEDDEHEVDHTQPSVSLTFVGSDVISGIRKLAELGVVDPERMPSWMTGEEAVSVA
FT                   VVHRGKRVVKAG"
     atggcgcgtc caaaggctat ccgtgcgcct acagccgcca gtctacccaa cactctgcgt        60
     ctcccctcct cgacctcgtc tctcataaag tcattctcac gactatcacg ccacgctctg       120
     ctggacctag tcttccagtg gctcgatgat cgcaacgcac aattgtttcc accatatctt       180
     cagaaagacg agatcgagaa ccccgccgac gataaactca gcccgtaccc ggccgccgaa       240
     acgatcgagg acgtccggaa tgcttaccag gatctacaag acaggaaggg cggcaaacgc       300
     gaagtgattg atcgtatatt ggagggcgac tggcgacacg gtatcaccct gcgacaactg       360
     gcaatggtgg acattcggta catggaagat catcccgcaa gtctgcgatg gacagcattt       420
     gaactcagtc gcattggcat ggacggaact caatccgcag gagcaacaac gcccgacgtt       480
     tccgcatgtc taccgcgcat ccacgccacc acgttcctga gcaaccttca acagcagatt       540
     tctcctctgg tgaaagcgca ttaccatctc gtccgctcgt cctcgcttcc gctctcgttc       600
     ttgcgcattc tagtgaccag ttctccatac caaaaccctc gccagccacc tgaggctctg       660
     atggactcat ctcgagtgat gtacgtggct ttccccgaca gttgcccttt catctacacg       720
     tccatagcaa catcgcctgt cgcaaaatcc aatacaacca ccaaccatgc cgtcgcaacc       780
     gatgctcgaa gtctgcagcg cattgtccga gacgctttac ccaaagcatt atcacgacct       840
     caagagcgat atgccctgaa agcgacctct ctaacagcga agaacctgca agcgctgctg       900
     gcgctccgtg gtcctggaag atccaacgtg gcccatgggg cgttcagtat attcgcggac       960
     gcggtactcg aagggagtcc cttggaccca cgtccgtcgg atacgatatc tcccagagag      1020
     cacttctacc aagacttaga caaggagaac gaaaaccaag aggacggcaa cacgagcaaa      1080
     gagacggagc ctagttccca tgttgctaag aagcgcaaat tagctgtcca ttctcgtttt      1140
     ggcacaactg gaaccctctc gtctgcccct ctggaccgcc tcgacgtgcg cctgcttgat      1200
     ccagcagacg atgaggatga cgaacatgag gtggaccaca cgcaaccatc agtatcactc      1260
     acatttgtcg gctcggacgt catcagtggt atccgcaagc tcgccgaact gggtgtcgtt      1320
     gacccggagc gtatgccgtc ctggatgacg ggcgaagaag cagtcagcgt agctgtcgtt      1380
     catcgaggaa aacgtgtagt caaagctggt tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page