(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE439

ASFUM1_4.PE439       Location/Qualifiers
FT   CDS_pept        join(complement(1686422..1686967),
FT                   complement(1683411..1686368))
FT                   /codon_start=1
FT                   /gene_family="HOG000188111" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902271"
FT                   /orf_name="AFUA_4G06570"
FT                   /product="Ras guanine-nucleotide exchange protein, putative"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL90131.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG324332"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="UniParc:UPI000051FC5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ3"
FT                   /transl_table=1
FT                   /translation="MEPMKRHIAPLKVEKTITNPCGSTTSESGDPSSNHHYSTQHSLQL
FT                   SPPLTPYCATSSKDNSMDRTEAPRAVFHNYLRAFYPFHPPGDVSPDTITLPLDQGDIIL
FT                   VHSVHTNGWADGTLLDTGARGWLPTNYCEAYDQLPMRPLLKALTDFWDIIRGGCGSSLR
FT                   DFGNQDLVRGLIAGVRFLLEKSECLTRDSFLVRRHEGLRRNRKALLSDLTALVRTTKSF
FT                   QVIASGNPLQDEVEYMVDEMLLKAFRVVTRGVRFLDIWNEEVGLSRTIAELEQSKDHTS
FT                   PLTPASETFVMSEKAPSEAETERNESRVLNSSRMSMSRCSTRVDMSEQPRPVSVATKRI
FT                   SISHRVSYSGPAAASRNPNLASERLNATYDAFLGVLGSFIGLHLQSRSSTELVVTTEQA
FT                   VRSCRGLLTVVEAVCEHDSQGSSLLESAKDAMYERLSELVFAARDAFRPAQSPDDELVF
FT                   MPDEGKRLVDAATDCVRAAGNCLAKARLVLEQVGDFELEALPQDVATPLVGAGPESQSQ
FT                   QQKGDQPELSMRLPPPPLQIPQNADLDSSPPTPGLTDDTTPSSSFNSRNLSNPTIAATD
FT                   EASLPSANIPPPSPAKSSFSSSCDAAAGVKVLENRISHPKSEIGESFGRGVTSTGSSFT
FT                   YHSHLRDSEMSGVSQTSTRATSPDIGSCYQAPSLKSCVSHSTLAEEGEETEVNILEKTY
FT                   AHELIFKDGQVMGGSLRALIERLTSHGSTPDAMFVSTFYLTFRLFATPLEFAEALVERF
FT                   NYIGDTPHAAGPVRLRVYNVFKGWLESHWRHDCDDSALDFIVNFAKTTLMQSLPSAGKR
FT                   LLELTDKVSTLQGPVVPRLISSIGKTNTATAQYVHPDTPLPPPILSKKEVNLLKQWKNG
FT                   EAAISILDFDPLELARQLTIKESRIFCAILPEELLATEWMKKSASLAVNVRAMSTLSTD
FT                   LAHLVADSILQLEEPKKRAAIIKQWVKIANKCLELNNYDTLMAIICSLNSSMISRLKRT
FT                   WEVVSQKTKATLETLRGIVDVSRNYAVLRQRLQTHVPPCLPFVGTYLTDLTFVDHGNQP
FT                   LRSLPTDDGEMTVINFDKHMKTAKIISELQRFQVPYRLTEVPELQTWMQNELVRVRSNG
FT                   EKSLQTFYRRSLILEPREITPRPNLQPESSASSIMENARDKFDLFAWTHPSKAKSVATN
FT                   S"
     atggaaccaa tgaagcgaca cattgcgccg ttaaaagtcg aaaagacaat caccaatcct        60
     tgcgggtcga ccacttcaga gtctggagac ccttctagca atcatcacta ttctacacag       120
     cacagtctgc agttgtcacc acctctgacg ccttactgcg caacctcgtc caaagacaac       180
     agcatggatc ggacggaggc ccccagggcc gtcttccaca actatctacg cgcattctat       240
     ccgttccatc cgccgggaga tgtttcgccg gatacgatta ccctgccatt ggaccaagga       300
     gatatcattc tggtgcactc ggtacacaca aatggctggg ctgacggaac gcttctggac       360
     accggagccc ggggctggct acccaccaat tactgcgaag cctacgacca gctacctatg       420
     aggcctcttc tgaaggcatt gaccgatttc tgggatatta tccgaggcgg atgcgggtcg       480
     tctcttcgtg actttggaaa tcaggatctt gtaagaggcc tgattgccgg agtacgtttc       540
     cttctggaaa aatcagaatg tctcacccgc gactcgttcc ttgtccgaag gcacgagggt       600
     ctgcgaagaa accgaaaagc attgctttcg gaccttacag cgcttgttcg tacaactaag       660
     agtttccaag tgattgctag cggaaacccc ttacaagacg aggtcgagta catggtcgat       720
     gagatgcttc tcaaagcgtt ccgcgttgtg acccgcggtg tgcggtttct cgatatctgg       780
     aacgaggagg ttggtctgag tcgaacaatc gcggagctgg agcaaagcaa ggatcatact       840
     tctcccctta cacctgcatc cgagacattt gtcatgtcgg aaaaggcccc ctcggaggct       900
     gagactgaac gaaacgagtc gcgagttctc aacagcagcc gcatgtcgat gagtcgctgt       960
     tccacccggg tagacatgtc ggagcagcca cggcccgttt ccgtcgctac aaaacggata      1020
     tccatctccc accgggtgtc ttactcggga cctgctgcag cttcccgaaa cccgaatctc      1080
     gcatcggaac gactcaacgc cacgtacgat gctttcctcg gcgtgcttgg ttcattcatt      1140
     ggtctccacc tgcagtctcg ctcctcaacc gagctagtcg tcaccaccga gcaggctgtc      1200
     cggtcctgcc ggggtctgct cactgtggtc gaggccgtct gcgaacacga ctctcaaggc      1260
     agttcgctcc tcgagagcgc caaggatgcg atgtatgagc gactgtccga gctcgttttc      1320
     gctgcacggg acgccttccg acccgcccaa tcccccgatg acgagcttgt cttcatgccc      1380
     gatgaaggaa agcgactggt cgacgccgcc accgactgcg tccgagcggc agggaactgt      1440
     ctggccaaag ctcgcctggt gctggagcag gttggagatt tcgaactcga ggcactgccg      1500
     caagacgttg cgacgccatt ggttggtgct ggacccgagt cgcaatcgca acagcagaaa      1560
     ggcgaccagc ctgagctatc catgcgactc ccaccacctc ccctgcagat cccccagaac      1620
     gcagatctcg actcttcccc tcccacccca ggtcttaccg acgataccac tccatcttct      1680
     tctttcaact cccgcaacct cagtaacccc accattgctg caactgacga ggcgtcattg      1740
     ccatccgcta acatccctcc ccccagccca gcgaagtcct cgttctcctc gtcttgtgat      1800
     gcggcggctg gtgtcaaggt actcgagaac cgtatcagcc atcccaagtc cgagatcggc      1860
     gagtcgtttg gccgtggagt gaccagtact ggaagcagct tcacctacca cagccacctc      1920
     cgggactccg aaatgagtgg agtgtctcaa acttctactc gcgccacatc cccagacatt      1980
     ggcagctgct accaggctcc atcgctcaag agctgtgtca gccactcgac gctggcggag      2040
     gagggagagg agaccgaagt gaatattctg gagaagactt atgcgcatga attgatcttc      2100
     aaggacggtc aagtcatggg cggcagtctt cgggcactga tcgagaggct cacctctcat      2160
     ggatcaacgc cagacgccat gtttgtctcg accttttacc tcaccttccg tctatttgcg      2220
     acgccgctgg agtttgccga ggcccttgtt gagcggttca actacattgg cgatacgccg      2280
     cacgccgcgg gacccgtgcg tctccgcgtg tacaacgtgt tcaagggttg gctggagtca      2340
     cactggcgtc atgactgcga tgactcggct ctagatttta ttgtcaattt tgccaaaact      2400
     actttgatgc aatccctccc ctccgccgga aaacgccttc tagaactgac ggacaaggtt      2460
     tcgacgctcc agggacccgt tgtgccccgt ctcatctcgt ccataggaaa gaccaacacc      2520
     gcaaccgcac aatatgtgca cccggacacc ccgctccccc ctcccattct cagcaagaag      2580
     gaggtgaacc ttctgaaaca gtggaagaat ggcgaggctg cgatcagcat cctggacttt      2640
     gatccattgg agctggcccg tcagctcacc atcaaggagt cacgcatctt ttgtgcaatt      2700
     ctccccgagg agctgttggc gacagagtgg atgaaaaaga gcgcttcact ggccgtcaat      2760
     gtccgtgcca tgtcgacttt gtctaccgat ctcgcccatc tggtggctga ttctatcctg      2820
     cagctggagg aaccgaagaa gcgggcggct atcatcaagc agtgggtcaa gattgctaac      2880
     aagtgcctgg aactcaacaa ctatgacact ttgatggcca ttatctgctc tctgaactca      2940
     tcaatgatct cgcgcctgaa gcggacctgg gaagtggtat cgcagaagac caaagccact      3000
     ctcgagaccc tgcggggcat cgtggatgtg tcgcgcaact acgctgtcct gcggcaaaga      3060
     ctgcaaactc atgttccgcc atgtcttcct ttcgtcggca cctacctcac agatctgacc      3120
     ttcgtagacc acgggaacca gccgctgcga agcctgccta ccgatgacgg cgagatgacc      3180
     gtcatcaact ttgacaagca catgaagacc gccaagatca ttagcgagct ccagcggttc      3240
     caggtcccct accgtcttac cgaagttccc gaacttcaga cctggatgca gaacgagctg      3300
     gtgcgggtgc gttccaatgg cgaaaaaagc ctgcagactt tctatcgtcg ctctctcatt      3360
     ctggagccgc gcgagattac gccgcggccg aatttgcagc ctgagtctag cgcctcctct      3420
     atcatggaga acgccaggga caaatttgac ctcttcgctt ggacgcatcc ctccaaggcc      3480
     aagtcggtcg ctaccaatag ttga                                             3504
//

If you have problems or comments...

PBIL Back to PBIL home page