(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE443

ASFUM1_4.PE443       Location/Qualifiers
FT   CDS_pept        complement(1702474..1703148)
FT                   /codon_start=1
FT                   /gene_family="HOG000188122" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261071"
FT                   /orf_name="AFUA_4G06610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90127.1"
FT                   /db_xref="HOGENOM:HBG054209"
FT                   /db_xref="HOGENOM:HBG324328"
FT                   /db_xref="UniParc:UPI000051E6C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ7"
FT                   /transl_table=1
FT                   /translation="MASAQHFEPDTIINLSGSSQEAAHGTIDIFEWYPHYQSCQRYLLD
FT                   HAQHSVTVQALCAFLNIRLPFQRIPHPVSSSSSKTSTPSAGLTSSVSESSPHPAPFVSL
FT                   IPYIRRLVATGMDSPGVLQGFFGDDWTAGVGYLHEQERRNYLFAAKSGGWAAVKRDYDM
FT                   PPLETIPFLRPLQGTVDSEIEAAERSWSEWLAMEDWMVGPRAPDALRGSSSHMSCPRSS
FT                   GG"
     atggcctccg ctcagcattt cgaacccgac acaataatta acctttctgg gtcgtcccag        60
     gaagcagcgc atggcaccat tgatatcttc gagtggtacc cccactatca aagctgccag       120
     cggtacttac tcgaccatgc acaacatagt gtcaccgttc aagcactgtg cgcgtttttg       180
     aacattcgtc tgcccttcca acgaataccg caccctgtct ccagttcttc aagcaaaaca       240
     tcaacacctt ctgcaggact gacgtcttct gtctcagagt catccccgca tccggccccc       300
     tttgtgtcac tcatccccta tattcgacgt ctagtagcca cgggcatgga ttctcctggg       360
     gtcctccaag gattctttgg tgatgactgg accgcaggtg ttggatatct ccacgaacag       420
     gaacgtcgca actatctctt cgccgcgaag agcggcggct gggctgcggt taagagagat       480
     tacgatatgc ctcctttgga gaccattccc ttcctgcggc ccctgcaagg gacagtggat       540
     tccgagatcg aggccgcgga gagaagttgg agtgagtggc ttgcaatgga agattggatg       600
     gttggacccc gggctcctga tgctctccga ggttcctcct cacatatgtc gtgtcctcgg       660
     agctcaggag ggtga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page