(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE444

ASFUM1_4.PE444       Location/Qualifiers
FT   CDS_pept        join(1708834..1708879,1708941..1710271)
FT                   /codon_start=1
FT                   /gene_family="HOG000243799" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16261072"
FT                   /orf_name="AFUA_4G06620"
FT                   /product="Glutamate/Leucine/Phenylalanine/Valine
FT                   dehydrogenase, putative"
FT                   /EC_number="1.4.1.4"
FT                   /function="binding"
FT                   /function="glutamate dehydrogenase (NADP+) activity "
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL90126.1"
FT                   /db_xref="GO:0004354"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054208"
FT                   /db_xref="HOGENOM:HBG590661"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EDB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ8"
FT                   /transl_table=1
FT                   /translation="MSNLPHEPEFEQAYKELASTLENSTLFEKNPEYRKALAVVSVPER
FT                   VVQFRVVWEDDNHQVQINRGYRVQFNSALGPYKGGLRFHPSVNLSILKFLGFEQIFKNA
FT                   LTGLNMGGGKGGSDFDPKGKSDNEIRRFCVAFMTELCKHIGADTDVPAGDIGVTGREIG
FT                   FLFGQYRKIRNQWEGVLTGKGGSWGGSLIRPEATGYGLVYYVDHMIKYVTKGAESFAGK
FT                   RVAISGSGNVAQFAALKVIELGGSVVSLSDSKGSLVVNGEGSFTPAEIDIIAQLKVDRK
FT                   QLSEVATTEAFATKFKYIEGARPWVHVGKVDVALPSATQNEVSGEEAQALIDAGCKFIA
FT                   EGSNMGCTQAAIDIFEAHRQANPGAAAIWYAPGKAANAGGVAVSGLEMAQNSARISWTA
FT                   EEVDSRLKDIMESCFRNGLDTAVKYATPAEGVLPSLVTGSNIAGFTKVAEAMKEQGDWW
FT                   "
     atgtctaacc ttcctcacga gcccgagttc gagcaggcct acaaggagct tgcctctact        60
     cttgagaact cgactctctt cgagaagaac cctgaatatc gcaaggctct cgccgttgtc       120
     tccgtccccg agcgtgtggt tcagttccgt gtcgtctggg aggatgacaa ccaccaggtc       180
     cagatcaacc gtggttaccg tgtccagttc aactccgctc ttggtcccta caagggtggt       240
     ctccgtttcc acccctccgt taacctgtcc atcctgaagt tccttggttt cgagcagatc       300
     ttcaagaatg ctctgaccgg tctgaacatg ggtggtggca agggtggttc cgacttcgac       360
     cccaagggca agtccgacaa cgagatccgt cgcttctgcg tggccttcat gaccgagctg       420
     tgcaagcaca tcggtgccga caccgacgtc cccgccggtg acattggtgt caccggtcgt       480
     gagatcggtt tcctctttgg ccaataccgc aagatccgca accagtggga gggtgtcctc       540
     accggcaagg gcggtagctg gggtggttct ctgatccgtc ccgaggccac cggctacggt       600
     ctcgtctact acgtcgacca tatgatcaag tatgtcacca agggtgccga gtccttcgcc       660
     ggcaagcgcg tcgccatctc cggctctggt aatgtcgccc agttcgctgc cctcaaggtc       720
     atcgagctcg gcggttccgt cgtctccctg tccgacagca agggctccct ggttgtcaac       780
     ggcgagggca gcttcacccc cgccgagatc gacatcatcg cgcagctcaa ggtcgaccgc       840
     aagcagctct ccgaggtcgc taccaccgag gcctttgcca ccaagttcaa gtacatcgag       900
     ggcgcccgcc cttgggtcca cgtcggcaag gtcgacgtcg ccctcccctc cgccacccag       960
     aacgaggtct ccggcgagga ggcccaggcc ctgatcgacg ccggctgcaa gttcatcgct      1020
     gagggctcca acatgggctg cacccaggcc gccatcgaca tcttcgaggc ccaccgccag      1080
     gctaaccctg gtgccgccgc catctggtac gcccccggca aggccgccaa cgccggcgga      1140
     gtcgccgtct ccggcctcga gatggcccag aactcggccc gcatcagctg gactgctgag      1200
     gaggtcgact ctcgcctcaa ggacatcatg gagtcctgct tccgtaacgg tctcgacacc      1260
     gccgtcaagt acgccactcc cgctgagggt gtcctgcctt ccctggtcac cggtagcaac      1320
     atcgccggtt tcaccaaggt tgccgaggct atgaaggagc agggtgactg gtggtaa         1377
//

If you have problems or comments...

PBIL Back to PBIL home page