(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE447

ASFUM1_4.PE447       Location/Qualifiers
FT   CDS_pept        join(complement(1722248..1722463),
FT                   complement(1721926..1722084))
FT                   /codon_start=1
FT                   /gene_family="HOG000048510" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055582"
FT                   /orf_name="AFUA_4G06660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90122.1"
FT                   /db_xref="HOGENOM:HBG054203"
FT                   /db_xref="UniParc:UPI00005207D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNR2"
FT                   /transl_table=1
FT                   /translation="MTFADRLAKDAARLGKTHPFPLLSRESACLPGNILHQWEQEMEGW
FT                   SPIERSKASFQKHTKEKAIWKPSQELSREVGDVFSSVSSLLGGLTKDKKGKPDTVSREK
FT                   TVKAALDFAEASQWFWSRAP"
     atgacatttg cggatcgact ggctaaggat gccgcgcgcc taggcaaaac gcaccccttc        60
     ccactacttt cgagggagag cgcgtgcctt cctggcaata tcctccatca gtgggaacag       120
     gaaatggagg ggtggtcacc tattgaaaga tcgaaagcat ccttccagaa acatacaaaa       180
     gagaaggcta tatggaagcc ttcccaggaa ctaagtaggg aagtagggga cgtgttcagt       240
     agcgtctcga gtttgctggg aggcttgacc aaagataaga aaggtaaacc agacaccgtc       300
     tcaagggaga agacggtcaa ggccgcctta gacttcgctg aggcatcaca gtggttttgg       360
     agtcgcgcgc catga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page