(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE448

ASFUM1_4.PE448       Location/Qualifiers
FT   CDS_pept        complement(1724024..1724836)
FT                   /codon_start=1
FT                   /gene_family="HOG000188145" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI19055583"
FT                   /orf_name="AFUA_4G06670"
FT                   /product="Allergen Asp f 7"
FT                   /protein_id="EAL90121.1"
FT                   /db_xref="EMBL:CAA11255.1"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR014733"
FT                   /db_xref="UniParc:UPI000051EB74"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42799"
FT                   /transl_table=1
FT                   /translation="MAPIFKSLALVSALFAAISSAAPVNLDKREVDVVWTTVTTVVWTT
FT                   IDVTTTIYPTPQAPTPPVVESTPTPTPSAAPEQAEPIETSTQPETTKSQPTQPSVATFI
FT                   PVAAAAAAADSAAPIPEEPAPQPATTAAPSTSTTTQAAPSAPPAANSGSTEKAASSGYS
FT                   GPCSKGSPCVGQLTYYDTATSASAPSSCGLTNDGFSENVVALPVGIMTDADCGKTVTIT
FT                   YNGITKTATVVDKCMGCKPTDLDASRHLFGELADFSAGRIDGMSWYFN"
     atggctccta tcttcaagtc ccttgcgctc gttagcgctc ttttcgctgc catcagctcg        60
     gccgcccctg tcaaccttga caagcgtgaa gtggacgtag tgtggacaac ggtcaccact       120
     gtcgtctgga ccaccatcga tgtgaccact accatctacc ctactccgca ggcccccact       180
     ccccctgtcg ttgagtctac tccgacccca actccatcag ctgctcccga gcaggccgag       240
     ccgatcgaga cctcaacgca gcccgagacc accaagtctc agcccactca accttctgtc       300
     gctacgttca ttcctgtcgc cgccgccgct gctgctgctg attctgctgc tcccatccct       360
     gaagagccgg ctcctcagcc tgctaccacc gcagctcctt ccacttctac tactacccag       420
     gctgccccgt ccgctccgcc agccgctaac agcggtagca ctgaaaaggc ggccagcagc       480
     ggatacagtg gcccctgctc caagggctca ccctgcgttg gccagctcac gtactatgac       540
     acggctactt ccgccagcgc tcccagcagc tgcggcctga ccaacgacgg cttttctgag       600
     aacgtggtcg cgcttcccgt gggcatcatg actgacgctg actgcggcaa gaccgtgacc       660
     atcacctaca acggtatcac caagaccgct actgtcgtgg acaagtgcat gggttgcaag       720
     cccaccgatc tcgacgcgtc ccggcacttg ttcggcgagc tggctgattt cagtgcgggc       780
     cgtatcgacg gcatgtcgtg gtacttcaac taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page