(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE449

ASFUM1_4.PE449       Location/Qualifiers
FT   CDS_pept        join(complement(1730423..1730441),
FT                   complement(1730142..1730299),complement(1729139..1730079),
FT                   complement(1727623..1729084))
FT                   /codon_start=1
FT                   /gene_family="HOG000057035" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16261073"
FT                   /orf_name="AFUA_4G06690"
FT                   /product="Ribonucleotide reductase large subunit Rnr1,
FT                   putative"
FT                   /EC_number="1.17.4.1"
FT                   /function="ATP binding"
FT                   /function="ribonucleoside-diphosphate reductase activity "
FT                   /biological_process="DNA replication"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="ribonucleoside-diphosphate reductase
FT                   complex"
FT                   /protein_id="EAL90119.1"
FT                   /db_xref="GO:0004748"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005971"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054200"
FT                   /db_xref="HOGENOM:HBG296647"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniParc:UPI000051E6E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNR5"
FT                   /transl_table=1
FT                   /translation="MFVYKRDGRKERVQFDKITARVSRLCYGLDPEHVDAAAITQKVIS
FT                   GVYQGVTTVELDNLAAETAAYMTVTHPDYAILAARIAVSNLHKQTKKQFSLVISDLYHY
FT                   VNPKNKQPAPMISKETYEIVMKHADELNSAIVYDRDFNYNFFGFKTLERSYLLRINGKV
FT                   AERPQHLLMRVAVGIHGNNIEKAIETYHLMSQKYFTHASPTLFNAGTPQPQLASCFLVD
FT                   MKEDSIEGIYDTLKTCAMISKTAGGIGLNVHRIRATGSYIGGTNGSSNGIVPMLRVFNN
FT                   TARYVDQGGNKRPGAFAIYLEPWHADIFEFLDLRKNHGKEEVRARDLFYALWTPDLFMK
FT                   RVESNGDWTLFCPNEAPGLADVYGDEFDALYERYEKEGRGRKTIKAQKLWYAILEAQTE
FT                   TGNPFMLYKDACNKKSNQKNLGTIRSSNLCTEIIEYSAPDEVAVCNLASLALPTFVDAA
FT                   RGEYDFGKLHEVVQVLVRNLNKIIDVNYYPVPEAKKSNMRHRPIALGVNGLADAFLALR
FT                   LPFDSAEARQLNIQIFETIYHGALTASCELAKEFGPYETYEGSPVSQGILQYDMWDRTP
FT                   TDLWDWDSLKAKIAQHGVRNSLLVAPMPTASTSQILGFNECFEPYTSNIYSRRVLAGEF
FT                   QVVNPWLLKDLVDLGLWSDNMKNRIIADGGSVQNIPNIPADIKALYKTVWEISQRTILQ
FT                   MAADRGAFIDQSQSLNIHLKEPTMGKLTSMHFAGWKMGLKTGMYYLRTMAASAPIQFTV
FT                   DQEQLKVADTNVARANAAYKKRAAGSVPTTYSAVPRTTSAPLNGHSEDGSPRALAADVT
FT                   ADSETGVNGSQEEDDERESGERESDIYSQKVLQCSIENKEACLMCQG"
     atgtttgtct acaagagaga cggacgcaaa gaacgcgtac agtttgacaa aatcactgca        60
     cgtgtatcaa gactgtgcta tggtcttgac ccagaacacg tcgatgctgc tgctatcacg       120
     cagaaggtca tctctggtgt ctaccagggt gtcaccactg ttgagctgga taacttggct       180
     gccgagactg ccgcgtacat gaccgtcact caccccgatt atgccatctt agctgcccgt       240
     atagccgtgt ccaacctcca caagcaaacc aagaagcagt tctctctggt catctcggac       300
     ctgtaccact atgttaaccc caaaaacaag caacccgcgc caatgatttc gaaagagacg       360
     tatgaaattg tcatgaaaca tgctgatgag ctcaactctg ctattgtata tgatcgtgac       420
     ttcaactaca actttttcgg tttcaagaca ctcgagcggt cctacctgct gcgaatcaat       480
     ggcaaggttg ctgagcgtcc gcagcacttg ttgatgcgtg ttgcggttgg cattcatggc       540
     aacaatattg aaaaggccat tgagacctac cacctcatgt ctcagaaata cttcactcat       600
     gcttctccta ctctgttcaa tgctggtact ccccaacccc agcttgcgtc ttgcttcctc       660
     gtcgatatga aggaggatag cattgagggt atctacgaca cccttaagac ttgtgccatg       720
     atctcgaaga cagctggcgg tatcggcctt aacgttcacc gcatccgtgc cacaggctcc       780
     tacattggtg gcactaatgg gtcctctaac ggtattgttc ccatgcttcg cgtgttcaac       840
     aacactgcta ggtatgtcga ccagggaggt aacaagcgcc ctggcgcttt tgctatttac       900
     ctcgagcctt ggcatgccga tatcttcgag ttcctggatc ttcgcaagaa ccacggtaag       960
     gaggaagtca gagcccgtga tctgttctac gccctgtgga cccctgatct gttcatgaag      1020
     cgagttgagt ccaacggtga ctggactctg ttctgcccca atgaagcccc tggtttggca      1080
     gatgtttatg gtgatgagtt tgatgctctt tatgaacggt acgagaaaga gggccgtggt      1140
     cgtaagacca tcaaggctca aaagctttgg tatgctattc ttgaggctca gaccgagact      1200
     ggcaacccct ttatgcttta caaggatgcc tgcaacaaga agagcaacca gaagaacctg      1260
     ggaactattc gcagctccaa tctttgcacg gagatcattg agtacagtgc tcctgacgaa      1320
     gttgctgtct gcaacctggc ttctctcgcg cttcctactt ttgtcgacgc ggcccgtgga      1380
     gagtatgact tcggcaagct gcacgaggtt gtgcaggtct tggttcgtaa cttgaacaag      1440
     attattgatg taaactacta ccctgttcca gaggccaaga agagcaacat gcggcatcgc      1500
     cccattgctc ttggtgtcaa tggtttggcc gatgccttcc ttgccctgcg cctgccgttc      1560
     gactccgccg aagcaagaca gctaaacatc cagatctttg agaccatcta tcacggtgct      1620
     ttgactgcat cttgtgagct ggccaaggag tttggtcctt atgaaactta cgagggctcc      1680
     cccgtctctc agggtattct ccagtatgat atgtgggaca gaacccccac ggacctctgg      1740
     gactgggatt ctctgaaggc gaagattgcc cagcacggtg ttcgtaacag tttgttggtg      1800
     gcaccgatgc ccaccgcaag caccagccag attctgggct tcaacgaatg ttttgagcct      1860
     tacacctcga acatctactc tcgccgtgtt cttgctggtg agttccaggt cgttaaccct      1920
     tggcttctca aggatcttgt cgaccttggt ctgtggtcgg acaacatgaa aaaccgtatc      1980
     atcgcagatg gtggctccgt tcaaaacatt cccaacattc ccgccgacat caaggctctc      2040
     tacaagaccg tgtgggaaat ctcccaacgt accatcctgc agatggccgc cgaccgtggt      2100
     gctttcattg accagtctca atctctcaac attcacctga aggagcctac tatgggcaag      2160
     ctcaccagta tgcactttgc tgggtggaaa atgggtttga agactggaat gtactacctg      2220
     cgaaccatgg ctgcctccgc tcccatccag tttactgttg atcaggagca acttaaggtt      2280
     gctgatacta atgttgctcg agccaacgct gcctacaaga agagagccgc cggatccgtg      2340
     cctaccacat actctgctgt tcctcgtaca acgagcgctc cgctcaacgg ccacagcgag      2400
     gacggcagcc cgcgagctct tgccgccgat gtcactgcag atagtgaaac cggcgtgaac      2460
     ggctcccagg aggaagatga tgagcgggag agcggcgagc gggagagcga catttactct      2520
     caaaaggtcc ttcagtgcag catcgagaat aaggaggctt gtctgatgtg ccaaggttag      2580
//

If you have problems or comments...

PBIL Back to PBIL home page