(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE455

ASFUM1_4.PE455       Location/Qualifiers
FT   CDS_pept        join(1743575..1744023,1744085..1744689,1744753..1745325,
FT                   1745416..1745663)
FT                   /codon_start=1
FT                   /gene_family="HOG000188189" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261077"
FT                   /orf_name="AFUA_4G06760"
FT                   /product="Ubiquinone biosynthesis protein, putative "
FT                   /protein_id="EAL90112.1"
FT                   /db_xref="HOGENOM:HBG054192"
FT                   /db_xref="HOGENOM:HBG324320"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0000520313"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS2"
FT                   /transl_table=1
FT                   /translation="MRVALRTPLRASDFDPAAVFRYNPNGFFLSQASKRNYSSTSSLRS
FT                   PASIQSSWRGISRHHSHARSSFRTCPSSRFYSTKTPILPEDIKSRDNRSGHSGSQRSRR
FT                   RLLKYAIIAGVVGATTVTLSDDVRHLYRAAQRTGRVVGTLAVCINDYRVTLKQDTPTEE
FT                   ERQEAIRACHKRCAERTLRVLEKNGSIFIKLGQHLSSMGYLLPLEWTTTFVPLQDKCPV
FT                   SSIESVEEMFVTDTGHRIDELFSSFEPLPIGAASLAQVHIGTLKETGQKVAVKVQHPAL
FT                   AEWVPLDLALTRFTFSMLKRFFPEYDLEWLSNEMDFSLPQELDFRMEAENARRASEYFK
FT                   NHSDAPLVIPEVMWAQKRILVMEFLSGHRPDDLEYLDSNHIDRDEVSAAFAHIFNEMIF
FT                   GDNAPLHCDPHGGNIAIRKNPNRRRHNFDIILYDHGLYRDIPRDLRRNYAKLWLAVIEA
FT                   DEGRMREYARKVAGITDEQFPLFASAITGRDYTVLANKDVASPRTAAEKENISGALGEG
FT                   MLQQLVELLGQVPRIILLILKTNDLTRSLDENLHTRQGPIRTFLILARYATRTVFEEKM
FT                   ENINETGGMLRPLNFLRFLWAWTGYLRVELKLSIYETLLSMKSQFGLI"
     atgagagtgg cgctccgcac cccattgcgg gcatcggatt ttgatccagc ggcagtgttc        60
     agatacaatc cgaatggttt cttcttgagc caagcttcga agcgcaatta ttcgtctacg       120
     tcttctctgc gatctccggc ctccattcaa agttcatgga gagggatatc tcggcaccat       180
     tcacatgcgc gatcgtcatt ccgcacatgt ccgtcttcgc ggttctattc tacaaaaaca       240
     cctatcttgc cggaggatat caagtctcgg gacaatagat cgggtcattc aggttcacag       300
     cgatcgcgga ggaggcttct aaaatatgca atcatcgccg gtgtcgtcgg cgctacaacg       360
     gtgaccttat cagatgatgt acggcatcta tatcgcgcgg cacagcgtac aggccgggtt       420
     gtcgggactc tggctgtctg tatcaatgat taccgtgtca ccctcaaaca agatactcca       480
     acagaagaag agcgacaaga ggctatccga gcatgtcata agcgttgcgc agaacgaacc       540
     ctacgtgttc tcgagaagaa tgggtctatc tttataaagt tgggccagca tctcagtagc       600
     atgggttatc ttcttccgtt ggaatggacg acgactttcg tccctctgca agacaagtgt       660
     cccgtctcgt ctattgagtc cgtcgaggaa atgttcgtca ccgacacggg ccatcgcatc       720
     gatgagttat tctcgagttt cgagccattg cccattggag ccgcatctct tgcccaggtt       780
     cacattggta cgctgaagga gactggtcag aaggttgctg ttaaagtgca gcatcctgca       840
     ttggccgaat gggtgccctt agacctggca ttgacacggt ttactttctc gatgttgaaa       900
     agatttttcc ccgaatatga tctagagtgg ctctcgaatg aaatggattt ctcgctaccc       960
     caggaattgg atttccgcat ggaggcagag aatgccagga gggctagtga gtatttcaaa      1020
     aatcactcag atgctccgtt agtgattccg gaagtcatgt gggctcagaa aaggattttg      1080
     gttatggaat tcctctcagg ccatcgtccg gatgatctcg aatatttgga ctccaaccat      1140
     attgaccgtg acgaggtctc cgccgcgttc gcacatatct tcaacgaaat gatcttcgga      1200
     gacaatgccc cgttacactg tgacccccac ggcggtaata tcgccattcg caagaacccc      1260
     aaccgacgcc gccacaactt cgatatcatc ctctacgacc acggcctgta ccgcgacatt      1320
     ccacgcgatt tacgtcgtaa ctatgctaag ctctggctgg cagtcatcga agcagatgaa      1380
     ggccgcatgc gtgagtatgc gcgtaaggtc gcaggtatca cagacgaaca atttcccctg      1440
     ttcgcgagcg caatcaccgg acgagattac accgtgctag ccaataagga tgtcgcttct      1500
     ccacgcacgg ctgccgaaaa agagaacatc tccggtgcgc tcggggaggg catgctgcaa      1560
     cagctcgttg agttgcttgg ccaggtaccc cggatcattc ttttgatact gaagacaaac      1620
     gatctgaccc gcagtctgga cgaaaatcta catacccgac agggacccat acgcacattt      1680
     cttatcctag cccgctacgc cacgcgcacc gtcttcgaag agaagatgga gaacatcaac      1740
     gagaccggcg gcatgctccg cccactcaac ttcttgcggt ttctctgggc ctggacaggc      1800
     tatctccggg ttgaactgaa actctccatc tacgagactc tgctgtctat gaaaagtcag      1860
     ttcgggttga tctga                                                       1875
//

If you have problems or comments...

PBIL Back to PBIL home page