(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE456

ASFUM1_4.PE456       Location/Qualifiers
FT   CDS_pept        join(complement(1747149..1747377),
FT                   complement(1746368..1746906))
FT                   /codon_start=1
FT                   /gene_family="HOG000069228" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206879"
FT                   /orf_name="AFUA_4G06770"
FT                   /product="Iron-sulfur cofactor synthesis protein (Isu1),
FT                   putative"
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="EAL90111.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG054191"
FT                   /db_xref="HOGENOM:HBG584215"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniParc:UPI000051E6C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS3"
FT                   /transl_table=1
FT                   /translation="MFRRLATVAPRSVGAVASPRIAPAISGIQSQPINRASPTPQRRNY
FT                   HEKDKYIDQSGMTSQMLTFFALLDHYNNPRNEDCYDQSTSICLLCARGESRVSAFFKLL
FT                   TNHVHASETDISIVGSLPKDAPDVGLGLVGAPACGDVMKLQIRVDKDTSKITDVKFKTF
FT                   GCGSAIASSSYLTELVRGMTLDEAAKIRNTDIAKELCLPPVKLHCSMLAEDAIKSAIND
FT                   YYTKNPKAAKTDLSGTAASISNVEKTDGSTASL"
     atgttccgcc gtttggctac tgtcgctccc cgctcagtcg gtgctgtcgc gtcgcctcgc        60
     attgcgccgg ccatttctgg aatccagtct caacccatca atagggcgtc tcctacacct       120
     cagaggagaa attatcacga gaaagataag tacatcgatc agtctgggat gaccagtcaa       180
     atgctgacct tctttgcact gctagatcat tacaacaacc cacgcaacga agactgctat       240
     gaccagtcaa catccatctg tctcctatgc gctcgaggag aatctcgagt ctcagcattc       300
     ttcaagctct tgaccaacca tgtacatgct tcagaaactg acatatcgat agttggctca       360
     ctacccaagg atgctcctga tgtcggtctc ggacttgttg gtgcacctgc ttgcggtgac       420
     gttatgaagc tccagatccg agtcgataag gacaccagca agatcaccga cgtcaagttc       480
     aagacttttg gctgtggtag cgcgattgcc agctccagct acctgaccga gttggtgcga       540
     ggaatgacgc ttgacgaggc cgctaagatc cggaataccg acattgccaa ggaactttgc       600
     ttgccccctg tgaagttaca ttgctccatg cttgccgagg acgctattaa gtctgccatc       660
     aacgactact acaccaagaa ccccaaggct gctaagactg atctttctgg cactgcggct       720
     tccatttcca acgtggaaaa gaccgacggt agcaccgcaa gcctgtga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page