(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE457

ASFUM1_4.PE457       Location/Qualifiers
FT   CDS_pept        join(complement(1750474..1750945),
FT                   complement(1749623..1750344))
FT                   /codon_start=1
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902274"
FT                   /orf_name="AFUA_4G06780"
FT                   /product="Mitochondrial carrier protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL90110.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054190"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000051FC50"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS4"
FT                   /transl_table=1
FT                   /translation="MFSDGHGNSGATSSSEEQQISQSNNLASSDIQVPPEAASSPKFVT
FT                   NLEIWSTKIPDYYVAPFCGASAGVASGIVTCPLDVIKTKLQAQGGFLRRGGGVVEAKTL
FT                   YRGMLGTGRIIWRQDGIRGLYQGLGPMLLGYLPTWAVYLAVYDRSREYFYETTVTNPIW
FT                   VIKTRLMSQSLKSNSEGYTAPWQYSSTWDAARKMYRIEGIRSFYSGLTPALLGLTHVAI
FT                   QFPLYEYLKMAFTGYGIGEHPDNGGSHWIGISCATFLSKVCASTLTYPHEVLRTRLQTQ
FT                   QRTSPAPSPEGISFRGGLDHPQDRGRPPGAASSDGMPNRPRYTGVIRTCQTILREEGWR
FT                   AFYSGIGVNLFRAVPAAMTTMLTYEYLRKLIGHLQHEGEMKLRMANDREIALLQQDE"
     atgttttccg acggtcacgg caattcagga gccaccagca gctctgaaga gcagcagata        60
     tcgcagtcga acaaccttgc gtcatccgac attcaagttc cacctgaagc tgcttccagc       120
     cccaagttcg tcacaaacct tgagatatgg tccacgaaga taccggatta ctacgttgct       180
     ccattctgcg gcgccagtgc gggtgtggcc tctgggattg tcacatgccc ccttgatgtg       240
     atcaagacga agctgcaggc acaaggcgga tttctccgac gaggcggcgg agtcgttgag       300
     gcgaaaaccc tttatcgtgg tatgctaggt actgggcgga tcatatggcg gcaagatgga       360
     attcggggtc tatatcaagg attgggtccc atgctcttgg gatatctgcc tacgtgggcc       420
     gtatatttgg ctgtttatga ccgatctcga gaatacttct acgaaaccac cgtgactaat       480
     ccaatctggg tcattaaaac gcggcttatg tcacagagcc tcaagtccaa cagtgaaggc       540
     tacacggctc catggcagta ctcaagcact tgggatgcag cccgcaaaat gtacaggatc       600
     gaagggatta ggtcatttta ttctgggctg acccccgcgt tactcggctt aacgcacgtc       660
     gctattcaat tcccgctata cgaatacttg aagatggcct ttactgggta cgggataggg       720
     gaacatcctg ataacggtgg ctctcactgg attggcatat cctgtgcgac attcctaagc       780
     aaagtttgtg ccagcacttt aacctacccg catgaagtgc tacggacaag acttcagaca       840
     cagcaaagaa catctccagc gccttctcca gaaggtatct catttcgtgg agggctagat       900
     cacccacaag accgcgggcg gcctccagga gcggcttcat cggacggcat gcccaaccgc       960
     cctcggtata cgggcgtgat ccgtacatgt cagaccatcc tgagggagga aggctggcgc      1020
     gcattctact ccggcatcgg ggtgaatcta ttccgggctg tgccggctgc catgaccaca      1080
     atgcttacat acgagtatct ccgtaagctg atcggtcact tgcaacatga gggagagatg      1140
     aagctgcgca tggcaaatga tagagaaata gccttgctgc agcaggatga gtaa            1194
//

If you have problems or comments...

PBIL Back to PBIL home page