(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE458

ASFUM1_4.PE458       Location/Qualifiers
FT   CDS_pept        join(1751971..1752108,1752166..1752219,1752408..1752497)
FT                   /codon_start=1
FT                   /gene_family="HOG000188221" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206880"
FT                   /orf_name="AFUA_4G06790"
FT                   /product="Ubiquinol-cytochrome c reductase complex 14 kDa
FT                   protein"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="mitochondrial electron transport,
FT                   ubiquinol to cytochrome c"
FT                   /protein_id="EAL90109.2"
FT                   /db_xref="GO:0006122"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG054189"
FT                   /db_xref="HOGENOM:HBG324319"
FT                   /db_xref="InterPro:IPR003197"
FT                   /db_xref="UniParc:UPI0000F51C05"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS5"
FT                   /transl_table=1
FT                   /translation="MQAVKLIILRFDDLIPEESDVVQTALKRLPPKEAYDRVFRIRRAF
FT                   QCSVSHTLLPAHEHTKPEEDVEYLSPIIREIERENKERVDLDTLVVRR"
     atgcaggcag tcaagctgat tattctcaga ttcgatgacc tgattcccga ggagagcgac        60
     gttgttcaga ctgcccttaa gcgtcttcct cccaaggaag cctacgaccg cgtcttccgt       120
     atccgcagag ctttccagtg ctccgtttcc cacaccctcc ttcccgctca tgagcacacc       180
     aagcccgagg aggacgtcga gtacctgagc cctatcatcc gcgaaatcga gagggagaac       240
     aaggagcgtg tggacctcga caccctcgtt gttagacggt ag                          282
//

If you have problems or comments...

PBIL Back to PBIL home page