(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE47

ASFUM1_4.PE47        Location/Qualifiers
FT   CDS_pept        join(complement(160830..161200),complement(160482..160803),
FT                   complement(159962..160387))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273695"
FT                   /orf_name="AFUA_4G00580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84360.1"
FT                   /db_xref="HOGENOM:HBG054028"
FT                   /db_xref="UniParc:UPI000051F749"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W981"
FT                   /transl_table=1
FT                   /translation="MLTSAILVPWLLTAVPASSASSLLRYDATLDKGRIECVYPISGQY
FT                   ALLHRVLYYSLLLFSIVSGKTPWLVAGALGAAMTYAGSAAVHATILAGISRDSLLDLDC
FT                   LGIFAIVSVGSLVVTVFFHGGLLMVVGTICAIVAMLRDYPSEDQCTSIPSDATNSTEPI
FT                   LLTSAAQSGLVPFNCTYACFSTRQAFRDPGDIRVVPAGTVSTQRFRLLEVSIWLSRFLG
FT                   AVVSLYRLLRRHAKQMRSMAQKKLAHEQKRGRPGLMTDLLLIACVVVIVLNEVFIHLSD
FT                   GIPTSEPPNAVGQWGPWVAVIMALAGSAIVEYHRPAWEEWQRVLREEGVLVEAEKNPSL
FT                   VPSLWMRLSNMGGKSPATESGPSRSSLAKGIA"
     atgcttacct cggctatcct ggtgccatgg ctcctgacgg ctgtcccggc atcatccgct        60
     agtagtctcc ttcgctacga tgcgacactg gacaagggac ggatcgaatg cgtctacccc       120
     atcagcgggc aatatgccct tctgcaccga gtcctctact acagcctcct tctcttctcc       180
     atagtcagtg gcaagacccc gtggttggtg gctggtgcgt tgggtgcggc catgacctat       240
     gccggatcag cggctgtcca tgcaaccatc ctcgctggca tatcgcgtga ttctctactt       300
     gatctggact gccttgggat cttcgccatc gtcagcgtcg gcagtttggt cgtgacggta       360
     ttcttccatg gggggttact gatggtggtt ggaacaatct gtgccattgt ggcgatgcta       420
     cgagactatc cgagtgagga ccaatgtaca tccataccga gtgatgcgac caacagcaca       480
     gaaccgatac tgctgacaag cgcggcacaa tccggtctgg tgccgttcaa ttgcacgtat       540
     gcctgcttca gcacacgaca agcctttcga gacccgggcg acattcgcgt ggtaccagct       600
     ggcacagtat caactcagag attcaggcta ttagaagtct ccatctggct ctcgcgattc       660
     ctcggggccg tcgtctctct ctaccgtctc ctccgccgcc acgcaaagca gatgcgatcc       720
     atggcccaga agaagttggc tcacgagcag aagcgtggcc ggccggggtt gatgactgat       780
     ttgttgttaa tcgcctgtgt ggtcgtcatc gtcttgaacg aggtgttcat acatctcagc       840
     gatggcatcc ctaccagcga accgccgaat gccgtggggc aatggggtcc atgggtagcc       900
     gtcatcatgg cgttggcggg atccgccatc gtggagtatc accggccagc ctgggaggaa       960
     tggcagcggg tattgaggga ggagggcgtc cttgtggaag cagagaagaa cccatcactg      1020
     gttccttcac tgtggatgcg cttgagtaac atgggtggga aatcaccagc tactgaaagt      1080
     ggaccctcaa gaagcagcct agccaagggg attgcctag                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page