(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE49

ASFUM1_4.PE49        Location/Qualifiers
FT   CDS_pept        join(complement(165039..165685),complement(164542..164983))
FT                   /codon_start=1
FT                   /gene_family="HOG000200300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273697"
FT                   /orf_name="AFUA_4G00600"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL84358.1"
FT                   /db_xref="HOGENOM:HBG054006"
FT                   /db_xref="HOGENOM:HBG324891"
FT                   /db_xref="UniParc:UPI000051F9B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W983"
FT                   /transl_table=1
FT                   /translation="MVALYDAFGFPIVRDQLIANTVLVALATLAVLLRFISRHIRKSKI
FT                   WWDDGCCVGSMLHTYGMLAMHYHYARVGMRKHVTEIPPENLVAMLKMLIVYQVVYYNAM
FT                   VLAKLSYLFFYLRIFVTKGFRIAAWVCMGCACAYWTGSMLQIFFICQPFQKNWNPTLPG
FT                   HCASQNVAFSTIGAFNLITDVMIMVLPLHFIWKLQMSTATKLALYGIFGLGLFISAITI
FT                   IRIRVLTTVDFFDLPYSMIWAAFWSVTEPALANLNACVPMLRPVFKAAFPTLFASRKMY
FT                   STQPGSGASGIKNKAFKRMNEVESDLQLTNLTQLEPVRTSREGRISEHGDDGSHDDRSQ
FT                   DGRSQDESTHVPRSVIVNRPWT"
     atggtggccc tgtacgatgc ctttggcttt cccattgtgc gcgaccagct catcgccaac        60
     acggtgctgg tcgccttggc cactcttgcg gtgcttctcc ggttcatctc gcggcatatc       120
     cggaagagta agatctggtg ggacgatggt tgctgtgtag ggtccatgct gcacacatac       180
     ggcatgctgg caatgcacta ccactacgct cgcgtcggga tgcgcaagca cgtcaccgag       240
     atccctcccg agaacctggt ggccatgctc aagatgctga tcgtctacca agtcgtctac       300
     tacaacgcca tggtcctcgc caaactgagc tatctcttct tctacctccg catcttcgtc       360
     acaaagggct tccgcatcgc cgcctgggtc tgcatgggct gtgcctgtgc ctactggacc       420
     gggagcatgc tccagatctt cttcatctgc cagcccttcc agaagaactg gaaccccacg       480
     ctaccgggcc actgcgccag ccagaacgtg gccttctcga ccatcggcgc cttcaatctc       540
     atcacggacg tcatgatcat ggtgttgccc ctgcacttca tctggaagtt gcagatgagc       600
     actgcgacca agctggccct ctacggtatc tttggattgg gtctttttat ctccgcgatc       660
     accatcatcc gcatccgcgt ccttaccacc gtcgacttct tcgatctccc atactcgatg       720
     atctgggctg cgttttggag cgtcaccgag ccggccctgg ccaacttgaa cgcgtgcgtg       780
     ccgatgctcc gacccgtctt caaggccgcg ttcccgaccc tgtttgccag ccgcaaaatg       840
     tactctacgc agccggggtc tggagcctcc gggatcaaga acaaagcttt caagcgcatg       900
     aacgaggtcg aaagtgacct tcagctgacg aatcttacgc agttggagcc ggttcgaaca       960
     agccgcgagg ggagaatatc ggaacatggc gacgacgggt cgcacgatga tcggtcccag      1020
     gatggccgtt cgcaggatga gtcgacccat gtcccgagga gtgtcattgt gaacaggcct      1080
     tggacttag                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page