(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE5

ASFUM1_4.PE5         Location/Qualifiers
FT   CDS_pept        join(31312..31536,31649..31986,32188..32350)
FT                   /codon_start=1
FT                   /gene_family="HOG000048687" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058735"
FT                   /orf_name="AFUA_4G00140"
FT                   /product="RTA1 domain protein, putative "
FT                   /protein_id="EAL84404.1"
FT                   /db_xref="HOGENOM:HBG054315"
FT                   /db_xref="UniParc:UPI0000520797"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W937"
FT                   /transl_table=1
FT                   /translation="MLLEAHQAIALMDPEHCTLDTCPIQNAYIHYQPTIAGNSVYLALF
FT                   GIFLFTQLIQSIFFRMWGFAGAMAAGLVLEKLDLSQPWTGFLLCCPLPAPRLDHHHLPR
FT                   RRDLAVEAQKLCHLLRFMRCHCAHPAERRWSSYLCGRRCRWSTNGIERHDCRSSLPGCC
FT                   TDSFYCPSFSLQSVYDVDISRENISDLANNEIAFMILEGAMVSITCLCLTIMHPGIYLG
FT                   SRNKRKGVLSEDVAMLSMR"
     atgctactag aagctcatca agcaattgct ctcatggatc ctgaacattg tacgctcgat        60
     acctgtccca tacagaatgc ctacatccat taccagccca ccatcgcggg caacagtgtc       120
     tacctggcac tattcggcat cttcctcttc acccaactaa tccagtccat tttctttcgc       180
     atgtggggat tcgccggagc tatggcagct ggactagttc ttgagaaact tgatttgtct       240
     cagccttgga ccggttttct tctgtgctgc cctctacctg ctcctcggct agatcatcat       300
     catctaccac ggcgaagaga tctcgcggtt gaagcccaga aactatgcca tcttcttcgt       360
     ttcatgcgat gtcattgcgc tcatcctgca gagcgccggt ggagctctta cctctgcggc       420
     cgaagatgcc gatggtcgac aaatgggatt gaacgtcatg attgccggtc tagtcttcca       480
     ggttgctgca ctgactcttt ttattgccct agcttcagtt tgcaatctgt ctacgacgtc       540
     gacatctcaa gggagaatat cagtgacctg gccaacaacg agatagcatt tatgattttg       600
     gaaggagcga tggtttcgat cacctgcctt tgcttgacaa ttatgcatcc agggatatac       660
     ttggggagtc ggaacaagcg caagggtgtc ctgagcgaag acgttgccat gctatcaatg       720
     aggtaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page