(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE56

ASFUM1_4.PE56        Location/Qualifiers
FT   CDS_pept        join(185434..185693,185740..186241)
FT                   /codon_start=1
FT                   /gene_family="HOG000200256" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273699"
FT                   /orf_name="AFUA_4G00670"
FT                   /product="Nucleoside-diphosphate-sugar epimerases, putative"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84351.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG055099"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F4DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W990"
FT                   /transl_table=1
FT                   /translation="MHLILTGATGLVGSGVLDAMLAMKEVTKISILSRRPVQMAEDAHD
FT                   PRVQVILHQGFEAYDPKVLSQLQGATGCVWALGISQTKVNKEDYIKITKTYALEAAKAF
FT                   RTLPPPNQPFHFVYVSGTGATTQPGFFTSLFARVKGETELELAELRRATPLFRASSVRP
FT                   AFIDHAHHEAIKKYVPPRPTYETLFRPLAPVFRAAMPGLCSPTEQLGRFLTEMAMGRHE
FT                   DRLVGGKDVQMVGEMPILENMAFRRLAGLRL"
     atgcatctca tcctcaccgg cgccacgggc ctagttggct ccggcgtcct cgacgcaatg        60
     ctggcgatga aagaagtcac caaaatatcc atcctcagcc gacgaccagt gcaaatggcc       120
     gaggacgccc atgacccccg agtgcaggtc atcctccacc agggctttga agcctacgac       180
     cctaaagtcc tctcccagct gcagggggca acaggctgcg tatgggcact gggtatcagc       240
     caaacaaaag tcaacaaaga ggactacatc aaaatcacca aaacctacgc cctggaagcc       300
     gccaaagctt ttcgcactct tcccccgcca aaccagccct tccacttcgt ctacgtctcc       360
     ggcacaggcg ccaccacgca accgggcttc ttcacttcac tctttgcccg cgtcaagggc       420
     gagacagagc tggaacttgc agaattacgt cgcgcgaccc cactgtttag ggcgagttct       480
     gtccgaccgg cgtttataga ccatgcgcac cacgaggcca tcaagaagta cgttccgccg       540
     cggcccacgt atgagacgct gtttcggcct ctggcgcccg tattccgggc ggcgatgccg       600
     gggttgtgta gtcctacgga gcaactcggg aggtttctga cggagatggc gatggggagg       660
     cacgaggatc ggttggtggg ggggaaggat gtgcagatgg ttggggagat gcctatactt       720
     gaaaatatgg cgtttcggcg gttagctggg ttgcgtttat ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page