(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE6

ASFUM1_4.PE6         Location/Qualifiers
FT   CDS_pept        join(complement(37469..37684),complement(36940..37418),
FT                   complement(36547..36884),complement(35916..36496))
FT                   /codon_start=1
FT                   /gene_family="HOG000159003" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19905461"
FT                   /orf_name="AFUA_4G00150"
FT                   /product="MFS maltose transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84403.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054314"
FT                   /db_xref="HOGENOM:HBG328361"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FE69"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W938"
FT                   /transl_table=1
FT                   /translation="MDNVTEKQTSALELEEQPVSKGGPVYDVNEKVGLDRAGAINAEDV
FT                   EHKMTVVEAVKAYPAASWWAFVMSCTIIMESYCVFLMGQFIATKRFARDYGVWSDVKQD
FT                   FIIEASWQSAFQCSGPVGAFIGVFIAGPITSWIGYRWATIGGLMFLNAFIFIFYFGNSQ
FT                   GMFLASQILEGIPWGIFVANAPAYCSEIVPMRLRAPATQMLQMFWAIGSIIVGGITYHY
FT                   QSRDDPTAYRIPIALQWMFPTPLAILLYLAPESPWWLVRKGRLADAEKAVRRLGRASAN
FT                   DDPADAVAMMRRTIELEKTEKKPSLVELWKGTDLYRTLIVCGVYASQNLTGNLIANQAV
FT                   YFFKQAGMADNTAFALGLITSALQWIMVMLSWILTTYLGRRTIYVYGQLINCVFLVALG
FT                   IAASVGASKAASNAQASLGLIVSVLFCLGPAPASWVIIGETSSVRLRPLTTGIGRGAYY
FT                   VVNIPCIFLASYMLNADKWNLGGKSGYVWAGTAFICTFMSWLWIPEMKDRSFREIDILF
FT                   KRRVPARKWKQTVVDINDDE"
     atggataacg tcacagagaa gcaaacctca gcgttagagc tcgaggagca gcccgtctcg        60
     aagggcgggc ctgtctacga tgtcaacgag aaggtcggct tggacagagc aggtgccatc       120
     aatgctgagg atgtcgaaca taagatgact gtggtcgagg ctgtcaaggc ctatcccgca       180
     gccagttggt gggcattcgt catgtcatgc accattatca tggagtcata ctgtgttttc       240
     ttgatggggc agttcatagc cacaaagcga ttcgccaggg actatggtgt atggagcgat       300
     gtaaaacagg atttcattat tgaagcttca tggcagtccg cattccagtg tagcggacca       360
     gtcggtgctt ttatcggtgt attcatcgca ggccccatta ccagttggat tggatatcga       420
     tgggcaacca ttggcggtct catgtttctg aacgccttca tcttcatctt ctatttcggc       480
     aacagccagg gcatgttttt agcgtcccag atcctggaag gcatcccgtg gggtattttt       540
     gtcgccaatg cacccgccta ctgttccgaa attgtgccca tgagattgag agctccagcg       600
     acgcagatgt tgcagatgtt ctgggctatt gggtcaatca ttgtcggcgg tatcacttac       660
     cactaccaat ccagggatga ccccacagcg tacagaatcc ccattgcact ccaatggatg       720
     tttcctactc ctctcgctat cctactctac ttggcgcctg aatcaccctg gtggctcgta       780
     cgaaagggcc gtctggctga cgcagagaag gctgtcagac gccttggacg cgcgagtgca       840
     aatgatgatc ccgctgacgc agtcgcaatg atgcgtcgca cgatcgagct tgagaagacc       900
     gagaagaagc ccagtcttgt tgaactgtgg aaaggcaccg atctctaccg cacattgatt       960
     gtgtgcggtg tgtacgcatc tcagaatctg acgggcaatc tgattgctaa ccaagcggtt      1020
     tactttttca aacaggccgg tatggcagac aacaccgcat ttgcactcgg tctcatcact      1080
     tctgctctcc agtggatcat ggtcatgctc tcttggatcc tcaccacata cctcggccga      1140
     cgcaccatct atgtctatgg ccaattgatc aactgtgtat tcttggtcgc gctaggtatt      1200
     gcggcttcag tcggcgccag taaggcagct agcaatgcgc aagcatccct cggcttgatc      1260
     gtctccgtcc tattctgctt gggacccgcc cctgcctcat gggtcatcat cggtgagaca      1320
     tcttctgtcc ggctcaggcc actgaccacc ggtattggac ggggtgccta ctacgtggtc      1380
     aacattcctt gcatcttcct tgccagctac atgctcaacg ctgataagtg gaacctgggc      1440
     ggcaagagtg gctatgtctg ggccggcact gcctttatct gcaccttcat gtcttggcta      1500
     tggatcccag agatgaagga caggtccttc cgggagatcg acattttgtt caagcgacgt      1560
     gttccggctc gcaaatggaa gcagacggtc gttgatatca atgacgatga gtag            1614
//

If you have problems or comments...

PBIL Back to PBIL home page