(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE63

ASFUM1_4.PE63        Location/Qualifiers
FT   CDS_pept        join(198243..198712,198777..198881,199202..199429,
FT                   199601..199838)
FT                   /codon_start=1
FT                   /gene_family="HOG000215690" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905471"
FT                   /orf_name="AFUA_4G00740"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84344.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG055022"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E693"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W997"
FT                   /transl_table=1
FT                   /translation="MSRTVCITAVDGHTGFLIAELLLTNETFKSHIKSVAGLTLHPHAA
FT                   KCKELAKLGVKIVPHEPGRLKHTVQTLQQIGAEAMCLIPPAHKEKFDITMEMIEAAKKA
FT                   NVANVCFVSSAGCDLAERDKQPHLRSFIDLEAAFMASKGDSSTQTGHSPVVVRAGFYAE
FT                   NLLLYSEQAQTEGILPIPIGQNHKFAPIAAEAKKVLHAQSESDASELQYLLEYYSLVRE
FT                   GKTNYISTTAFHDVTGSHPQEPVEFFKVYAESFRPKHVNKKRKMSNHLAHPVLPIFIQK
FT                   HQIQRPPHSRLPKNPFNRLLLVRRIHPRSTKPATIPNVAARTTIPETAYGSLYHIRLSI
FT                   TVLRAR"
     atgtcccgca cagtttgcat caccgctgta gacggccaca cgggcttcct catcgccgag        60
     ctactcctca caaacgagac cttcaaatcc cacatcaagt ccgtcgcagg tctcactttg       120
     cacccccacg cagcaaaatg caaggagctc gccaagctgg gcgtcaagat cgtcccacac       180
     gagccgggcc gtctgaagca caccgtccag accctgcagc agatcggcgc cgaggccatg       240
     tgcctgattc cgcccgcgca taaggaaaaa ttcgacatca cgatggagat gatcgaagcg       300
     gcgaagaagg ccaacgtcgc caatgtctgc ttcgttagct cggccggctg cgatctcgct       360
     gagagagaca agcagcctca tctccggagc tttattgacc tggaggcagc ttttatggcc       420
     tccaagggcg attcttctac ccagacggga cactcgccag ttgttgttag ggctggcttc       480
     tacgccgaga atcttctgct gtactcggag caggcgcaga ccgaggggat cctcccaatt       540
     cccatcgggc agaaccacaa attcgctcct atcgcggccg aggcaaagaa ggtcctgcat       600
     gcgcagtcgg agagcgacgc gtccgagcta cagtatctgc tcgagtacta ctccctcgtc       660
     cgtgagggca agaccaacta catatccacc acggcgttcc acgatgtgac gggcagccat       720
     ccgcaggagc cggtggaatt cttcaaggtg tatgccgaga gcttccgtcc taagcacgtc       780
     aacaagaaga ggaaaatgag caaccacctt gctcacccag tccttcccat cttcatccaa       840
     aagcaccaaa tccaacgacc tccccacagc cgtcttccca aaaacccctt caaccgacta       900
     ctcctcgtcc gccgcataca tcctagatca accaagcccg ccacaatccc caacgtcgca       960
     gccaggacca caatccccga aaccgcatac ggaagtctat accatattcg cctctcaatc      1020
     accgtactga gggcgcggta g                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page