(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE64

ASFUM1_4.PE64        Location/Qualifiers
FT   CDS_pept        join(complement(202401..202864),complement(202083..202303),
FT                   complement(201853..202028))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273703"
FT                   /orf_name="AFUA_4G00750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84343.1"
FT                   /db_xref="HOGENOM:HBG055011"
FT                   /db_xref="UniParc:UPI000051F9B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W998"
FT                   /transl_table=1
FT                   /translation="MRFLNLLLALSPLAQVSSAIPQEWGNSTGPLGGNLITDPARLSEL
FT                   HEVHNEVIRMLNTGETLPVERSRSLTVHGQHDKRVYQAFGLLGVFVASMFGLKTVEKIT
FT                   DQLLELFTSDDTIWTRKENCRAYFSTQGGGNEEFRTYARDHGNPTSEVHKNVGWIDPEH
FT                   TAPPIHFFEGDQGDSAIGVYSVQYTATDRVAWSGIPDTEKCPFEGLCNPQYIFYHNGYQ
FT                   IVLNTWQSQGRISACQYSQGEDCLGLCSSGVKNQFSRGGVRWGGDCAIPCIDDAGDGYD
FT                   VVPNK"
     atgagattcc tcaacctgct tctagctctt tcgccgctgg ctcaagtctc ttcggctata        60
     ccgcaagaat ggggcaactc cactgggcct ttgggcggca acctgattac ggaccctgcg       120
     cgcctgtccg aactgcatga agtgcacaat gaggtgatta ggatgctgaa cacgggcgag       180
     acgctccctg tagagcggtc gaggagcctt accgtgcatg gccagcacga caagcgtgta       240
     taccaggcct ttgggctcct cggagttttc gtcgcatcca tgttcggtct caagactgtt       300
     gaaaaaatta cggaccaact cctggagctt tttacatcgg atgataccat ctggacgagg       360
     aaggagaact gccgtgcgta tttcagcact caaggcgggg ggaacgaaga gttccgaact       420
     tatgcaaggg accatggtaa tcctacatct gaggtacaca aaaatgtcgg atggattgac       480
     cctgagcaca ctgccccccc gatccatttc ttcgagggtg atcagggtga ttctgctatt       540
     ggtgtctaca gcgtgcagta tacggcaacg gacagagttg cctggagtgg tattccagac       600
     acagagaaat gtcccttcga ggggctgtgc aacccccagt atatcttcta ccacaacggc       660
     tatcaaatcg ttctcaatac atggcaatcc cagggccgca tctcagcttg ccaatactcc       720
     cagggagaag attgcctggg cttgtgctcc tcgggcgtga agaaccagtt ttccagaggc       780
     ggtgttcgtt ggggcgggga ctgcgcgatt ccctgcatcg atgacgctgg cgatggctac       840
     gacgtagtcc ccaacaaata g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page