(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE65

ASFUM1_4.PE65        Location/Qualifiers
FT   CDS_pept        join(complement(204481..204973),complement(204327..204439),
FT                   complement(203502..204227))
FT                   /codon_start=1
FT                   /gene_family="HOG000200234" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058746"
FT                   /orf_name="AFUA_4G00760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84342.1"
FT                   /db_xref="HOGENOM:HBG055000"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI000051EB2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W999"
FT                   /transl_table=1
FT                   /translation="MAVLCTASQTELHSSAGSFNALLKSDRARMNDLRDINESIQVPDP
FT                   RIFKDPILPTDVISLPNMAQCAAHLELLQAINHIRREVLNSKDLDAILDIKPEKRTVRQ
FT                   RYSQKRIEVKDPRFAQKRQAKWPFYVKLGVARFFLWLKKMEQTLTSNKNEVLELPTCPP
FT                   LDVLIAWHSALLNPAWLRKYCKNGGIKHMRRVVFPWRQISFTSLTGQEADLLAYLLSPK
FT                   PGPYASLLLAYRDSSPNHRPYLNKLDSLYLEKKEELPHSAFITSCYAAAHPGPYGAYLF
FT                   DAIERQRVFVDKMVGYLWIRSPGVHGTLSRAITRYEYFLQLFKLRPGTTLVPTLDIDLV
FT                   WHTHQCSASMYKASMKKLAGRFINHDDTIPGGVLRTQSDETSLLFRDYFGMDYHICLCW
FT                   ECEALQSAVDECGDGEVDFEKLANKVVNDLAAHRLLELKRRKQV"
     atggccgtcc tatgcactgc atcgcaaacc gagctgcata gcagcgccgg gtctttcaat        60
     gcgctgttga agtctgacag agctcgaatg aatgatttgc gcgatatcaa tgaaagcata       120
     caagttcctg atccaaggat cttcaaggat ccaattctgc cgactgatgt tatatccctc       180
     ccaaacatgg ctcaatgtgc cgcgcacttg gaactgttgc aggcgatcaa ccatatccgc       240
     cgggaggtcc tcaattcgaa ggacctggac gcgatcctcg atattaagcc ggagaagcgg       300
     acagtgcgac aacggtattc ccagaaaaga atcgaggtaa aggatcctag gtttgcgcag       360
     aaacggcagg ccaaatggcc gttttatgtc aagctgggag tcgcccgatt ctttctctgg       420
     ctgaagaaga tggaacagac gttaacatcg aataagaatg aagtccttga gttaccgacc       480
     tgccctccac tagatgtgct catcgcgtgg cattctgccc tgctgaaccc agcatggttg       540
     aggaaatatt gcaagaacgg tgggatcaag catatgcggc gggtggtatt cccatggagg       600
     cagattagct ttacaagcct aactggccag gaagcagacc tgctggccta ccttttgagt       660
     ccaaagcctg ggccctatgc ctctctgctt ctcgcgtacc gggactcatc ccctaatcat       720
     cgcccttacc taaacaaact ggacagtctg tatctggaaa agaaagagga gctaccacac       780
     agcgccttca tcacatcctg ctatgcagcc gcccatccgg gcccatacgg agcctaccta       840
     ttcgatgcaa tcgagcgcca acgcgtcttc gtcgacaaga tggttggata tctgtggatc       900
     cgcagtcccg gcgtgcacgg gacgctgtcc agagcaatca cccgctacga gtacttctta       960
     cagctattca aactccgtcc gggaacaact cttgtgccaa cgctggacat cgatctggtg      1020
     tggcataccc accaatgctc ggcgagtatg tacaaagcca gtatgaagaa actggcgggc      1080
     aggttcatca accacgacga taccatcccc gggggggtgc tccggacgca gtcggacgag      1140
     acgtcgttgc tgttcagaga ctattttggc atggactatc atatttgtct ctgctgggag      1200
     tgcgaggctc ttcagtcggc cgtcgatgag tgtggtgacg gcgaggtgga ttttgagaag      1260
     ctggcgaata aagtggtcaa tgatttggcg gctcaccggc tgctggagtt gaagcggaga      1320
     aagcaagtat aa                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page