(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE66

ASFUM1_4.PE66        Location/Qualifiers
FT   CDS_pept        join(205320..206449,206493..208002)
FT                   /codon_start=1
FT                   /gene_family="HOG000200223" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905472"
FT                   /orf_name="AFUA_4G00770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84341.1"
FT                   /db_xref="HOGENOM:HBG054989"
FT                   /db_xref="UniParc:UPI000051F9B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A0"
FT                   /transl_table=1
FT                   /translation="MSRLSRLFDKSKQTLPVTSASPDGPAWTEVGNAADHLPAELESLY
FT                   WTGVNKELDCIVSTLRRWQQPHFQHIQPDADNTLVNGFDTFVADVVPQSAQAPPQLPSQ
FT                   ASTELNVKGRLVRSAQVRAMELAAAKTRTKVNVDVHKRLLQRPVETDAAKRRARLLLQA
FT                   AGFLDIEKTIEHSPAANTPSPLTPQLRMTKKGFKGCPAISTLPCSRCKRVIRGSMYQAT
FT                   GGSTQTICEDCYWEHHYGDPAYIKQYKHSIASQVDELMSKHTSCRSCRKNSDKIRRPSG
FT                   LPGKTGVHKLADAKYLGVQEAQNKSGLSGRPTPLAKVIHNDYNSRSGTSFAASRSDKLH
FT                   LVGEEWLYKDFVQENPWKNIRVAVRVGPLVFENGSKESRNGAGISIRDPIFGQGHQRVN
FT                   GTCLAVCGENERQLWRYVRPLPWKRKRFQAVLKQVVGTPFTGWPLSPAEDEIITLLVKA
FT                   SNDDIEGACQELHDKVKAFLSPWVSVYFESIVGSLLDTKTRLAWDGLTNNCQQFCNSLI
FT                   DWELFGPLVASSSVTISTNDPPQPLYRMSFVCRPRAAQDPFNHPNSITNVPYGLTEEYT
FT                   RRFHFGCYTGPDFIDSLHEYWYDWAGFHKPLYPHQSLFPWDCTEALRRYPVKCGTCTLS
FT                   KHVWAFPFDSWSIIALHLSRDKCAYPASELSPNSPSDASWITNRLTLLTALDTLSAGAT
FT                   AMSQSLPFQSATQWLHLQLDPSTDRIKLGGINRAQPYSHALERRTHDDFFVAKWVSDDR
FT                   LPIQTYEDMREKRYSPRTAQERELVFWGAEGSDPPGEYATWAVEYTRIPNANFPVSVSF
FT                   TTGCGACGTQATAAACGANCGASCGSCGGGGGGGGGCGSGDSGGGSGSGGGGCGGGSGG
FT                   GGGGSGGG"
     atgtcgcgac tgtcccggtt atttgacaag tctaaacaga ctctacccgt tacctcggca        60
     agcccagacg gccctgcctg gactgaggtc ggcaatgccg ccgatcacct tccagcagag       120
     cttgaatctc tctactggac tggggtcaac aaagagctgg actgtattgt ttctactcta       180
     cgacgatggc agcaacccca tttccagcac attcaacccg acgcagacaa tacactggtc       240
     aacggcttcg acaccttcgt cgccgatgtt gtcccgcagt ccgcgcaggc acctcctcag       300
     ctaccatccc aagcatccac tgagctcaac gttaaagggc gtctggtgag gagcgcacaa       360
     gttcgcgcga tggagctggc agcagcgaaa accaggacga aggtgaatgt cgatgtacat       420
     aaacgcctat tacagcgtcc tgtcgagaca gatgccgcta agcgacgagc acggctactt       480
     ctccaagccg ctgggttctt ggatattgaa aaaaccattg agcattcacc ggcagcgaat       540
     acgcccagtc ctctcacccc gcagctacga atgaccaaga aagggttcaa agggtgtccg       600
     gccatttcca ccctcccttg cagtagatgc aagcgcgtca tccgggggag tatgtatcaa       660
     gccactggtg gatccaccca gaccatctgc gaagattgct actgggagca ccattacgga       720
     gatcctgcgt acatcaaaca atacaagcat tccattgcgt ctcaggtcga cgagctcatg       780
     agtaagcata cttcctgccg ttcctgtcgc aaaaattcgg ataagattcg acgaccatct       840
     gggctgccgg gcaaaaccgg ggtgcataag ttggcagacg caaagtactt gggcgtccag       900
     gaagcacaga ataaatcagg tctttcgggc cgacctactc ccttggcgaa ggtaattcac       960
     aatgattaca atagtcggtc tgggacttca tttgccgctt cgaggtctga caagctgcat      1020
     ctggtcgggg aggagtggct gtacaaggat tttgtgcagg agaacccatg gaagaacatc      1080
     cgtgtggccg ttcgagttgg accactggtg tttgagaacg gcagtaaaga gagtcgaaat      1140
     ggggccggaa tatccattcg cgatccgatt ttcggacaag ggcaccaaag ggttaacggc      1200
     acttgccttg ccgtctgtgg ggaaaatgag aggcagctat ggcgctatgt ccgccctctt      1260
     ccttggaagc gaaaacgctt ccaagcggtt ctgaagcaag tcgttgggac tcctttcacc      1320
     ggttggccgt tatcgccggc agaggatgag atcattacgc tgctggtgaa agcgagcaac      1380
     gacgacatag agggtgcatg tcaggaactg cacgacaaag tcaaagcgtt tctcagccca      1440
     tgggtgtcgg tctacttcga aagcattgtg ggcagcttgc tcgacaccaa gacgagactc      1500
     gcatgggacg gattgaccaa taactgccag caattctgta actcgctgat cgactgggaa      1560
     ctctttggac cacttgtcgc ttcgtcttca gtcactatct cgaccaacga ccccccgcag      1620
     ccactctacc gcatgagctt cgtctgtcgc cctcgtgcag cacaggatcc gttcaaccac      1680
     ccaaacagca tcaccaacgt cccatacgga ctgaccgagg agtatacccg tcgctttcac      1740
     tttggctgct acaccggccc cgactttatt gattctctgc atgagtactg gtacgactgg      1800
     gccggattcc acaaacccct ctatccccat caatccctct tcccctggga ctgcaccgaa      1860
     gcactccgcc gctacccggt caaatgcggg acctgcacac tctccaaaca cgtctgggcc      1920
     ttcccctttg actcctggtc aatcatcgcc ttgcacctct ccagagacaa atgcgcctat      1980
     cccgcgtccg aactaagtcc aaattcccca agcgacgcat catggataac caaccgcctc      2040
     actctcctca ctgcactgga caccctctcc gccggcgcaa cagccatgtc gcagagccta      2100
     cccttccagt ccgcaacgca atggctccat ctccaactcg acccatcaac cgatcggatc      2160
     aaactcggcg gtatcaaccg cgcgcaacca tacagccacg cgctggagcg ccgcacgcac      2220
     gacgacttct tcgtcgcgaa gtgggtttcg gatgacaggc tccccattca aacctacgag      2280
     gacatgcggg agaagcgata ctcgccgcgg acagcccagg aacgggaact ggtgttctgg      2340
     ggcgcggagg ggagcgatcc gccgggggag tatgcaactt gggcggtgga gtacacccgt      2400
     atcccgaatg cgaactttcc ggtgtctgtc agtttcacta ctgggtgtgg agcttgtggg      2460
     acgcaggcca ctgcggctgc ttgcggtgcc aactgtggtg cgagctgtgg gagttgtggt      2520
     ggaggcgggg gcgggggcgg gggctgcggt agcggagata gcggaggcgg cagtgggagt      2580
     ggaggaggag gctgcggagg aggcagcgga ggtggaggag gagggagtgg aggaggttga      2640
//

If you have problems or comments...

PBIL Back to PBIL home page