(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE68

ASFUM1_4.PE68        Location/Qualifiers
FT   CDS_pept        join(213386..213677,213726..214894)
FT                   /codon_start=1
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16273704"
FT                   /orf_name="AFUA_4G00800"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84338.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054956"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E8DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A3"
FT                   /transl_table=1
FT                   /translation="MPYWQELFSTGYRDPTGHPNITSSQSAAIVSILSAGTFFGALGAA
FT                   PMGDRIGRRWGLIASAQVFNLGVILQTAATGIPLFLAGRFFAGLGVGLISALIPLYQSE
FT                   TAPKWIRGTIVGAYQLSITIGLLLASIVNNSTQNRMDTGCYRIPIAVQFAWSIILVGGM
FT                   LILPDTPRYLIKRGNIDGAARALGRLRRLPADDPAVREELAEIQANHEYELSLGKSTYL
FT                   DCFKGNLLKRLLTGCGLQALQQLTGINFIFYYGTQFFKNSGFKNSFTISLITNCVNVGS
FT                   TLPGLYAIEKWGRRPVLFWGAVGMCVSQFVVAIIGTTTTGQDAHGVIIVHNEPAQKAAI
FT                   AFICFYIFFFASTWGPSAWVVTGEIFPLKIRAKSLSMTTATNWLLNWAIAYSTPYLVDY
FT                   GPGNANLQSKIFFVWGGCCFLCISFVYFLIYETKGLTLEQVDELYGEVSSARLSKHWTP
FT                   TITFREMQQEKARDVHLETAEAAVPKTA"
     atgccctact ggcaagagct cttctccacc ggctaccgtg accccaccgg acaccccaat        60
     attacctcct cgcagtctgc cgccatcgtc tccatcctct ctgctggtac cttcttcggt       120
     gctttgggtg ctgctcccat gggtgaccgg atcggtcgtc gctggggtct gattgcttcg       180
     gcccaggtgt tcaatctggg agtcatcctg cagacggccg ccacggggat ccccctcttc       240
     cttgcgggtc gcttctttgc cggtctcggg gtcggtttga tctctgcgtt gatccctctg       300
     taccaatctg aaacggcccc caagtggatc cgaggcacga tcgtcggtgc ctaccagctc       360
     tccatcacca tcggtctcct gctggcctcg atcgtcaaca actccacgca gaaccgcatg       420
     gacaccggct gctaccgcat ccccatcgcg gtccagtttg cctggtcgat cattctcgtc       480
     ggcggtatgc tgatcctccc tgacacgccc cggtacttga tcaagagggg caacatcgat       540
     ggcgccgcca gagccctcgg ccgtctccgc cgcctccctg ccgatgaccc ggccgtccgc       600
     gaggaactgg ccgagatcca ggccaaccac gagtatgagc ttagtcttgg caaatccacc       660
     tacctcgact gcttcaaggg caacctgctc aagcggctcc tgactggctg cggcctgcag       720
     gccctgcagc agctcaccgg catcaacttc attttctact atggcaccca gttcttcaag       780
     aactccggct tcaagaactc cttcaccatc agtctcatca ccaactgcgt caacgtcggc       840
     tccaccttgc ctggcctcta cgccatcgaa aaatggggtc gccgccccgt cctcttctgg       900
     ggtgccgtgg gcatgtgcgt ctcgcagttc gtcgtcgcca ttatcggcac caccaccacc       960
     ggccaggacg cccacggcgt catcatcgtc cacaacgaac ccgcccagaa ggccgccatc      1020
     gccttcatct gcttctacat cttcttcttc gcctccacct ggggccccag cgcctgggtc      1080
     gtgactggcg aaatcttccc cctcaagatc cgcgccaagt ccctctccat gaccaccgcc      1140
     accaactggc tgctcaactg ggccatcgcc tactccaccc cgtatctggt cgactacggc      1200
     ccgggcaacg ccaacctgca gtccaagatc ttcttcgtct ggggcggctg ctgcttcctg      1260
     tgcatctcgt tcgtgtactt tttgatctac gagaccaagg gtcttaccct tgagcaggtg      1320
     gatgagctgt acggcgaggt gagcagtgcc cggctgagca agcactggac tcctaccatt      1380
     accttccgcg agatgcagca ggagaaggcc cgggatgtgc atctggagac tgcggaagcg      1440
     gctgttccga agacggcatg a                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page