(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE69

ASFUM1_4.PE69        Location/Qualifiers
FT   CDS_pept        join(215210..215217,217000..217144)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273705"
FT                   /orf_name="AFUA_4G00810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84337.1"
FT                   /db_xref="HOGENOM:HBG054945"
FT                   /db_xref="UniParc:UPI0000520799"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A4"
FT                   /transl_table=1
FT                   /translation="MIGHLLDYDSLPSTESMFSTGSIAATSTCILQLSHTQFRHENRGR
FT                   ANACI"
     atgatcggtc acctgctcga ctatgactcc cttccatcga ctgagtcgat gttttcgaca        60
     ggctccatcg ccgccacgag cacctgtatc ctccaacttt cccatactca attccgtcat       120
     gaaaatcgag gaagagcaaa tgcctgcatt tga                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page