(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE71

ASFUM1_4.PE71        Location/Qualifiers
FT   CDS_pept        join(complement(226968..227013),complement(226211..226914))
FT                   /codon_start=1
FT                   /gene_family="HOG000216771" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059002"
FT                   /orf_name="AFUA_4G00840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84334.1"
FT                   /db_xref="HOGENOM:HBG054911"
FT                   /db_xref="UniParc:UPI0000520096"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9A7"
FT                   /transl_table=1
FT                   /translation="MCQAWTLPGGYRAAALVRDGSKLRKILSVLGVSSEIVESQLIITE
FT                   DSSRDVKTVVRLLRSDPDLIFSGVTSLPKFSINPLRPIGMQDATIIGDSAIALIDALRE
FT                   LRSTGGLSNAPLYIPISSVGHSSQRDQPLLSIPLYLWLLPIAQEDTAVLEKVVRKAATE
FT                   ANSPLGGYVMLRPPLLTHGKMKGRESVRVGWIWEDEAFKNQDEEEEEEGIKIKWTISRL
FT                   DLAKWMFEELVQGDAHKWKGKCVYLTY"
     atgtgccaag catggacgtt accggggggc tatcgcgccg ctgccctcgt ccgtgatgga        60
     tccaaactca ggaagatctt gtcagttctc ggcgtttcta gcgagattgt tgagtcgcaa       120
     ctcatcatca cagaagattc atcccgtgat gtgaagacgg tagttaggct ccttcgcagc       180
     gatcctgacc tcatcttcag tggcgttaca agtcttccca aattctcaat aaatccattg       240
     cgcccaattg gcatgcagga tgccaccatc ataggagact ctgctattgc cctaattgat       300
     gctctccgtg agctgagatc cacaggcgga ctctcaaatg cgcccctata cataccgata       360
     tcgtcggttg gtcatagctc acagcgagat cagcctcttc tatcgattcc actttacttg       420
     tggctcctgc caatcgccca ggaggacact gccgttttgg agaaggttgt acgtaaagca       480
     gccacggaag ctaattcgcc tctcggtggc tacgttatgc tacgaccgcc gctgttgacg       540
     catggtaaaa tgaaagggcg tgaatctgtc cgagtagggt ggatctggga ggatgaggcc       600
     ttcaagaacc aagatgagga ggaggaggag gagggaatta agattaaatg gactattagt       660
     cggctggact tggcaaagtg gatgttcgaa gagcttgttc aaggggatgc tcacaagtgg       720
     aaagggaaat gcgtctatct tacatattag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page