(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE76

ASFUM1_4.PE76        Location/Qualifiers
FT   CDS_pept        complement(243969..245627)
FT                   /codon_start=1
FT                   /gene_family="HOG000200155" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905729"
FT                   /orf_name="AFUA_4G00890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84329.1"
FT                   /db_xref="HOGENOM:HBG054856"
FT                   /db_xref="UniParc:UPI000051F4D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9B2"
FT                   /transl_table=1
FT                   /translation="MNKRKVELMSDTVDSLEISVLHELHGEGEAVGPEGQFPETQEARR
FT                   KRKKNKKKKRLSEVTQTGENAQISLTPIMDLQQPSQSRSITDEEFLPDMFHRLTTITPL
FT                   NGPHANPNRRIPPAPVSFKHNDYLCNLSISEADVIAMQLFQGTYRLDIRELPHQECRMT
FT                   LIWDYDHLWGCFDIGVWKGLMLIDPGPRDNTKTMYSFAWRGVCENEPEVAYDNEGITVG
FT                   EITLGGKGPVSGCFKGMAVANFPNDKCDFKAVREVGPPMVPWPVETFVADWNYLQHDRA
FT                   KEPESQRLVLLALSPEPESQVVNDETMQMDGEEDQEEEGQCQDEVTTDVHPSSPARQPA
FT                   ETPHTSPPPDEPTQQSQRAPSTISRFHATPLAMQRSWARHDQDKFLDVVCGSYEISSPT
FT                   MKHNWSRKASKLRMRLLVDRGESCVWGMFAMGVYRGIMLFQESPIRFQKDRRLKFCWRG
FT                   RETDGRDCAEKLGYLHFVEDMSIQGCFYDMYGDVPFAGRRRIRPAVESRFDEAFFKQQW
FT                   WEHEPVPPTLLRQVQGHSQGQMETQLETQTQPETR"
     atgaacaaac gaaaggtcga gctcatgtcc gacactgtgg actcgcttga gatttctgtg        60
     cttcacgagc ttcatgggga aggcgaagca gtaggcccag agggccaatt ccccgagacc       120
     caagaagcac gcagaaaaag gaagaagaac aaaaagaaga agagattatc tgaagttact       180
     cagactggcg agaatgctca aattagtctt acaccgatca tggacctcca acagccgagc       240
     cagagccgct ctatcaccga cgaggagttt ttgccagaca tgttccatcg tcttacgacc       300
     atcactccac tcaatggtcc tcatgcaaat cccaaccggc gaatccctcc cgctccagtc       360
     tcattcaagc acaacgacta cctgtgcaac ctgtcgatat ccgaagcaga tgtcattgcg       420
     atgcaactct tccagggcac gtaccgactt gacatcaggg agctccccca ccaagaatgt       480
     cggatgaccc tcatctggga ctacgaccat ctgtggggct gcttcgacat tggcgtgtgg       540
     aagggactga tgctcatcga tccggggccg cgggataaca ccaaaaccat gtactccttc       600
     gcgtggcgag gtgtctgcga gaacgagccc gaggtcgcat acgacaacga gggtatcaca       660
     gtgggagaaa tcaccttggg cgggaagggc cctgtgtctg gctgcttcaa gggaatggcc       720
     gttgccaatt tccctaacga caagtgcgac ttcaaggccg tgcgggaggt cggaccgccc       780
     atggtcccgt ggccggttga gacattcgtc gcagactgga attatcttca gcatgataga       840
     gcgaaggagc cggagtcaca gcgtctggtg ctgcttgcgc tttctcctga gccggaatcg       900
     caggtcgtga atgatgagac tatgcagatg gacggcgagg aggaccagga ggaggaaggt       960
     cagtgccagg acgaggtcac cacggacgtg cacccatcct ctcctgcccg tcaaccagca      1020
     gagacaccac acacctcgcc accaccagac gaacccactc agcagtccca acgggcccca      1080
     agcaccatta gtcgattcca cgcaaccccc cttgcgatgc agcgctcctg ggcccgccac      1140
     gaccaggaca agttcctcga tgtcgtctgt ggcagctacg agatctccag ccccaccatg      1200
     aaacacaact ggtcgcgcaa agccagcaag ctgaggatgc gtcttcttgt tgatcgaggt      1260
     gagagctgcg tctggggcat gttcgccatg ggcgtctacc gcggaatcat gctgtttcag      1320
     gaatcaccca tccgatttca gaaggacaga cgactgaagt tctgctggcg gggtagggag      1380
     acggatggtc gtgactgcgc agagaagctg gggtaccttc attttgtgga ggatatgagt      1440
     attcaggggt gcttttatga tatgtatggc gacgtcccgt ttgcaggaag acggaggata      1500
     cgtccggctg ttgaatcgcg gtttgatgag gcattcttca agcagcagtg gtgggaacat      1560
     gagccggttc cgccgactct acttcgacag gttcagggtc atagtcaggg tcagatggag      1620
     actcagcttg agactcagac gcaacctgag acccggtaa                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page