(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE77

ASFUM1_4.PE77        Location/Qualifiers
FT   CDS_pept        join(247227..247254,247398..249385)
FT                   /codon_start=1
FT                   /gene_family="HOG000216766" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753590"
FT                   /orf_name="AFUA_4G00900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84328.2"
FT                   /db_xref="HOGENOM:HBG054845"
FT                   /db_xref="UniParc:UPI0000F51BD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9B3"
FT                   /transl_table=1
FT                   /translation="MDLRREIPSLYGNFGVCYLHFSVFRFLFYILYLGLVDADRQASVR
FT                   CWPLIWRELAPHTLVLWLHDCSTEDDWPPWKFRSLLEQMVERGCRYIWVGLNKQDSPDV
FT                   SEESVQEARRKYEEEFAKYKDDLSWKVLTHKLSAKTGVGVSEVLKDIYQAVKRANLEPP
FT                   KEDKQDKTGTVISDSSDEKLTTEQLQRRIEKEVTGDTIDPDAFWTSFLEGDLPAWTHYT
FT                   YLKALYFVILESAKKKTFTEIANDFNIHLIRLRNISPQLFNDSETPSAYVHAPFNICLA
FT                   TFWTLQLQHGIREYRMHSMSSHLPSREEFPQVLRRSPSLMSTYLWKSYYSFNPVSRPRD
FT                   YWSIPNLRKLPTQTDYLRDPATVPRKDEGPDKLIRYAFAVMQYVRNAGAARGQVVTQAL
FT                   VALQQATMRARTADSTVETYSETQAYFWIQIVHAALRSLDDKKGSVDTSEMSFEAFQQT
FT                   FHLKPTDWQEYYSKKLWNSVAARSQFVMPDLKPLPNVIASLPSKVIRKAPEGIPKLPSA
FT                   EELTFRARMACEELTPTLQSSGPPVLSHTHLLFYLHKRFTQSAEGGTRKKLERRARELF
FT                   SEIAGPIVAGATYRNFWIQQVGVAVLNSDIGKGRSTFPEFITSNLHLVFEELHGIYYGP
FT                   GVWTSADAAEKILGPDRRRMETIVNMADVNMSANTK"
     atggatcttc ggcgagaaat accatcgcta tatgggaatt tcggagtatg ctacttgcac        60
     ttttccgtct tccgttttct gttttacatt ttataccttg gtttggtaga tgctgaccga       120
     caagcatcag tccgatgctg gcccttgata tggcgggagc ttgcgccgca cactttggtc       180
     ctgtggttgc atgattgctc tactgaggac gattggccac catggaagtt tcgtagcttg       240
     ctagaacaaa tggtggagag aggatgtcgg tatatctggg ttgggttgaa taagcaagat       300
     tctccagacg tctcggagga gtcggttcag gaggcgcgac ggaagtatga ggaggagttt       360
     gcgaagtata aagatgacct gtcgtggaaa gtactgacgc ataagctgag tgcgaagact       420
     ggggtagggg tatctgaggt cctcaaggac atctaccagg ccgtgaagag ggcgaatctg       480
     gagcctccaa aggaggacaa acaagataag acggggaccg tcataagcga ctcatcagat       540
     gaaaaattaa ctactgaaca gctgcaacgc cgaattgaga aggaggttac tggcgacacg       600
     atcgacccgg acgcattctg gacatccttc ctggagggag acctgccggc gtggacccat       660
     tacacctatc tgaaagcgct ctatttcgtc atccttgagt cggcgaagaa gaaaaccttc       720
     acagagatag caaatgattt taacattcac ctcatccgac tgagaaacat atccccccag       780
     ctatttaacg acagcgagac accgagtgcc tacgtccatg caccattcaa catatgcctg       840
     gccacattct ggactctaca actccaacac ggtatccggg aatatcgcat gcacagcatg       900
     agctcacatc ttccatctcg agaagaattc ccccaagtcc tccgccgctc gccatcactg       960
     atgagcacgt atctctggaa aagctattac tccttcaatc ccgtctccag accacgggac      1020
     tattggtcaa tcccgaactt acggaaactt ccaacacaga cagattatct ccgcgatcca      1080
     gcgacagtgc ctaggaagga cgaggggcca gataagctca tacgctacgc cttcgctgta      1140
     atgcagtatg tgcggaacgc gggggcggcg cgtgggcaag tagttacaca ggcgctggta      1200
     gcactccagc aagctactat gcgtgcaagg acggcagatt cgaccgttga gacatactca      1260
     gagacacagg catatttctg gatccagata gtccatgctg cgttgcggtc gctggatgat      1320
     aagaagggct cggttgatac ttcggagatg tcgttcgagg cattccagca gactttccat      1380
     ctcaaaccga ctgactggca ggagtattat tcgaagaaat tgtggaatag tgtcgctgcg      1440
     cgatcgcagt tcgtgatgcc tgatctcaag ccgctgccga acgtcattgc atctctccct      1500
     agcaaagtaa ttaggaaagc accagaaggg ataccaaagc tcccatccgc agaagagctt      1560
     acatttcggg ccaggatggc ctgtgaggag ttgacgccga ctctgcaatc ttcaggcccg      1620
     ccggttctca gtcacactca ccttctgttc taccttcaca aacgcttcac acaaagtgct      1680
     gagggaggga ctcgaaagaa gctcgagcgc cgggccagag aactatttag cgagatagca      1740
     ggcccgatag tggctggtgc gacgtatcga aacttctgga tccagcaggt tggagtcgca      1800
     gtgttgaatt cggacattgg caagggccgc tcaacattcc cagaatttat tacgagcaac      1860
     ctgcacctgg tcttcgagga gctgcatggg atttattacg gaccaggagt ctggaccagc      1920
     gccgatgcag cggagaagat cctcggtccc gacagacgaa ggatggagac gatcgtcaac      1980
     atggcggacg tgaacatgtc tgcaaacaca aaataa                                2016
//

If you have problems or comments...

PBIL Back to PBIL home page