(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE88

ASFUM1_4.PE88        Location/Qualifiers
FT   CDS_pept        join(272645..273498,273800..274370,274434..274985)
FT                   /codon_start=1
FT                   /gene_family="HOG000216763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753593"
FT                   /orf_name="AFUA_4G01010"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84318.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054735"
FT                   /db_xref="HOGENOM:HBG324602"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051E42E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C3"
FT                   /transl_table=1
FT                   /translation="MADTLKTGEPSGWRIPKACQECRKRKIKCNGVNPCKTCRVRNTLC
FT                   VYRDVIRQRKKKRHGPVDEGLASCESTRTELGTQQPSSPPPQPLGRRNKSASYTFHNSV
FT                   SATHMTSPSCKVQLYYGPTSHFTLMHEIYRGLVSNQTTHPEEPQGEVEEAGAGLDMFSV
FT                   RGIFFGTPAETHDPNKGIGTTVAPVMFMPYELARVFLQRFLSTLYHLVPFWSKELYERQ
FT                   LETLYLPSSGTGSDTCTNSILLMALAMGSLGTQRYRWGDILFERVKASCPSWDDVVNLE
FT                   TVQLWICFHLGRPSSLSSRDVGIAPPKDPFILILIHLTNVMARSANEIYGRPHDSLLQM
FT                   WKLARSITEDLRCYDEKMKLALGFGLDKSPQPGDVGVQQAILTTCKPLTCRLMDGRLRK
FT                   IVYYHTILLTFRPFLIFRGRWLRDTKKSPSATGPNTTKRPTEMPAWLNEACDHAVHAAC
FT                   RTVHHLCEAAIVNEFVRELRYHGFFLTSACFALIYDFMYNEKVATTHLPWVHVGLQCLG
FT                   AMRPGDPITSSISAIQTVLKKLCPSYEWVPPGPVQGQTYAPNLTSSASATPYSNGVAPS
FT                   QVNPMRETFPGGTFLGGYLPTMPNIQVNPLQSDIPEASASVVSSEDLPDFNLSDMGWDF
FT                   DFSTMDLEAFFSIQPTMNPSQPL"
     atggctgata cccttaaaac aggcgagcca tccggttggc gaatacccaa ggcttgtcaa        60
     gaatgcagaa agcgaaaaat caagtgcaat ggagtcaacc cctgcaagac ctgtcgggtg       120
     cggaacactc tatgtgtcta ccgggatgtg atccggcagc gcaagaaaaa gaggcatggc       180
     cctgtagacg agggcctggc ttcctgtgaa tctacgcgca ctgagcttgg tacacagcag       240
     ccatcctcac caccgcccca gccgctaggc cgccggaaca aatcagccag ctatactttc       300
     cacaacagcg tttcggcaac gcacatgacc tctccgtcat gcaaggtgca actatattat       360
     ggaccgacgt cccattttac ccttatgcat gagatctatc ggggtttggt ttcgaatcaa       420
     accactcatc ctgaggagcc gcagggagaa gtcgaagagg ctggggctgg gcttgatatg       480
     ttcagtgttc ggggcatctt cttcggtact ccagctgaga cgcatgatcc caataagggg       540
     atcggtacga cagtcgcacc ggtgatgttc atgccgtatg agctcgccag ggtatttctg       600
     caaagatttt tgtcaacgct gtaccatctg gtaccattct ggtccaaaga gctttatgag       660
     cgccagctag aaaccctgta tcttccttcc tctggtaccg gctctgacac ttgtaccaac       720
     tccatcttac tgatggcttt ggccatgggc tccctgggca cacagcgtta tcgctgggga       780
     gatattctgt ttgagcgggt caaggcgtct tgtccttcct gggacgacgt ggtgaatctt       840
     gagactgtac agctctggat ttgctttcat cttggtcgcc caagttcgct ttcttcgagg       900
     gacgttggca ttgcacctcc caaggatcca ttcatcctca tcctcataca cctcacaaac       960
     gtcatggctc gttcggcaaa cgaaatttac ggccgaccac acgactcatt gttgcaaatg      1020
     tggaagcttg ccagatccat tacagaagac cttcgttgtt acgacgagaa gatgaagctt      1080
     gctcttggct ttgggcttga caaatcaccc cagcctggtg atgttggtgt tcagcaggcc      1140
     attctcacaa cctgtaagcc attgacatgc agattgatgg acggacggct aagaaagata      1200
     gtatactatc acaccattct tttgacattc cgaccgttcc tgatctttcg cgggcgatgg      1260
     ctgcgcgata ccaaaaagtc tccttccgcg actgggccca acacgactaa acgtccgaca      1320
     gaaatgccgg cgtggctgaa cgaggcgtgc gaccacgcgg tccacgctgc atgcaggact      1380
     gtccatcatc tatgtgaagc tgctatcgtc aatgagtttg ttcgggaact tcgctatcat      1440
     ggcttcttcc tgaccagcgc ttgctttgca cttatttacg acttcatgta taacgagaaa      1500
     gttgcaacta cacaccttcc atgggttcac gtgggcctcc aatgtcttgg agccatgcgg      1560
     ccgggggatc ccatcacaag ctctatttca gctatacaga ctgtcctgaa gaaactgtgc      1620
     ccgtcgtatg aatgggtgcc acctggacct gtccagggtc agacatacgc accaaaccta      1680
     acgagctcgg catcagctac cccctattct aatggtgtag caccgagcca agtaaatcct      1740
     atgcgcgaaa ctttccctgg tggcactttt ctgggagggt accttcctac aatgccgaac      1800
     atccaagtca atccgcttca aagcgatatc ccggaggcct ctgctagtgt tgtgagcagc      1860
     gaggatcttc cggatttcaa tttgtcggat atgggatggg attttgactt ttccacgatg      1920
     gatctggaag cattcttctc tatccaacca actatgaacc catcgcagcc actttaa         1977
//

If you have problems or comments...

PBIL Back to PBIL home page