(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE89

ASFUM1_4.PE89        Location/Qualifiers
FT   CDS_pept        join(275753..275904,276630..277556,277603..278286,
FT                   278332..279360,279410..280043)
FT                   /codon_start=1
FT                   /gene_family="HOG000178140" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059005"
FT                   /orf_name="AFUA_4G01020"
FT                   /product="Sensor histidine kinase/response regulator,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84317.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG054724"
FT                   /db_xref="HOGENOM:HBG326511"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI000051E69A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C4"
FT                   /transl_table=1
FT                   /translation="MPTFSSSPGIPSGCTTFRMRHPLAKKYPRTCPRLMKEENAGTKPD
FT                   TLLLTEFRSSHSQDGVNEPLEAASARGTIRRRDKSNSAASLIAYAQLAAYRLGCSQSFV
FT                   VRFERGQANIIAEASPSLLLEGGGGVGVDEGHRQAKVLSLRLADGRVVNTPNVIADSTR
FT                   CVIRDLTQDNPSDNQEIQFFAAVPIYDVNKDTMGAVCVVDKTPHLGFGDSEVTSMQEIA
FT                   DLVACNIKDKSAEEDHLQAERLIKGLTTFVSCQVVPDLEQGYHFKRRPSYLPGIDDLSL
FT                   SEKCSVGSPQYTHPQTPGTPPNQLFSRIHERRNSVTVIEGSTVSHSMSFLFSRASALLQ
FT                   KCMELDGVLFLDATRSNARSSCSPSMSDLEVLSKDGDSCINSPGLSAGAWRERVCEPLG
FT                   WASSGSANRCTSQYSISEGLLHDLFAAYPKGAIFNASTLVDCTSQRCGHDTDARGLRHH
FT                   TIILRLVQDLPEARSLLFLPMWNWKSSRWLAGALLWTCDIQRSFEQTDLFYVKAYGDAI
FT                   VSEAAQIDWQATEKSKSDLLSSVSHELRSPLHGMLASVELLRTTDLQPAQLDMLTMIET
FT                   CGLTLMDTLNYLLDFTKINNLTSADAKNDTETSLVDLACEFNLDTLVEDVADTLYAGHR
FT                   SPINASQVAGRYLPSGSMGIISAKGTESATESNDLSVIVGVEPGNWKVRSNPGGWRRIV
FT                   MNLLGNSFKFTKSGFIEVTLARKMEGTGGTKRVYAHLTITDTGCGIAPEYLEHKLFQPF
FT                   TQEDILTEGVGLGLSIVDRLVTNAGGQIDVKSTVGIGTQFEVYIPVEFVDTLDEGAPEQ
FT                   QQPQSVSVSRVCLVGLNVFSSMKTSSQRLSVNTKRRLSVRSALSNAILSQPGWTVSFAD
FT                   TLSQAKGDIGIIEESSLAEKADLEQITTDLTRLIILGQYGSGPSVDPATKKLDVVYVPQ
FT                   PLTPRKLIGALHTLSNLPEAREQIGSSDSMPHRQRSLSEAFVLAKQTESPPVVEGLELG
FT                   EFRGSTPKASTTTDRHVLIVDDNDINLKILATFMRRIGCSYETATNGLVALEKYQQAQR
FT                   QFNYVLMGRLPLLGVMVQLTAIDLSMPVMDGIISTSKIREYEEENSLPRAAIMAVTGVA
FT                   SATMQQQAFAAGIDDFLVKPLSLRDLKRVMMNIA"
     atgccaacat tctcgtcgtc ccctggaatc cccagtggat gcaccacctt ccgcatgcgg        60
     catcccctcg caaaaaagta tccccggacc tgtccacggc tcatgaagga agagaatgct       120
     ggaaccaaac cagacactct tctacttacg gaatttcgtt cgtctcattc tcaggatgga       180
     gtcaacgagc cccttgaggc agccagtgcg cgagggacaa tccgtcggcg agataagtca       240
     aattcggcgg catccttgat cgcttacgca caattggcgg cgtatcggtt gggctgcagc       300
     cagtcgtttg tggttcgttt cgagcgaggg caggcaaata tcattgcgga agcatcgcct       360
     tctctcctgt tagagggagg gggcggggtt ggtgttgacg agggtcaccg gcaagcaaag       420
     gtgttgagcc tgcgcctggc tgatggtcgt gtcgtcaata ctcccaatgt tattgctgac       480
     agcacccgat gtgtcatacg tgatctcaca caggacaatc cttctgacaa ccaggagatc       540
     cagttctttg cagcggtccc gatttatgat gtaaacaaag atactatggg cgctgtttgt       600
     gtggtagaca agacgccaca tctgggtttt ggagacagcg aggtcacaag catgcaagaa       660
     attgctgatc tggttgcttg taacatcaag gataaatcgg ctgaagagga ccaccttcaa       720
     gcagagcggc ttatcaaggg tctgaccact ttcgtcagct gtcaggtcgt ccctgacctt       780
     gagcaaggct atcacttcaa gagacggcca tcgtaccttc ctggtatcga tgatctttcg       840
     ctgtcggaga aatgtagcgt gggctcgcca caatacacac atcctcaaac cccgggaacc       900
     ccgccaaacc agctcttttc aagaatccac gaaagaagga attcagtgac tgttatcgag       960
     ggaagcacag tatcccactc gatgtcgttt ttgttctccc gtgctagtgc tttactgcag      1020
     aaatgtatgg agctcgatgg cgtgcttttt ctggacgcca cccgaagtaa cgctcgaagc      1080
     tcctgctctc ctagcatgag tgacctggaa gtactctcca aggatggcga ttcgtgcatc      1140
     aactcgccgg gcctgtccgc cggcgcttgg cgagagaggg tatgcgagcc tttgggctgg      1200
     gcgtcatcgg gctcggcaaa tcgctgtacc tcgcaatatt cgatctcaga aggcttgctg      1260
     catgacttgt ttgccgcgta cccaaaaggc gccatcttta atgccagcac cctcgttgac      1320
     tgtactagtc agagatgtgg tcatgacacg gatgcaaggg gattgcgcca tcacacgatc      1380
     atcctgcgcc tggtacaaga ccttcctgag gccaggtcac ttctttttct cccaatgtgg      1440
     aactggaaat catcgcgctg gctggctggt gccctgttgt ggacatgtga catccaacga      1500
     tcttttgaac aaaccgattt gttctatgtc aaggcatacg gtgacgcaat tgtgtccgaa      1560
     gcggctcaaa tagactggca ggcgacggaa aagtccaaat cagatttact gtcatccgtc      1620
     agccacgagc taagatcacc gcttcatggc atgcttgcca gtgtagagct gttgcgcacc      1680
     accgatcttc aaccggctca gctggatatg ctgacgatga ttgaaacctg cggcctgaca      1740
     ttgatggaca cgttgaatta tctgctggat tttacgaaaa tcaacaatct gaccagtgcg      1800
     gacgcaaaga atgataccga aacctctctc gtcgatctag catgcgaatt taatttggac      1860
     actctggtag aggatgttgc ggacaccctg tatgcaggtc atcggtcccc gatcaatgct      1920
     tcccaagtcg ctggtcggta cctgcctagc gggtcgatgg gaattatatc tgccaagggc      1980
     accgagagcg ctacggaatc gaatgattta tcagtcatcg tgggggttga gccaggaaat      2040
     tggaaagtgc gatccaaccc tggcggatgg agacgaattg tcatgaacct gctcggcaat      2100
     tcatttaagt tcaccaagtc gggtttcatt gaggtcaccc tcgccaggaa gatggaggga      2160
     accggcggca ccaagagggt gtatgctcat ttgacaatta cagatactgg atgtggcatc      2220
     gctccggagt acctggagca caaactattt caaccattta cccaggagga catcctgacg      2280
     gaaggggttg gcctggggct aagtattgtc gaccgactgg tgacaaatgc gggtggccag      2340
     attgacgtga agagtaccgt cggtattgga actcaattcg aagtgtacat tcccgttgaa      2400
     tttgtcgata cactggacga aggtgctcct gagcaacagc aaccacagag tgtgtcagtc      2460
     tctcgggttt gtctggtcgg cctgaacgtg ttttccagta tgaagacgtc aagccaaagg      2520
     ctgagtgtta acacgaagag gaggttgtca gttcgcagtg cattgagcaa tgcaatcctc      2580
     agccaacctg gctggacagt ctcctttgcc gacactttgt ctcaagcgaa gggagatatt      2640
     ggtattatcg aggagagcag tctggctgaa aaggcagacc tagagcaaat aactacagac      2700
     ctgacgagac tgatcatact aggacagtat ggtagtggcc catccgtcga tcctgccacg      2760
     aaaaagctgg atgtggtcta cgttcctcaa ccactcacgc ctcgaaagct catcggcgcc      2820
     ctacataccc tttccaactt gcccgaagca agggaacaga tcggtagttc cgatagtatg      2880
     ccacatcgtc aacgcagctt atcggaagct tttgtcctgg ccaaacagac cgagtcacca      2940
     ccagtggtgg agggtttaga gttaggcgag ttccgtggct cgacacccaa ggcttcaaca      3000
     acgaccgatc gccacgtcct gattgtggac gataatgaca tcaatctcaa aattttggct      3060
     acttttatgc gccgcatcgg ctgcagctat gagacagcga ccaacggact cgtggcgctg      3120
     gagaagtacc agcaggccca gcgccagttc aactacgtcc tgatgggtag gttgcctctt      3180
     ttgggagtta tggtccagct aaccgcaata gatctttcaa tgccggtcat ggatgggatt      3240
     atctccacaa gcaagattcg agagtacgag gaggagaatt cccttccccg ggccgccatc      3300
     atggccgtga ccggggttgc atcggcgaca atgcagcaac aggcatttgc cgcggggatc      3360
     gacgattttc ttgtgaaacc tctttcactg cgtgatttga aacgagtgat gatgaacatt      3420
     gcatga                                                                 3426
//

If you have problems or comments...

PBIL Back to PBIL home page