(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE90

ASFUM1_4.PE90        Location/Qualifiers
FT   CDS_pept        join(complement(280397..280502),complement(280173..280339))
FT                   /codon_start=1
FT                   /gene_family="HOG000200111" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274671"
FT                   /orf_name="AFUA_4G01030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84316.1"
FT                   /db_xref="HOGENOM:HBG054712"
FT                   /db_xref="UniParc:UPI00005202E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C5"
FT                   /transl_table=1
FT                   /translation="MKPTLFVLALAGVALGAKTCTPSFDYCAKKLIADKGFTEADLEVV
FT                   LKAEDLETTDLKNVLFHCKNPGDVGHAKVCPNGCTDPATEGSHGC"
     atgaaaccaa ccctcttcgt cctcgcgctg gctggcgtcg ctctaggcgc aaaaacatgc        60
     acgccgagct tcgattactg cgctaaaaag ctcattgctg ataagggatt caccgaggcg       120
     gacctcgagg ttgttctcaa ggcggaggat ctggagacta cggacttgaa gaacgtgctc       180
     ttccactgca agaatccggg ggatgtgggg catgcaaagg tgtgtccgaa tgggtgtaca       240
     gacccggcga cggaagggag tcatggttgt tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page