(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE93

ASFUM1_4.PE93        Location/Qualifiers
FT   CDS_pept        complement(287471..288277)
FT                   /codon_start=1
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274672"
FT                   /orf_name="AFUA_4G01060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84313.2"
FT                   /db_xref="HOGENOM:HBG054679"
FT                   /db_xref="HOGENOM:HBG329730"
FT                   /db_xref="UniParc:UPI0000F51C0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9C8"
FT                   /transl_table=1
FT                   /translation="MPTFTTTSSNPGLDHRLSSPILEHYVYPTFIAVAWCNAIDLIVLC
FT                   FNTFKRYSGPYFWSLLVSSFCIIPFGLGYVLKIYSITFTNYFLEIAILDAGWSGMVTGQ
FT                   SLVLWSRLNLVLDNRRVLKALLYLIIVDGAVLHTACTALEFATNALPSNGVAIAFDVME
FT                   RVQLVGFCLQELLLSGLYIYKAVPLLKMDADRRSRGVLVQLIVINAVIMALDVSVVIVQ
FT                   YLGLFTLQVTSKALVYSIKLKLEYVILGRLVDVSRVRSPAAARMRL"
     atgcctacct tcactaccac ctcgtcaaac ccagggcttg accaccgcct ctcttcccca        60
     atcctcgagc actatgtcta cccaaccttc atcgccgtcg cctggtgtaa cgccatcgac       120
     ttgatcgtcc tctgcttcaa caccttcaag cgctactccg gcccctactt ctggtccctc       180
     ctcgtgtcct ccttctgcat catccccttc ggcctcggct acgtcctcaa gatctacagc       240
     atcaccttca caaactactt cctcgagatc gccattctcg atgccggctg gtcgggaatg       300
     gtcacggggc agtcgctcgt cctctggtcg cggctgaatc tggtgctcga caaccgccgc       360
     gtcttgaaag cgctgctata cctgatcatc gtggacgggg ctgtgctgca caccgcctgc       420
     accgcgctgg agtttgcgac gaacgccctg ccgtccaatg gcgtagctat cgcgttcgac       480
     gtcatggagc gcgtgcagct tgttggcttc tgtctgcagg aattgctgct ctcggggctg       540
     tatatctaca aggcggtgcc gctgctgaag atggatgcgg atcgtcgctc gcggggagtg       600
     ttggtgcagc tgatcgtcat caatgcggtt attatggcgc tggatgtgtc ggtcgtgatt       660
     gtgcagtacc tggggttgtt taccttgcag gttacctcta aggcgttggt gtatagcatt       720
     aagctgaagc tggagtatgt tattctaggg cggctggtgg atgtctcgcg ggtgcgctcg       780
     ccggccgcgg cgcggatgag gttatag                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page