(data stored in ACNUC8465 zone)

HOGENOMDNA: ASFUM1_5

ID   ASFUM1_5; SV 1; linear; genomic DNA; GRV; FUN; 3948441 BP.
XX
AC   CM000173_GR;
XX
DT   28-JUL-2009 (Rel. 109, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 18)
XX
DE   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293) chromosome
DE   5, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; Neosartorya.
XX
RN   [1]
RX   PUBMED; 16372009.
RA   Nierman W.C., Pain A., Anderson M.J., Wortman J.R., Kim H.S., Arroyo J.,
RA   Berriman M., Abe K., Archer D.B., Bermejo C., Bennett J.W., Bowyer P.,
RA   Chen D., Collins M., Coulsen R., Davies R., Dyer P.S., Farman M.L.,
RA   Fedorova N., Fedorova N.D., Feldblyum T.V., Fischer R., Fosker N., Fraser
RA   A., Garcia J.L., Garcia M.J., Goble A., Goldman G.H., Gomi K., Griffith-
RA   Jones S., Gwilliam R., Haas B.J., Haas H., Harris D.E., Horiuchi H.,
RA   Huang J., Humphray S., Jimenez J., Keller N., Khouri H., Kitamoto K.,
RA   Kobayashi T., Konzack S., Kulkarni R., Kumagai T., Lafton A., Latge J.-
RA   P., Li W., Lord A., Lu C., Majoros W.H., May G.S., Miller B.L., Mohamoud
RA   Y., Molina M., Monod M., Mouyna I., Mulligan S., Murphy L.D., O'Neil S.,
RA   Paulsen I., Penalva M.A., Pertea M., Price C., Pritchard B.L., Quail M.
RA   A., Rabbinowitsch E., Rawlins N., Rajandream M.A., Reichard U., Renauld
RA   H., Robson G.D., Rodriguez de Cordoba S., Rodriguez-Pena J.M., Ronning C.
RA   M., Rutter S., Salzberg S.L., Sanchez M., Sanchez-Ferrero J.C., Saunders
RA   D., Seeger K., Squares R., Squares S., Takeuchi M., Tekaia F., Turner G.,
RA   Vazquez de Aldana C.R., Weidman J., White O., Woodward J.R., Yu J.-H.,
RA   Fraser C.M., Galagan J.E., Asai K., Machida M., Hall N., Barrell B.G.,
RA   Denning D.W.
RT   "Genomic sequence of the pathogenic and allergenic filamentous fungus
RT   Aspergillus fumigatus.";
RL   Nature 438:1151-1156(2005).
XX
CC   This Genome Reviews entry was created from entry CM000173.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3948441
FT                   /organism="Aspergillus fumigatus"
FT                   /strain="FGSC A1100 = CBS 101355 = Af293"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 5"
FT                   /db_xref="taxon:330879"
FT   CDS_pept        join(complement(2599..2846),complement(2195..2492),
FT                   complement(1773..2093))
FT                   /codon_start=1
FT                   /gene_family="HOG000207218" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208495"
FT                   /orf_name="AFUA_5G00100"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL86292.2"
FT                   /db_xref="HOGENOM:HBG055624"
FT                   /db_xref="HOGENOM:HBG324973"
FT                   /db_xref="UniParc:UPI0000F51C90"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDN5"
FT                   /transl_table=1
FT                   /translation="MTSGLLIAQLALYAPLTLPTLYLLYRHGHHGLLAWLYLLAFCVLR
FT                   VTGAAMGLNDPHNAGSRIISSIGLSPLLLSIDGVLHEARIYCLSPSKRTEWTFMALIHV
FT                   LVATGVAMVGVGAGGLLGDTPKPSDLSNIKVGMVLLEVSWGVLALWGLWTLWNGTGGGR
FT                   KSARNQGAQAGLAAREGWLLLTGNLLALALVEISVVYMLVAEFTQRADLNPTTGSLAVR
FT                   VVLGFCPELLAAIVLVFAGFVTRGAGEVGAGEAGLGYGQGRRHRHAHGHGRRSSPKHGT
FT                   RSLSRSH"
FT   CDS_pept        join(complement(4274..5290),complement(3152..4150))
FT                   /codon_start=1
FT                   /gene_family="HOG000220823" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267330"
FT                   /orf_name="AFUA_5G00110"
FT                   /product="Squalene-hopene-cyclase, putative "
FT                   /function="intramolecular transferase activity "
FT                   /biological_process="hopanoid biosynthetic process "
FT                   /protein_id="EAL86291.2"
FT                   /db_xref="GO:0016866"
FT                   /db_xref="GO:0019746"
FT                   /db_xref="HOGENOM:HBG055623"
FT                   /db_xref="HOGENOM:HBG535807"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR006400"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR018333"
FT                   /db_xref="UniParc:UPI0000F51CA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDN6"
FT                   /transl_table=1
FT                   /translation="MATLTTTMATTATMATTEASKPLEAQARTALTKATNYAWEIFSNR
FT                   HWCGELESNVTVTCEHIFFLYVLYQHIDPGEGSQYRQWLLLQQNSDGSWGIAPNYPGDI
FT                   STSAEAYLALRIIGMSTDSPELYRARTFIRAAGGLSKMRMFTRIFFAEFGLVPWTAIPQ
FT                   LPAEFILVPAHFPISIYRLASWARSNVVPLLIIAHHRPLYPLPNGLHKQNPFLDELWLD
FT                   PATKPLPYGSSDPTDPVAFVFTILDKALSYLGGLRRSPTRGYARRRCVQWILQHQEKAG
FT                   DWAGIIPPMHAGIKALLLEGYKLHDEPIQLGLAAIERFTWADNRGKRLQCCISPVWDTR
FT                   VYKPNIPVGGWAFEYHNTWYPDIDDTAAAVLAFLTHDPATARSRLVRDAVLWIVGMQNA
FT                   DGGWAAFDHENNQLFLNKIPFSDMESLCDPSTPDVTGRTIECLGMLRDLLMRPAENAEN
FT                   GEKYGYPDGEGDAAADAHLLQIINTACARAIPYLIRSQEATGTWYGRWAVNYVYGTCLV
FT                   LCGLQYFKHDPKFAPEIQAMAARAVKWLKQVQNSDGGWGESLLSYREPWRAGCGPSTPS
FT                   QTAWALMGILTVCGGEDRSVQRGVRHLVDTQDDTLSQGDGGAAAWTEREFTSTGFPNHF
FT                   YISYTLYRVYFPITALGRYLSLIEGGQEKKKKGGGT"
FT   CDS_pept        join(5839..6946,7005..7271,7347..7498)
FT                   /codon_start=1
FT                   /gene_family="HOG000170996" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267331"
FT                   /orf_name="AFUA_5G00120"
FT                   /product="Cytochrome P450 oxidoreductase/alkane
FT                   hydroxylase, putative"
FT                   /EC_number="1.14.14.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86290.2"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG055622"
FT                   /db_xref="HOGENOM:HBG397671"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000F51C91"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDN7"
FT                   /transl_table=1
FT                   /translation="MYTALGLAVFTALFHYTIVLAINHYRTREILSQLVKAHNCCPPKT
FT                   ERPWDILGLVKIYSSTKHLLNETALSNVSALFKCYGDTYASRILTQRVYFTCDPRNIRH
FT                   VLINRFSDFDASDVRAHLFAPITPHGIFAVDGAEWKEARSLYADIFSATRKIFDLQLQE
FT                   DGFQGLIKQIPRGQAMDLAPLFLKLVLDVNSAFAMGTGLDTLKQDQSLEKKEVAEALMY
FT                   AKKIMARDGFLGPLHYLLSRKDFYAACETVKAYVEKVVRKEMTAREYQKQSNAATVDDE
FT                   RQKRTQSLLSRILDNTNDVHAVRDAVVTILIAGTDSVASMLSTTFYLLARHERVYAKLR
FT                   QEILDTIGTEPPTYDNIRKATYLRYVFNEAMRVYPPVPFNARTANRDTYLPAGGGPDGQ
FT                   SGVLIRKGQRVIFASWGSHRSTRSFGADALEFRPERWEGLKSESLGYIPFSAGPRVCLG
FT                   QQYALLEASYATIRIIQTFERLENRDVRPWTEKIGLNLSNKNGVLVELVH"
FT   CDS_pept        8045..9220
FT                   /codon_start=1
FT                   /gene_family="HOG000207229" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751815"
FT                   /orf_name="AFUA_5G00130"
FT                   /product="Capsule polysaccharide biosynthesis protein,
FT                   putative"
FT                   /protein_id="EAL86289.1"
FT                   /db_xref="HOGENOM:HBG055620"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="UniParc:UPI000051F554"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDN8"
FT                   /transl_table=1
FT                   /translation="MAIPTKERGSRLTDADILSDLQMYKPVTDSDTRNVWAFWDKGLSN
FT                   SPAWNQRNVISWVRRLSPKWTVRVLDLVEGSPNHVSQFIPREMLTDVFWNRTMTGPHVG
FT                   QHSSDLIRLPLLYLYGGVWLDVGMLLFRSLDALCWNALEDPETPYEVAAFKVSMGPELS
FT                   FLFNGFIAARRGSVCIKYWHEIFRTLWDGATSCAGMHSHPLLAHLPVYEPPSLNGKRPP
FT                   FMYAQFADYLAQVFCLERLRHLVDSKTGWDGPKFFEEKVLLFDCVTEAYWAQRLTDWNG
FT                   RKQYELLDLQRGEDGLDNARVKEAEALVQGVLSMSSTMKLSHGLVTAGREYLADIWDSP
FT                   KNHDADIRPGTFAAYLREASETFEQTKELVPLRMPVIEKALLRAGVTEVVR"
FT   CDS_pept        join(complement(10322..10498),complement(9396..10277),
FT                   complement(9314..9376))
FT                   /codon_start=1
FT                   /gene_family="HOG000207240" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267332"
FT                   /orf_name="AFUA_5G00135"
FT                   /product="C6 finger domain protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27266.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG324972"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51CAD"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Z7"
FT                   /transl_table=1
FT                   /translation="MLDRSKMTSAIPDSNSSSSPRGHNQSERDSYNRKKRKGPRLAHRK
FT                   SRTGCQRCRARRVKCDESRPVCRDCHRHGIPCVYDRPAEEGAIPPSTGIQSRPLEPSPS
FT                   DPSNDAHMELRLLHHFTLFTSATMPGAHLKRIKDCWSIDVPRLAFSYKPLLHAVFAIAA
FT                   LHLSKVNPDEAGLPDIHCNFLEQALREHRLCIGGITTQTADAVCFTSILLQIDVFATLQ
FT                   SRHVVSYEQVSEWMRLVRGSVAVFDAAMEIVRHNTHPPNIWCIIDTFPMPLRTSSDAGS
FT                   FSFLLPTVPDDEDDETALEAYRGAVAHINATWLAMEAKEHPQISCRRLMVFPLFVTAGF
FT                   IDLLEKRRPRALVPCPHHYVTYGGSETLHTNTS"
FT   mobile_element  complement(12613..13545)
FT                   /mobile_element_type="transposon:hAT transposon family"
FT   CDS_pept        join(complement(15992..16327),complement(15749..15940))
FT                   /codon_start=1
FT                   /gene_family="HOG000217872" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267333"
FT                   /orf_name="AFUA_5G00145"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86288.2"
FT                   /db_xref="HOGENOM:HBG055619"
FT                   /db_xref="HOGENOM:HBG334060"
FT                   /db_xref="InterPro:IPR021054"
FT                   /db_xref="UniParc:UPI0000F51C75"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDN9"
FT                   /transl_table=1
FT                   /translation="MLFSRVTPVALLVALATSALGEVNTKQAIEGMNTLQKRVSKARES
FT                   IEGWDGGLLGVIPIASKMQGVKSSTADTRRTIEQSDAFGDEDQDEVLAAYQQLQPEIVG
FT                   ALNAAEQKAPAFKDAGVAFVARAMMDDLKSEKEKFKTTMQEKVPAERYRSTEPKVAEVN
FT                   AAFDSAHKALSA"
FT   CDS_pept        join(17759..18123,18141..18612)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208496"
FT                   /orf_name="AFUA_5G00150"
FT                   /product="Thioesterase domain protein "
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL86287.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG055618"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="UniParc:UPI00005207F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDP0"
FT                   /transl_table=1
FT                   /translation="MAYHTIRGLAEACQQRHQYIPAVALQPKGGKSPLWLVHAAAGEAL
FT                   IFINLARLINDQPVYAFKARGFVCGEIYFTSIDECVRTYYEAIKELQPHGPHAILEYSY
FT                   GGMLAFELAKIWRRKKISLNRPPYVSARLQEVKWTDCLVNISYFLGLLSRASFRDLLQQ
FT                   LYHLPKKEATACLIKVADPARLVALALDNDKPEQWIDVAPSPQEVGRNYTPQGSVAHMD
FT                   VFHCDPLEFLNVTPQEWQQRLSSWRDSQGRGSTSFTCQASTSLFWDRQTSKHSSTD"
FT   CDS_pept        join(complement(21280..21497),complement(20604..21232),
FT                   complement(20254..20558),complement(19707..20198),
FT                   complement(19084..19392))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751816"
FT                   /orf_name="AFUA_5G00155"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27265.1"
FT                   /db_xref="UniParc:UPI0000F51C65"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Z6"
FT                   /transl_table=1
FT                   /translation="MDQEFDIKVECDDSPSAQGCLGGPIEDRDRPSDKEGEDNSGPGEQ
FT                   SRIYLNVSPSYVGDWDATTAFRELYQNWKDAIIHSFNLHLRDFRPLYQENGDFISITVP
FT                   EMGSNTNALGFIRYEKKYGRVVLVNACAQLRTESLQLGHTSKKGQLQFAGCHGEGLKLA
FT                   AMVMCREGYSVSIETGNSHWSFVYGGPSKTRFYCNIGPLCVATPEVKLNPAQDMACFTY
FT                   RTWRDVCVEVGPDSEGTGGGVSIEEFRQWLTVSLDIHGHSYPESIIETDQGDLIIDPRF
FT                   REARPFELSYNFVQGGVNRDRQRLVSRYEQADMVRRIWESAIRENEALTLPIYVNLLRN
FT                   FPRAPDVELADQLLDHPTRFRIWKYLMKEAGDEKFYFCQKTGSQSVGSITKSLRKEPAA
FT                   LPDTLWNLLRGVTPIRTAYEEQIDMFQNANVCECHRTLFAVTIRRALWASMALCGYPTN
FT                   IQFVHSDNSQIDMVFDMGCRTLKIHDRWLDPGAVHYQSPCRPGMEYALTACGPFFCDHV
FT                   VEELFAMVQGEMSRISPSVMNHSRRHREIRLKSVEFDRLDIHKKYFPMIAANERAAFFG
FT                   QPTSPIHPARLPQPPFYTRWDGTTRNDSLQQVQNTMNPNLGGIVATSLGQATYYDARSP
FT                   KRALPPLYPNDRRIA"
FT   CDS_pept        join(24489..25342,25412..25522,25614..25947)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267334"
FT                   /orf_name="AFUA_5G00160"
FT                   /product="MFS polyamine transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86286.2"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG055617"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51CA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDP1"
FT                   /transl_table=1
FT                   /translation="MADFCVGRTQATLCITLYTLGLATGPLVLSPISEAYGRRWVYIPA
FT                   ISFVLAFSAGAAAAKGFAILLTCRFFSGFFCSVGIAVGGGTVADIWPRGKQRATASLLF
FT                   VLAPFLALTLGPTAGAYVLHIRHANWRWTQWMVVFFCLPLWLMFVVMRETSGEQPLHDA
FT                   NNGWEEIRLSARSFYLPLRLLFTDYIILSLTVYTSFSYATVFSYFSSLQHVLMLDYGFD
FT                   TRQASLGLLSQIVGNFCAIILWVVLEKAATSSEEKLPGKVFQPERHLYAGVIGGLLMCL
FT                   AEIWFALAGRPGGTWVNLVATGIPLGCGAFALFVSSSLFHLLCVRPYKNSYKKCLYLAI
FT                   AANGVSRYTLGAVFPLFTLQMYEKLGTTWASCLFAIISCVLIFIPLFVCKYGVRLRTTM
FT                   TVGATHGDSINRAAKNVDTRITEVCYTEHSVGR"
FT   CDS_pept        complement(32869..33471)
FT                   /codon_start=1
FT                   /gene_family="HOG000136553" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903921"
FT                   /orf_name="AFUA_5G00170"
FT                   /product="Extracellular serine threonine rich protein,
FT                   putative"
FT                   /protein_id="EAL86285.2"
FT                   /db_xref="HOGENOM:HBG055616"
FT                   /db_xref="HOGENOM:HBG324969"
FT                   /db_xref="UniParc:UPI0000F51C96"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDP2"
FT                   /transl_table=1
FT                   /translation="MIGNLALLTWLVFSFLKFGSCFFIDGELNLYGFSPYPGDRTTETN
FT                   TLTVSVHGLVHATASTFTHTSAVPSRTMSVADSISSTAPSSSISGASSLGWHPVAITLT
FT                   KKPTPHWNYNITVAKSSAKYSSSTTPTLTVSTAESSTREASDMETSGFWQEQSTPTTIT
FT                   ALSNNTMISSSADGSRSPLIFSAVMLFGVNLLTGVLL"
FT   CDS_pept        join(34623..35282,35340..35553,35624..35952)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267335"
FT                   /orf_name="AFUA_5G00180"
FT                   /product="DUF221 membrane protein, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86284.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG055615"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="UniParc:UPI0000520334"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDP3"
FT                   /transl_table=1
FT                   /translation="MHAARKTELELLLKKRDDLARNTAIQRRRLPISHLKSWIQVIVSS
FT                   AHLRWQVIRVRAEARKLRSVAIIRFSSLFTAHLVLQATTSSEPFKMKAHILSDKAYDGR
FT                   RHIFKSRLERSIHSISITVILNVLEIVWAVPIAMTGLLSQLSYLDTISIDLADLSEWQV
FT                   SAIQGLAPQAALSLLMYCFPYIICALSNFFVHFEGSSVETLIQRHYFTFLYVQLFLVSI
FT                   PLILARNLPKSCNYFFSYLILQAVVQTSTILFQLPDGLWRGLRRGQAEHSMKRVRWSLV
FT                   YPVFANLICICIIFSLLSPLILPIGLLTFKVFLILYSYQATYVLESDKETSGLLYWEAV
FT                   NYLFVGIYTMDLCLIGLFALQNAVGPTIMAATFLLGVAMVHKHLRSNFSPLIHYISCKS
FT                   P"
FT   CDS_pept        join(complement(38050..38262),complement(37838..37996))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267336"
FT                   /orf_name="AFUA_5G00190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86283.1"
FT                   /db_xref="HOGENOM:HBG055614"
FT                   /db_xref="UniParc:UPI000051F549"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDP4"
FT                   /transl_table=1
FT                   /translation="MESGSEEEIDIQYTDWESETDPTASESDEAFIVYDDEPIEMEDYD
FT                   SSYVPTESEEVASFTTVSDYGETFNERDLGEYITVLDEREIEGNDGRMTELLLNFWAEE
FT                   RVAEEIRDLLHVSRNGPVG"
FT   CDS_pept        join(complement(42399..42498),complement(41963..42333))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267337"
FT                   /orf_name="AFUA_5G00200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86282.1"
FT                   /db_xref="HOGENOM:HBG055613"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="UniParc:UPI000051FEC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDP5"
FT                   /transl_table=1
FT                   /translation="MAHSEFHFEPFEPLREGMHETSHHGTAKILMLHGHGQSGKNFYYK
FT                   TKHFVGPLQQLALQEKFSGDVELFYPDGPWPAPGGEELDVRAWGFGDFEHGLIKGLDIS
FT                   ILKILDILDLYGPFSGVMGFSTGAAVAAIIASILERHERIQMFIGDTSTKAS"
FT   CDS_pept        join(complement(46677..46989),complement(46426..46460))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057178"
FT                   /orf_name="AFUA_5G00210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86281.1"
FT                   /db_xref="HOGENOM:HBG055612"
FT                   /db_xref="UniParc:UPI000052033C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDP6"
FT                   /transl_table=1
FT                   /translation="MMRHEQKAYTASEREIDLIREISWHRGRNRFYRACYQLLKELQEV
FT                   VSEVTDVLLGLYHFNPSPFAQIDYSPVTDIAFRMQEILRTLSDRESEALNAWNDLWTTE
FT                   VLFHRIGPRHS"
FT   CDS_pept        49116..49679
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267338"
FT                   /orf_name="AFUA_5G00220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86280.1"
FT                   /db_xref="HOGENOM:HBG055611"
FT                   /db_xref="UniParc:UPI000051EBA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDP7"
FT                   /transl_table=1
FT                   /translation="MSHRSESDLPSPRTVNFDFTKKPELQNLRKPARISLFPAPSTSSD
FT                   FMFEPLEPHDATDSYFRTKVRFPTTRDSTGDWAFLNMLLSKAIQQISFGGPIRNVNTYY
FT                   YKDESALTPGALVLLTAHRVREGWLQVDISSSGGSLIATAYALCDSIHSSEGIMRPLGS
FT                   PIALRTRMNRAATEKFQDPFSDRP"
FT   CDS_pept        join(50766..51090,51141..52564)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208497"
FT                   /orf_name="AFUA_5G00230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86279.1"
FT                   /db_xref="HOGENOM:HBG055609"
FT                   /db_xref="UniParc:UPI000051FEDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDP8"
FT                   /transl_table=1
FT                   /translation="MAPREYPLTAAYAKFVNAGLIEHIGQGGKPASLPAGVQNATQDLT
FT                   KNQNDRIKKHLENEVNRILEGQSAVLDMGPKYKGTSEDAKKFLQEILELAEKANIDNAH
FT                   AALKKVNSFSPAALETEDIEVSDAPQPGISEPAAPMGAAAAQVKETKPEEESREDEAPG
FT                   AASPEEEIPEEEIPEEEIPEEESPEEEAPGVASSEDKAPGVASPKLQPRSGVRTYGKGR
FT                   RFPAGETAEAFETENIPWTKGDPHDWPWWTYPLPNSGAIMAEKKTQRTDRRRSAPISYY
FT                   LVEIPVQQEKDGAAVTLYQHKLVRYSDYPTEIDEWKRISEETGQERCVFTATDPAGMRD
FT                   GKNYTFLRLEFVAPLTRLSKNGDSPSSLTSEAECVIYAQGYDKPVFLVTSQFKRARGVG
FT                   DKKGKLLISRVCARDGQLIPARTEAKRIWYTNQACPDNAEELELLDDSRASTALPHGQQ
FT                   EQQGIDEDALFGRVQTYVDRRFADFSTELSAAVASSIADEMAKLTINVGSMIEAQIQTH
FT                   MSRGGNRETPSSTNADLRYNTARREAIGRTPQSAATTPRIRERTLPPGFLPSPPRATPL
FT                   HQSIEA"
FT   CDS_pept        complement(59436..59855)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267339"
FT                   /orf_name="AFUA_5G00240"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86278.1"
FT                   /db_xref="HOGENOM:HBG055608"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI000051FEDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDP9"
FT                   /transl_table=1
FT                   /translation="MSAFDSEFCFIYASVATDFGNAVLDQNELLHPCTTGAFLIPNSIL
FT                   RWDHGLGEDAMALSFSVADESIHIVNLHGMLDFIQDLPYVANSVTYRGDHNTPSQKSRW
FT                   SVIEKEIISCAVDSAANSSRKDAIKTDMLSEELRN"
FT   CDS_pept        join(complement(60890..61033),complement(60204..60836))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267340"
FT                   /orf_name="AFUA_5G00250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86277.1"
FT                   /db_xref="HOGENOM:HBG055607"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniParc:UPI000051F7B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDQ0"
FT                   /transl_table=1
FT                   /translation="MHFQPFLRHTRFLPVKFGMLSLIFIAITVWRLKHGYFQPFKSASQ
FT                   KFVTSTEKLYLSGFSSDGDVEKIGCDDLRQTGYLDIERSILLHDNITQIALSVSSHPMI
FT                   QEILDQTAHGVKIFEPHDLIESHLSQFAGSGVWLSQLNVYIVASRVVYTAPGTSWPTIS
FT                   FLRGRVFDKSWRHLENYTIDWYGKTTTFPLLFEIPTVWWKDGSFFGPEDPRIVLEEGVQ
FT                   GAEPIIVFNMILNATGYPRVMWIFKPFSRIISYLRI"
FT   CDS_pept        63859..64734
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057179"
FT                   /orf_name="AFUA_5G00260"
FT                   /product="Ferric-chelate reductase, putative "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86276.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG055606"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI00005200F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDQ1"
FT                   /transl_table=1
FT                   /translation="MRQAGISLGALAAISIPWFRQWSYELFLRGHQLLAVLFVYGTWKH
FT                   LQGRSRLSNIYFFVGLGVFGLNFLFQLGLLLYRNGLFAGRGFPRAEMSFSTTKSKEDIV
FT                   VTAAHVRVSLPRPVQLESGQYINLWVPSVSLWSWAQTHPFTVTSWSKGPRNTIELLVQP
FT                   CRGLSADLARFATVAGETPVSFCALFTGPHGRSEDVRHYESILVIASGFGIAAAIPYMK
FT                   LMIYGYYTRTIKARQLHLVWQVGSRAEITAAEHLLNNLLEDDHKDHGYVRITMLRDSLW
FT                   TADNDRGFRS"
FT   mobile_element  complement(72750..76289)
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   CDS_pept        join(78168..79835,79889..80024,80084..80337)
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267341"
FT                   /orf_name="AFUA_5G00280"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86274.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG055605"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EDDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDQ3"
FT                   /transl_table=1
FT                   /translation="MEATAQRTRSSLQESGKLIHFKSGGNALEKRSWSGILVILYSPGF
FT                   PHVSPGQGPAVGSPSRTGSEERSGPRVCRTDFRPLSRSRSACPSCESCMQSWHHLAASR
FT                   QHRPRTLLSPSLYYDDYLGSPPSCSPKSSLTEEHISKLTFPSPLHGYKSDISKQRAPYT
FT                   SRTTIIKLLTMTLPIPPNIMFSFTSLRGRGLTIGITACCGVSFMLFGYDQGVFGGILSN
FT                   PTFQKQFDHPNTTMQGQIVSTYVLGCVAGAFLSMYTGDRLGRRRSVLLASAFLTIGGIL
FT                   QSMAFTLPHLIVGRIVAGLGVGMNTTTVPMWQSETCKQEDRGKLITIQLTHLVFGFVLA
FT                   NWINFGFTYSPYQQISWRFPLAFQSFLAILAASMVPFLVESPRWLCVRSRSPAAKEVIA
FT                   RVLDKRLEDDEVLTSLQSIETTVAHEMESQKPGWRTIFSNGPQQTFRRIALGVGVNFMQ
FT                   QFGGVNVVAYYLPIIMKRSFGFSDRMSLILSAVDSMQWMFWTGLGTLLIDRLGRRKLLI
FT                   VGAAGQSLCFAMTALGLGIGTKPLEGLAVAFIFVYYAFFGLSFLAIPFMYPSELNSSIH
FT                   RNFACSAAMVMEWLGVYVIVAITPVGIESIAWKFYLVFAIANFVFTIVCWFFVVETSGL
FT                   SLEEIDKMFEIKYYGGKSMTYLEAAKKAKGNPLCHEICEDGESKDKQRSF"
FT   CDS_pept        complement(81415..83670)
FT                   /codon_start=1
FT                   /gene_family="HOG000217219" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208498"
FT                   /orf_name="AFUA_5G00290"
FT                   /product="C6 transcription factor, putative "
FT                   /protein_id="EAL86273.1"
FT                   /db_xref="HOGENOM:HBG055604"
FT                   /db_xref="UniParc:UPI000051F2E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDQ4"
FT                   /transl_table=1
FT                   /translation="MNNMTSLDSLVRLIQASPQRSDVFGWDSLYGSGDPPSIANSNESG
FT                   AMKGQQELESLESLGELSSVASSNNHPADSTLHIGWNGFANPEMTGCGSDSSEVNVQSI
FT                   VSGLSQGNLIYRSRMSSMPSQWGDSQTGWRRVDRQRNESMNMRDHHALSLSTFGPDHLI
FT                   MENTNKIFISDSLLQIYHDVLENNLACWLAEDTCPYGLQWRRREPLPIPQKPIAGTKTY
FT                   PEWGVAWSNRMFQRVRQLDRSAQSAKLIRLTAYENQASSKALNLAVMAFSTQWAQGKRG
FT                   WDELHGASRCENFMDHKGEELGDEFEQALRHSIWEQAKRALQDVSDLECFRVVFAELIF
FT                   GLVQKPYSRNEYDLDATIGLATRNLCKSGTNSISPTIADIFAREGPPIFMERGARKMHA
FT                   LKYRFEAYQAGFRQGARSFESEPNAGPPQEMSAEDGQTIGLLYWLAVMFDTVSSSINER
FT                   PVVVPDEECQHDGAQRAAKDPLEIPVTNVRWKLDLYAQDDTERPSLLHWPCTYDVATRA
FT                   VARSAAVKVLLFRHISYLQNGLRNCENGPAIEEIIKTTLSVYRYWDVTHGAFFRDLIMN
FT                   YESVPPRIRSWFPCISIPWHLGSLMLANLIDYVDEHRLGCDSNRAKRLHVGLAAKIRRA
FT                   SSIELAQFAAVITPQAIGAIGLKQLPDFHFAVNESPALTEPWTILFIRAFTDAAVFHIG
FT                   EIEELQNHQWSDIDHTSEALQVSTARAESCIRALRFLGRKSRMAEDIGTVLSKHLDT"
FT   CDS_pept        join(complement(86139..86991),complement(85984..86079),
FT                   complement(85839..85927))
FT                   /codon_start=1
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18208499"
FT                   /orf_name="AFUA_5G00300"
FT                   /product="Zinc-binding oxidoreductase, putative "
FT                   /EC_number="1.1.-.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86272.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00005207F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDQ5"
FT                   /transl_table=1
FT                   /translation="MKAVVYTQNGTVEVLDRPKPTVQQPTDAVVRMLHASICGTDLHIL
FT                   KGDVPTAKPGLILGHEGVGIIEALGSAVQGFQVGDRVIVSCMTSCGSCRFCQRSIQSHC
FT                   QQGGWTLGHQVDGTQAEFVRVPHATLSLHPLDSSVDTCAAVSLSDALPTGFECGVCNAG
FT                   ISPTGSVVIVGAGPVGMAALLMACLIKPAFIVMVDLDDARLETARTMGAHHTVNSAAPD
FT                   AIQQLLDLTENKGYDSVIEAVGIPATFEMCQELVAVGGQIANMGVHGVKVNLHMEKLWD
FT                   RNISIHMSMCNATSTRHLQNLVKKGELDISSLVTHRFPCDQAVAAYDTFKAASKHRALK
FT                   VAIDF"
FT   CDS_pept        join(complement(89346..90006),complement(88046..89292))
FT                   /codon_start=1
FT                   /gene_family="HOG000240003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267342"
FT                   /orf_name="AFUA_5G00310"
FT                   /product="Flavin-containing monooxygenase, putative "
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86271.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053468"
FT                   /db_xref="HOGENOM:HBG700572"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000051F53A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDQ6"
FT                   /transl_table=1
FT                   /translation="MARVDVQQSVPSHLRTVPGSFNIPPASLPAPSKVGTFDPERVASD
FT                   LVDVFNLALDQHNYPKVTSLFTDNGFWRDHLALSWQLRTVHGHEAILKYLERCSESRDG
FT                   MRLRRISIDRSSSVRAPKAWVLDGAGEVQGIQFFFEAETVHGSAVGVARLAMQNDGWKI
FT                   FTLFTSLQELKGHEELLGHRRPKGAQHGDHPDRKNWAERRADSMAYIDNCEPTVIIIGA
FT                   GQGGLTAAARLKMLGVDSLIIDKNESVGDNWRLRYRQLVLHDPVWYDHMPYVKFPAHWP
FT                   IFTPKDKLAEFFECYVKMLELNVWNRTTISHCEWDEQTTTWTVSLSQKQSDGTCQVRTF
FT                   HPRHIIQATGHSGKMKMPYIPGMENFQGKRLCHSSQFPGAEKNGSGKKAIVVGSCNSAH
FT                   DIAQDYQEKGYDITMVQRSTTCVVSSAAITKIGLKGLYEEDGPPVEDADLLLHGTPTPV
FT                   LKVLQAHITSKEVEHDRELLDGLERAGFKVDHGPDGSGLLMKYFQRGGGYYIDVGASQM
FT                   IIDGKIKVKQGQEIAEVLPHGLRFADGSELEADEIIFATGYDNMRTQTGMLLGNKVADK
FT                   VSDVWGYNEEGEIRTMWQDSGHQGFYFHGGNLATARYYSKVLALQIKALEEGIHRYGEI
FT                   "
FT   CDS_pept        join(complement(91394..91528),complement(91159..91320))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267343"
FT                   /orf_name="AFUA_5G00320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86270.1"
FT                   /db_xref="HOGENOM:HBG055603"
FT                   /db_xref="UniParc:UPI000051F065"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDQ7"
FT                   /transl_table=1
FT                   /translation="MCNSHTFAIPRDQLTDLQQLFGFIVNLGASSSPYWVVCIHVSHYH
FT                   RVGSALPLKVGIDRFRSSHDGIIDAKTPGSRQTEKENVDPDGLAAVTIQQANV"
FT   CDS_pept        join(91964..92628,92664..93063)
FT                   /codon_start=1
FT                   /gene_family="HOG000048449" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057180"
FT                   /orf_name="AFUA_5G00330"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL86269.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG055601"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniParc:UPI00005200F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDQ8"
FT                   /transl_table=1
FT                   /translation="MYDVHGKTYGSQGFFEAAHALGVSLIVLGEPDHWLASETYSHLHK
FT                   EFIALDLSQHTNLPNRIAAAVCGRAIDGIIVTFTDEYVVTTAEAAEILGLRTEPALVMW
FT                   QAHHKHEMRQLLLSLLDDDNANNKVQAVRLHSAAYLDHPPPANQLAALQYPLGVNPCRG
FT                   QFSIGVKKVSNEASLRQAVAILGEDNQLAEQGIMLETYISGPELDANFVLLDRAVLFLR
FT                   SATLAANFAETLQISNTRFPLWEFEAIREKLSQSLRALGFRSWVFHVDARMRKTALRYG
FT                   LVDVRDGDGEVGGSIIDLIAARESELTRPRHPPLLSMTPSSSRLMSVPLAQEAPGPLCI
FT                   RTGWTSAPTRSCAR"
FT   CDS_pept        join(complement(98038..98172),complement(97814..97945),
FT                   complement(97673..97698),complement(97166..97624),
FT                   complement(95362..97112),complement(93541..95303))
FT                   /codon_start=1
FT                   /gene_family="HOG000185453" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267344"
FT                   /orf_name="AFUA_5G00340"
FT                   /product="ABC multidrug transporter, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86268.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG055600"
FT                   /db_xref="HOGENOM:HBG332181"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000051E93A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDQ9"
FT                   /transl_table=1
FT                   /translation="MGRAICSVSTKNNLTSIFNLRVSFSRLFPPSCLFHHRYGKLWHGY
FT                   GAIIIYTGLELALLILAVVGSSHISRLFIASSVLQLLSALFMLMTIYQRLFTEGLPQSK
FT                   IGDLGCNQHSPEETSGIFSLGVFFWLNKLFLAGYRHIFTIESLYPLDSTFDAQALHEEF
FT                   AKKMDYTKLKGDKFGLLKVLVRTLWVQLLLPIPPRAALIAFYICQPLFIESLVMYLSHS
FT                   DPDPNVGYGLIGAAIIIYSGIGISYALYWYCHHRVRTMVRSILVTETFKTATRVRLGAG
FT                   DDSAALTLMSTDMERIRMGLRFMHETWASIIQAGLAAWMLYGQLGVVFVAPVGVVVTCF
FT                   VGLGILINFTGDSQRSWMCGVQKRVGLTATVIASMKWLKISGLTGPVAEYVQQLRVDEL
FT                   AAGARYRRIMIIAAVFAFMPQLISPPLTFAFAQNPLNASTMFTSLSFLTLLTQPLSQLF
FT                   QSIPELVSGLACLGRFQAFLELEPRRDYRQPLVEAQSCSMEKSSKQLNLKSTDCVVIRD
FT                   ANFGWKADKFVLNNINTQIPAASLTMVIGPVGSGKSTFCKALLSKIPFSQGSVVMSTPP
FT                   RHVGFCEKTAFLWNGTIRENIVGFTPFDRERYDQVIEATSLRFDLATLLQGDQTNIGSG
FT                   GVALSGGQKQRLSHARALYLPSDFLILDDVFSGLDADTEEQVFRQVFGPDGLLRRRGST
FT                   VVLCTHSVRHLPTADYIMALENGSIAEQGTFVHLPTRAGYVQRLEVGLKPEGEDTNADD
FT                   EPGPCPKLFEGQTRTGKKLDPAITVNSTQSSTLNASAEAGARQVGDATVYKVYIKSMGW
FT                   FVAACSLFFAALWGLFTNYPTIWLTYWSDATESIHPAHPNSYYAGIYALLQICAIIALL
FT                   LLGITLFIVSVKKAGANLHQQALSTLICAPLSFFTNTDTGVVTNLFSQDLNLIDTELPE
FT                   ATLNTLFCIFQSLGQAAVMLTSSVYLAISYPILGGLLYFVQKYYVRTSRQLRLLDLEAK
FT                   SPLYTHFLDTLKGIVTLRAFGFIPNDIHKNTRLVDSSQRAAYLLMIQEWLNLVLNLVVM
FT                   VIAAVLTTLAVRLHSNSAFAGASLYSLMTFGESLSGIVISYTRLETSIGAIARLETFNE
FT                   AGTPEDRDGPGEEDIVPDTNWPDRGLVKLCNVSAQYKSTTVSNTDSESDSNSVVHGAAK
FT                   PPLALKNITLTIHPGEKVAICGRTGSGKSSFLALLLKLLDPLPSTSNNHNHEPPVLIDN
FT                   IPLHRIHRATLRQRLIAVPQDPVFLPDGTSFRANLDPTNTATPEECQRVLEAVQLWGFI
FT                   QEQAEGLHAPIRAGTLSAGQRQLFSLGRAMLRAIIRLRSTSSSYKEGSDSQDQGGILLL
FT                   DEVGSSVDRETERVMQEIIRAEFRHYTIIAVSHRLEMIMDFDRLVVMDRGEVVEVGNPA
FT                   ALKERAGSRFGELVAAAAA"
FT   CDS_pept        join(98367..99072,99302..99804,99962..100516)
FT                   /codon_start=1
FT                   /gene_family="HOG000253034" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903922"
FT                   /orf_name="AFUA_5G00352"
FT                   /product="NRPS-like enzyme, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="EBA27264.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniParc:UPI0000F51CBB"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Z8"
FT                   /transl_table=1
FT                   /translation="MKLAPKCSQDGYVQIHKRIYKDNGAIWSIAEGSYMDAPHNLPAHP
FT                   AHTMSNLTTRTMNDSHSSEPLHGTVVDLFDQWAEKFPERVAAEWQGKSLTYGALRDASL
FT                   HVSRALLRAGLLPRARAPLLTQMSLEMLSAVIGILRVGPCYVPMEVAAGSSARIEAALS
FT                   ELASPVVVITSPCPGLQLPTITVNFRGDGLSRHHRTKKAYEWSWRHAEEECGLRTLRGL
FT                   FSPRAQQASKGSDFSKFLKQRGYSIPAAQVLRLDTIERLEDRLRSQSNIEVAEGGSRNL
FT                   QATATPVQRLFLKWSIETPHTFAIIGLTKYIGDSSRTPTASDLRGAMEKSLSAHSIFRT
FT                   RFDLTGSTLSDLSRHNLTWGEVSVSEDELEQACASAEEESWQAVSRNTRADNEVPYCAV
FT                   TCISLYTSQPRTGNAMFHQDARVHTGLVRSATPGRERTSPPEALNLIRLQSSPTITRAA
FT                   LDASSRRLSVTPSTMIYAAWALFLHSITSWVHVCFSVSLSGSTVPWPSAPSVVGPLLCR
FT                   SLFSTSIVKDATAHDWLATVHKTTLDIIEFDGLTHSLPPSLMADPRTNTSNVLYFLDVP
FT                   APSQNWSHKDR"
FT   CDS_pept        join(102374..102835,102920..103100,103152..103618,
FT                   103728..103829)
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208500"
FT                   /orf_name="AFUA_5G00370"
FT                   /product="Amino acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86265.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG055597"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000052059F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDR2"
FT                   /transl_table=1
FT                   /translation="MDTTSLTSPNKPQELHPVTEPGGPKTIMSSLDKVQTKTEEGEIVD
FT                   HGADTQLHRSLGTRHLTMVALGSAIGMGMWLGSGTSLLKGGPASLFIGYLISSSILWSV
FT                   SQCIGEMAVVYPLPSAFVQWTTIFISPAAGFALGWGYWFSYWITIANELQFVVTILNYW
FT                   TDEVPKAAWITIFWVVIILVNIWVVKFFAEVEVVASTIKFSWMLIAIVALIVITAGGVP
FT                   EQQGPIGFQYWNEQPFINGFKGFITVLPTCVFAMAGSENAALVATEVANPRRSVPKAVT
FT                   SIWLRLGLFYILGSLMITLTIDPKDPNLFGGFGSNASPFVIAFKNAGIPAMAHITNAVI
FT                   FISVISTGSISGYGGSRMLMGLAHVNMNFKIYGEADKMGRPWAGYITTIGIGGALAYIN
FT                   VSNT"
FT   CDS_pept        complement(105691..107442)
FT                   /codon_start=1
FT                   /gene_family="HOG000050281" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267345"
FT                   /orf_name="AFUA_5G00380"
FT                   /product="TPR domain protein"
FT                   /function="binding"
FT                   /protein_id="EAL86264.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG074714"
FT                   /db_xref="HOGENOM:HBG326069"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00005205B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDR3"
FT                   /transl_table=1
FT                   /translation="MSAFQFPPVPSPVSATEEYFDLGAHGFPITTKNRDAQVWFDRGLI
FT                   WSYAFNHEESYRCFQQVLAHDPTCAMAYWGLIYAMGPNYNKTWQLFDPTDLERTFKFCH
FT                   HAAQKAGKLAHDNQNIKPVERALIKAISHRFPVDHPVSDFSTLDRHYAVAMEEVFREYG
FT                   NKDMDITTLYIDAIMHTAIRKMYEVKSGAPVEGAPVHKLRAIFDEALAKPASDSHPGLL
FT                   HFWIHFMEMSSTPGVALPGADKLRHLVPDAGHYHHMPTRIDVLVGDYRRSIDSNTAAVT
FT                   ADEKYLAKEGAKNFYIFYRFHNYHSLIYAAMLSGQRRIALDATTRMEASITDELLRVET
FT                   PPLADWMEFFKAVRVHVYIRFGMWKEIIDLPLPEDQALYCVTTTMIHYGKAIAFAATGN
FT                   LVQADKERSLYHAAARTVPPTRKDFPNLISDILKISDAMLDGEIEYRRGNYPVAFENLR
FT                   KAVHFDDSLRYTEPWGWMVPTRHAYAALMLEQGHVEEAAQAYAEDLGLDSSLTRAHQHP
FT                   KNVWALHGYHECLVRLGRESEARIIKQDLDLALQVADVPIKCSCFCRLGALESDENGGS
FT                   CCQGAYQ"
FT   CDS_pept        111861..112097
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267346"
FT                   /orf_name="AFUA_5G00390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86263.1"
FT                   /db_xref="HOGENOM:HBG055596"
FT                   /db_xref="UniParc:UPI00005205B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDR4"
FT                   /transl_table=1
FT                   /translation="MVLWRIRTAMCSGNISSCAYLLDRPCAATEVQDAERLVEELRYGM
FT                   EALERSIAADVVFEGIRMIHKEAERVYETVLMD"
FT   CDS_pept        join(complement(114264..114899),complement(113522..114217))
FT                   /codon_start=1
FT                   /gene_family="HOG000200289" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057181"
FT                   /orf_name="AFUA_5G00400"
FT                   /product="Aminotransferase, classes I and II family,
FT                   putative"
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="EAL86262.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG324870"
FT                   /db_xref="HOGENOM:HBG502043"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051E4A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDR5"
FT                   /transl_table=1
FT                   /translation="MGSITPPFSSLPRSSESYFSTRGQSALDQGRKRITWDVISDMWHP
FT                   QRNPSGILSIGMAENTLLHDTLLEYIHANIRLSAEHLTYNNGSMGSHALRKAVSHFLNR
FT                   QFKPFRPIEPSHVLVTNGCSSAIEHLSWTFLNPGDAVLLAMPYYSTFIADLSLRPEAVV
FT                   VPVHLAGFQDPLDPKTIDKYEEAAVEFEACTGKKVRAVMLCNPHNPLGRARGMHLISDE
FT                   IYALSVWNNRVDNPDNVPFTSFESVLSRDTTNLIDPSLVHVLWGMSKDFGANGLRVGAV
FT                   ISQSSPDFHIAQKCLSLYSFVSSLSDQITTSILMDDTFTNNYIKMNREKLSECHEFLAL
FT                   LLDKHRIEYMHGCNAGFFLWVNLGKRYLEAHPDEQKVGQREGQDEWGTKLTDVIFQKLL
FT                   DNKVYVAHGTAYGSEKPGWFRLVFSHPLPWLEEAMARIIRAITQ"
FT   CDS_pept        join(complement(115927..117567),complement(115692..115865))
FT                   /codon_start=1
FT                   /gene_family="HOG000050281" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267347"
FT                   /orf_name="AFUA_5G00410"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="EAL86261.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG074714"
FT                   /db_xref="HOGENOM:HBG326069"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000051EBA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDR6"
FT                   /transl_table=1
FT                   /translation="MSSLLAMSPVLASNEYYDLGSFGRTITTTSTDAQIWFNRGLTGVY
FT                   SFNHAEGAYCFQQALAHDPECAMAYWGLAYAVGPNYNKQWEKFDQGDLHTSVQRGYNAA
FT                   REARKHAAVRATPLERALVDAIQSRFPTSEPAKDYPAVNRDYAAAMKTVYETYRRDLDV
FT                   ATLYADALMNMTPWALWDLFTGKPDPKAPTMEVKAVLERALAQEEDGALRNPGLLHLYI
FT                   HFVEMSPTPELGINAADHLRDLVPDAGHIHHMPTHLDILIGDWRRSISSNYKSTLADDK
FT                   YFRKSGAKNFYTFYRLHDYHSLIYAAMFAGKSKVAFDAVTRMESTVPEEVLQIRSPPMA
FT                   DWLEQFMPIRLHIMVRFGMWEELKLMEPPQNQTLYASTTATTYYARAIAYAATGDIPSA
FT                   KKQQSLFHDAWARVPETRRAYNGKMIDVLKVADAMLEGEIEYRCTNYGKAFAALRRAID
FT                   LEDKLPYSEPWSWMQPVRHAYAALMMEQGYLEEALQVYRADLGLDASIIRPRRHPNNVW
FT                   SLQGYHECLVRLGRHEEAAVVEQPLILALAKFFLTDAVLLNERLQWDEDDQCGVQLEIG
FT                   MDGQERKKKVNKNKQEEGGGRGVMGKTC"
FT   CDS_pept        join(118071..118334,118446..118983,119097..119755)
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267348"
FT                   /orf_name="AFUA_5G00420"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86260.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F539"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDR7"
FT                   /transl_table=1
FT                   /translation="MGPSAGENAHETDQESRYCSLIDFDADDPDLPLNWSFSRKIWVTS
FT                   MVAILNLIGTIASSIFGTGIKEFMQEFNVSNEIAVQGTTLFLAGYIFGFLIFGPLSERF
FT                   GRKWPMLIGITASSLFDLMPALGTNVATVLIGRFFGGLFGVAPVAIFGGVLSDCWPLAQ
FT                   RGIAMALAVSLVFSGPTWGPVCGGFIMGSPSLGWRWTMWVVVIIGLGFTLLCVLLYPET
FT                   YPPVILRAKVQALRRKNGNLNIRTALDKGGLSIQDIMSVYLVRPFWLLATQPILALLTL
FT                   YQSFVYGVMFLFYQMYPVAFGDDRNWTTSLKYLPLLAIITGTFVGALGIVLHNQLYFRH
FT                   HCHNPDGTYIPESRLPPMIVGCVMVPAGMFWFAWTASPDNVSWASPICASFMTGCGMYL
FT                   LFIQGWNYIIDCYTSMANSAMGINGSMRSVFGAVFPLFANQMVGALGVAKTTTVLAAVS
FT                   VMLVPVPVCFWYWGSRIRAWSSAEVIGS"
FT   CDS_pept        join(complement(123668..123740),complement(123532..123614),
FT                   complement(123408..123478),complement(123064..123355),
FT                   complement(122944..123015),complement(122176..122889),
FT                   complement(121999..122103),complement(121699..121911))
FT                   /codon_start=1
FT                   /gene_family="HOG000216673" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903923"
FT                   /orf_name="AFUA_5G00430"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86259.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058861"
FT                   /db_xref="HOGENOM:HBG324966"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51C93"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDR8"
FT                   /transl_table=1
FT                   /translation="MAQSQYDIPSTDHYQPPGTFLLIQNETAESENYVRSQVILHPVPS
FT                   RDPNEPLNWSTAPKVVNFTLVLAVTVVIFTTLSIQVIFWQLMVSDMNVTYAQLNNAMSV
FT                   NFVGLSVGCIFFIPLEKKLGRRPVYLVSTAIMMAASFWSAWMKSLPELYISNLLYGLAG
FT                   ATNESIVQITIADLFFVHHRGGMNALYMAMVMIGSFLTPMAAGTQATREGWRASYRALG
FT                   IADAVLLGLFIFFYEETKYTQVVMGVSSSVQVGDAPNISVKDIKTDRQPDIECTTSRQE
FT                   SDTAPAQHCQLDYNIPLKTWRQRLALVSYTAEPIWPYFHRPFVVLSTFPAVLFCALQYA
FT                   LGVVWLTILSSVVGLVFPLPPYNFTPQQVGFMSIGPFVGNLLGSIYGGLLGGRSILFFA
FT                   RRNKGYYEPEMRLYILHLPALTLAGGLIMFGTTIARGLHWIWPSIAGGLFGFGLGSIGD
FT                   AALALVIDSYRDMWPFLRNAISIGIPFAISPWLERSGAQNMFLTCGFVSLAVTLTIIPM
FT                   VLYGRKMRMLTAARYRVMAGLRD"
FT   CDS_pept        join(124091..124106,124165..124620,124689..124766,
FT                   124864..125096,125155..125967)
FT                   /codon_start=1
FT                   /gene_family="HOG000048450" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267349"
FT                   /orf_name="AFUA_5G00435"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86258.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055594"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051F2B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDR9"
FT                   /transl_table=1
FT                   /translation="MTGRPPSPSPIFPSLCIPTPTRNVDPQSYPSFARRMVANPPPIHL
FT                   LSFVFQAAADSFDRHSWTCKAKHRKCDRCRPTCQACTDQGIPCDGYEVRLRWGSGIASR
FT                   GLYAGAEAPVDTSIPPRVPGRRRDRIRARRAQQEGEIRTQVTEVTSSQDYAQEDSRPSP
FT                   ASFSFSSPGHSKDDEQLFQDFHDEQILLKLRLPALCQKSEALYRICIALQASLSGKPAA
FT                   CSLEYLEVGLNKFRAELSESEGNLEDGTLTAGLLLCTLGVMHGIPWTMHLRGMYTILRM
FT                   HDVEGPQKHQERGAFRAHLFEVMGIMDLPTFSIGRRHPHLGFWRRYCCKGKSPAEIETG
FT                   VEVVTGLPRSLLTIFAFIGKGTTEICFWDWPGAQGTFIQCQLWEAYRLAGVWVVRHGGP
FT                   GFPRPSGTEATLDPAMRRGVTLTSTSVIVSRLLSSVDAVCRATLDPERWDTLIINAIAY
FT                   PVCVAGLQSGILQRDPAMKELVRKNLLLTAEGPIWNRQYRLLLNLLEEYWTYPVGAVDI
FT                   DQLAQARGVELGLF"
FT   CDS_pept        join(complement(126850..126892),complement(126399..126781),
FT                   complement(126018..126341))
FT                   /codon_start=1
FT                   /gene_family="HOG000234620" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267350"
FT                   /orf_name="AFUA_5G00440"
FT                   /product="GNAT family N-acetyltransferase, putative "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EAL86257.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG055593"
FT                   /db_xref="HOGENOM:HBG331530"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000051EBA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDS0"
FT                   /transl_table=1
FT                   /translation="MATDQELPLFQVHNDPESVRAVADTITASFADDPLIRWQGPLAGS
FT                   WSTSDPNTSEWQYRRVLKAVADGIVFISATVAEVDRRFHKDGKLCERSIVERDAGVVAL
FT                   LFPPRRRCRWTLGRILLWLKVWFLDIVSPVHEKGANDKRLKQLMDAHERVVTNVKDTYR
FT                   ISDLWYLEVIAVHPYLQGRGLGKKALRSVLDHTNDEPIILECTKEDNVVVYERLGFKVV
FT                   EEVELVQDGAGVKLWFMLRQGQQKQTD"
FT   CDS_pept        join(complement(130082..130723),complement(129099..130031))
FT                   /codon_start=1
FT                   /gene_family="HOG000216675" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903924"
FT                   /orf_name="AFUA_5G00460"
FT                   /product="FAD dependent oxidoreductase, putative "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL86255.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG055591"
FT                   /db_xref="HOGENOM:HBG331533"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000051F7B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDS2"
FT                   /transl_table=1
FT                   /translation="MAFLVQSLLSNPGIPLQARQEALDRVLSDPGLPTPNPTSSFWLRS
FT                   PHPDLTEIQSPKLPVEADVVIIGSGVTGTSIARTLLESRKPRNNDLGQEPAHRPAIVML
FT                   EARDICSGATGRNGGHILETAEEFADLEEAPGTDAARKILRFRLAHLRELLAVAEQYGL
FT                   TKTAQARKVQFLSVYSNQKRWSEARGRFQRLKEGLPETKEWRLYAKEDIPKEFSLPYAQ
FT                   GIVAGPAGAIWPYKFITGVLGHLKVKYPDELRIETNTPVTNIEDHRRKAPDGLRYTLTT
FT                   PRGIIRARHVVHCTNAHVAHLVPGMKGLICPVRGQMSAQHPGVKFRTQGVEHSWLFNYD
FT                   RGFDYLTQLPPSPSDAGEMMMFGGGFSQSEGSGISDLGVSTDSELSLYADIHLSGALSA
FT                   VFGHENWGAVPVRAVEQMWTGIMGFSADGFPWVGRLPGSLARRSQDAQEGRSAEWVSAA
FT                   FSGEGMVLAWLCGKALGMMLLGDDNNLLTGGEAVDLSWFPEQMLITEERATKVAHAFSV
FT                   PDVSPHL"
FT   CDS_pept        join(132072..132377,132450..132729,132791..133668,
FT                   133726..133813,133871..133983)
FT                   /codon_start=1
FT                   /gene_family="HOG000158126" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903925"
FT                   /orf_name="AFUA_5G00470"
FT                   /product="General amidase GmdB"
FT                   /EC_number="3.5.1.4"
FT                   /function="amidase activity"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="EAL86254.1"
FT                   /db_xref="GO:0004040"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG327754"
FT                   /db_xref="HOGENOM:HBG348222"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR015830"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI000051F2D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDS3"
FT                   /transl_table=1
FT                   /translation="MAISPSPKTDWQALVAAKRKRLDAQIPSEWRLSDDFRASVPANGH
FT                   LIEADIARRSGILSDEELDISEKFSAVELLKNLAERKFSAVDVTTAFCKRAAIAQQLTS
FT                   CLTEHFFAKAIERAQFLNEYLQREKKVIGPLHGLPISIKDNFCLEGIRSTVGYVSLLQN
FT                   ETVSHNSALVEILLDLGAVLYVKTNIPQTMMVSDSENNIFSRTLNPHNTNLTAGGSSGG
FT                   EGALVAFRGSILGVGTDIAGSIRIPSLCCGVYGFKPTTDRIPWGGQVAGLAMEGIPGLK
FT                   PSAGPLGHSLADIELFMSTVLKAEPWKYDVTASASPWQELPLTPAYSSQDKLTIGILPE
FT                   SKDFPLHPPVRRALESAIKSLCQRGHHIVRLPDDPSRDLAYAGRLAFQYFIYGLHIDHI
FT                   TSSGEPLVTSVAKMSSPMFTGPFPVDMELPPFEKINALHTARQEYADAWRRCWVGNGLD
FT                   VVLAPGAQNTAVPHDTFGWPPYTVIWNLLDYPACIIPYGEACKELDPVPMVIDDGVQPS
FT                   YDPDSIDGAPTAIQVVAPRFQDEKCLRAARIIDATIQ"
FT   CDS_pept        join(134985..135401,135454..137148)
FT                   /codon_start=1
FT                   /gene_family="HOG000181424" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16267351"
FT                   /orf_name="AFUA_5G00480"
FT                   /product="Exoinulinase InuD"
FT                   /EC_number="3.2.1.26"
FT                   /function="sucrose alpha-glucosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86253.1"
FT                   /db_xref="GO:0004575"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG086617"
FT                   /db_xref="HOGENOM:HBG693902"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="UniParc:UPI00005200FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDS4"
FT                   /transl_table=1
FT                   /translation="MKLSALVQPLVLGMSASAAARPSRPSAYTEPYRPQFHFSPEKNWM
FT                   NDPNGLVYDAKEGVYHLYFQYNPGGTTWGAMSWGHATSKDLMHWTEHPVALRAKGFPDN
FT                   ITEMFFSGTVVIDERNTSGFGRNGKTPWVAMYTSYYPMEQVLPSGKRVKTNQQAQSIAY
FT                   SLDRGMTWTTYDAANPVIAEPPTPYEDQYTEFRDPSVFWHDETHQWVAVISLAKLHKIL
FT                   IYTSRDLKHWDLASEFGPANAVGGVWECPSIFPLSLDGSKKTKFVLMLGLNPGGPPGTV
FT                   GSGTQYIVGDFNGTTFTPDANSIYDGRGPEDSVIFEDFEGDKTLAARGWTATGDLTSAS
FT                   PAKGTLPGQNPVTGYLGQQLLNTFLNGDATIGTLTSSPFEISHKYINFLVGGGSNLNET
FT                   AIRLKVNGQTVHTSTGSNSEGLAWQSWDVSALQGKTAVIEIIDNSTGGWGHINVDQISF
FT                   SNQPATSTIANWMDWGPDFYAALGFNGLPQDKRTIIAWMNNWQYGGVIPTDPWRSAMSV
FT                   PRQLALKTINGKATIVQEPAGKWSALTHGGQTFSFPRVEGVRGLGRIGKTLELELTFSS
FT                   RQSPAAGKAEFGVAVAATKDYSHETRVGYNFATQQVFVDRTRSGDTSFDGTFASVYHAP
FT                   LAPSADGTVSLRVLVDWSSVEVFGGNGEATITSQIFPASDAVYGRLFSTDGETRDVKLR
FT                   VKEVRSTWQ"
FT   CDS_pept        join(140225..140391,140467..140680,140763..140918)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751817"
FT                   /orf_name="AFUA_5G00490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86252.1"
FT                   /db_xref="HOGENOM:HBG055590"
FT                   /db_xref="UniParc:UPI000051EDE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDS5"
FT                   /transl_table=1
FT                   /translation="MKNRPFMGRKLSLFYIGTIILVQPYWVAEIYANFAYFNDINRTVY
FT                   EKIRPWEALFRDPWWIYTTCNLFWVVKKHYCFGIVELVRECPRFGLMLASMCLSMVFIV
FT                   LDVLSVTGALQSAMPLGINPFWKLCFMFKCLCDTIILDDFKTALDNLSSRWLARQGVQV
FT                   LGKLRLNLPSFARLL"
FT   CDS_pept        join(complement(146516..146547),complement(146389..146462),
FT                   complement(146008..146331),complement(144871..145787),
FT                   complement(144709..144813),complement(144511..144654))
FT                   /codon_start=1
FT                   /gene_family="HOG000216995" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267352"
FT                   /orf_name="AFUA_5G00500"
FT                   /product="MFS alpha-glucoside transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86251.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG055589"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051F06D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDS6"
FT                   /transl_table=1
FT                   /translation="MAATANARMDGVDYSHIDSSQKWRMLKSQKRFFFWCLWVSSGVIM
FT                   QGFDIVAGGQLAALPEFQKQFGRLQPDGSHIIPAHYLSAWNSIAPACEIASTFIYAPLL
FT                   EKYGRKPGILVASAISVAGVLLQQLATDWRVHLAGRGVNVPPWLEEAATWMANGESRHD
FT                   TRNVTIHIVTATTGNGGSPLLGCISFQVKPHPAPTVRNTAHITAILTFGWLFFPESPYW
FT                   LIRQGKTTQAQNALRRVYGFKNDAFYNVEVRRMATENNQALALQRSLTQSTRRTFLGLD
FT                   LSAEAECFNRMNRKRTLTAIFAASGQQMIGATFVIGYATYFLDLIGVKDYFDASIVLYV
FT                   VMLLASMAAFPLTEIMGRRTMIVIPQFMLCCMLLLIGILGCVPDQGKASWGIIVFIYIW
FT                   AIIYQLSIGAVGFVLASEIATVRLRSTTQGLVTITNAAWGLIMQFTIPYMINPDAGNLG
FT                   GKVGFIFLGTGLIAAIGGWYLYPETKGISFEAMDELYASGIAPRLFRRASEPQRGIPLE
FT                   SKTAPSVHVEVVNV"
FT   CDS_pept        complement(147724..149094)
FT                   /codon_start=1
FT                   /gene_family="HOG000115502" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057182"
FT                   /orf_name="AFUA_5G00510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86250.1"
FT                   /db_xref="HOGENOM:HBG055588"
FT                   /db_xref="HOGENOM:HBG530214"
FT                   /db_xref="InterPro:IPR021345"
FT                   /db_xref="UniParc:UPI000051EDF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDS7"
FT                   /transl_table=1
FT                   /translation="MSSALGSHLLADVTKRKAARSARVASWDQSGLNEDAFVVLPGETA
FT                   VLADLQGPGAITHLWFVQTCRKILGPGLIPYAKSGVAMMEIHNALGLNFEVNDPDYYRK
FT                   VLIKMYWDESESPNVLAPIGDFFCLGHSMAANFQSLPFTVSVKPSEEKQYGGAAAFNCY
FT                   LTMPFNKRARIEIENQNDEAYIQYFYIDYELYAEPLPKDTLFFHAHWRRENPTNGWAPS
FT                   CIQTNSLETQVKNLDGKSNYVILETEGAGQYIGCNHSVWHEQGTWWGEGDDMIFIDDDS
FT                   WPPSMHGTGGEDYFSQGWGMQKNAYPFCGTIIHEDDVPNTQVSYRWHLADPVRFSRKIK
FT                   VTMESGHANHLRDDWSTTAYWYQTLPGPKLDILPVEKRLPRRPAVPPIPEPSEREIAAL
FT                   SAEKKEKLAQHRERYEAFVKDRNDWLERRAKDTKQRALNNVWICEDIRQRFLTSLRE"
FT   CDS_pept        join(149357..149508,149570..150202,150390..150992,
FT                   151043..151232)
FT                   /codon_start=1
FT                   /gene_family="HOG000216994" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903926"
FT                   /orf_name="AFUA_5G00520"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86249.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055586"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051F548"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDS8"
FT                   /transl_table=1
FT                   /translation="MVKTRKRLALACDTCRSRRVKCDGERPFCAPCRTRGLNCFYQQLP
FT                   ERPATKVETELANVNRRLDYLTMLLSKESQPIAEPQQPSTSALGSHEDSPFRLLATDSI
FT                   MRVLGLDDHYARGLVQLERANLLVSTATPSRMFFISHEQITDALAAFSDRVHCYYPILP
FT                   LDFSETYFSVLSGPLAPSCQTFLVLLVAAIGCVARDPTTGSPYYEAALASLPVVLAECT
FT                   LTSIQCLIFLSIYYCCLLKPCQAHDYCLIASFKIQNLFKSELSVQLDVAKSDLWNLDEY
FT                   IPLPNCRRTWQFPTPQAPSTLAGVSPASVHSIDSTSTIADQAQSFFLAEIAMRRMLHRC
FT                   NSAVTRSPDGRPSYAPSIALELERQLDVWYDYLPANIRFAKVPDRQLYADRSGSLSNFL
FT                   NVKYYCCKLSIFWPAVYQAVQDNAASTQLLDHCQRFIDSYVQLLPRIAFAVDDCLIYKW
FT                   TLSLSFFTTTMAALKVADTPSLAGASREQLRECLASAAARDWGGIHGSPSLELLQQTLN
FT                   SRLQVVHP"
FT   CDS_pept        complement(151650..153236)
FT                   /codon_start=1
FT                   /gene_family="HOG000181424" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18208501"
FT                   /orf_name="AFUA_5G00530"
FT                   /product="Inulinase, putative"
FT                   /EC_number="3.2.1.7"
FT                   /function="inulinase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86248.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0051670"
FT                   /db_xref="HOGENOM:HBG086617"
FT                   /db_xref="HOGENOM:HBG693902"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="UniParc:UPI000051F7C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDS9"
FT                   /transl_table=1
FT                   /translation="MAACFVYALAFGLFLPISSTTATSTRASTTVQPLDTVPVDFRPVY
FT                   HFVPEQNWMNEPNGLIKIGSTWHLFFQHNPTGNFWGNLSWGHATSTDLVSWTHQPIAIS
FT                   SGDGIQAFTGTAYFDSENLSGLGSPSNAPYLAFYTGYFPSTGVQDQRLAYSLDHGTTWI
FT                   KYAGNPIISKTQEEPHDITKGLETRDPKVFYHTPSGRWVMILAHGGQNKVTFWTSSDAE
FT                   SWTWRSDFNANSIPNLPGGINGWEVPDFFELAIKGTTQKKWVMIITPATGSPAGGNGVF
FT                   AVVGSFDGAVFTADPVDPSAFWLDYGRDFDGALSWENVPASDGRRILASVMNSYGGNPP
FT                   TNTWKGMLSFPRTLELQQFNSKLRFLQLPVAELSAYTWLIANITNQTIAPGQTLLSDIH
FT                   SRTLDIEMSFTPSPGATLSLSVRKGGSQQTFIRYAESAQQLSVDRNASGNISYDPAAAG
FT                   VHTATVQPDASGEMHLRVLVDTCSLEVFGGQGEAVISNLIFPDVSADGVSLEVSGGTVA
FT                   LRSVEVREVLL"
FT   CDS_pept        complement(154630..155562)
FT                   /codon_start=1
FT                   /gene_family="HOG000216992" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267353"
FT                   /orf_name="AFUA_5G00540"
FT                   /product="FacC-like extracellular signaling protein,
FT                   putative"
FT                   /protein_id="EAL86247.1"
FT                   /db_xref="HOGENOM:HBG053589"
FT                   /db_xref="HOGENOM:HBG669874"
FT                   /db_xref="UniParc:UPI00005200FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDT0"
FT                   /transl_table=1
FT                   /translation="MRVSLFAIITALTCVIAKIPDSPRFDLTKPSYDLWRNKKTAAKTV
FT                   QQSFTFDNVNRRLFIVNRRDGSALDSGDLTISQLDFSGKVLGSMHLLGCGHGVNIAAEP
FT                   IGSDTYIWSETDAAASGYGTALWKFKFQNGKTLNSATDKRKRIVPLPEFDRGTATIDPV
FT                   YKRLIVRYQTGTVQNIAAFDLAEASAGNFSNPLAKWEIPHLVKELGAKVNVFQGYTAYG
FT                   RYVYFLTGESYDASGGKLNSEVMALDLNTGKLVQGPVTTKAGSTLKFREPEGMAIYKTA
FT                   SGEVRLFLGFASGVAGDRRSNLFYKNALI"
FT   CDS_pept        complement(157167..158726)
FT                   /codon_start=1
FT                   /gene_family="HOG000216991" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057183"
FT                   /orf_name="AFUA_5G00550"
FT                   /product="Endoglycoceramidase, putative "
FT                   /EC_number="3.2.1.123"
FT                   /function="cation binding"
FT                   /function="endoglycosylceramidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86246.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="GO:0047876"
FT                   /db_xref="HOGENOM:HBG055585"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051E94F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDT1"
FT                   /transl_table=1
FT                   /translation="MLFVSITAALLLAVLDTLPAGMQAQDAEGWYKAHPGMARISQVNQ
FT                   DTHQIVDEFGRTRFFHGTNVVMKEPPWYRPFEWAPGVSSFGEQDVQNLHALGLNIVRLG
FT                   HSWAGAEPVRGQYNQTFLDIMKKQTKLAEDYGLYVLVDVHQDVLARQFCGHGVPDVSRM
FT                   RGPVGTAATDMAVQWFVKEDWVPGWKMYPFPLKPTPFPVDNKGFPSPQSLCGTVDWSLS
FT                   YTSAAVCNAFGRLYNNYDGLGDAFAAYWKKLASEYVETTNVVGYNLLNEPWVGDSMADP
FT                   TLLVPGVADHKVLEGLWNRAAKQIRTVDNDTLIWFEGATIDILSGFNNVPLGDGSKSVH
FT                   SFHYYSPPQLSSISTTLNNRRKDNERLRTAGVLTELTFWMGENQQMQGLADAMSATDAH
FT                   MVSWIGWAYENLYNSTSGQPYPELAKHYSRGYPAAVAGTPNSFSFDENSGTFKLQFTSD
FT                   PNIKAPTEIILPPSTFPNGYKVQVSPDGSVLQYVPNKRTLALFTSSSIKNTINISATVS
FT                   PR"
FT   CDS_pept        join(complement(161368..161658),complement(161214..161312),
FT                   complement(160463..161023))
FT                   /codon_start=1
FT                   /gene_family="HOG000216990" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057184"
FT                   /orf_name="AFUA_5G00560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86245.1"
FT                   /db_xref="HOGENOM:HBG055584"
FT                   /db_xref="UniParc:UPI000051F2B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDT2"
FT                   /transl_table=1
FT                   /translation="MVDVDALNSELDQISDQYQSLFRRLNSESQRDVQTVALSLSIALS
FT                   QLYQLAIFVRGDYNKRVFNVSGILVTKVREAFEQLAHASTTALENVSTLQSENVDLLAA
FT                   KMHIFEQNVKAAHDETAAKIAGYKDAISMIVPIWGIIGLIDHTKSPGSVLLEGQIGAAR
FT                   QAVDNAPHILDSAYRNAQASLDPLRGEQAKLELQSVILKRLGPLQSAIQSAITKAQELE
FT                   KGLIPMKDSATEMVRRRNKLSSRAEDGAELSITKEESVSGILDVVELAIVEPNTAKQIK
FT                   MILAELRNSWGPSPVPPAILSRLDELDGKAAKIAG"
FT   CDS_pept        join(162664..162911,162936..163089,163170..163531,
FT                   163591..164074,164141..164251,164375..164614,
FT                   164671..164880,164943..165353)
FT                   /codon_start=1
FT                   /gene_family="HOG000216989" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751818"
FT                   /orf_name="AFUA_5G00570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86244.1"
FT                   /db_xref="HOGENOM:HBG055583"
FT                   /db_xref="UniParc:UPI000051F2E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDT3"
FT                   /transl_table=1
FT                   /translation="MVDQKELLAALEVQHKRDNRPGITRKAVAEIKSSAIFQVNWEDLL
FT                   KSAPISINALGAALVASSSETATTIEFTPPKGGFKFLQLLRVAGADGQSRFTSLRANLV
FT                   DCSNRGRLAFLDAEDGMLRINNISHIIYDKVAEIKIIGSPDPADVHKMLVPQLRSVKKA
FT                   ADECHTRALQMDKKFEEWLWFAADLHSNCVQEQSSNEERLLATKVNMSVAQRQFDSQKN
FT                   TVEEAKKISEKLGKQLDVASEAYKKASDSFPSGWDILGQQIVGELADTLTTALGQAITA
FT                   YTSNLNPVARAEKGVEMFEDVVNGGKNAPKSGEAPPPPPPAPPKPKSPLPQYSDDPAYV
FT                   QVKPAMVYLTVLNALLTSGKDGGVNWESAVDSPDKPDKTASFTSKMLKDTLERFEESAT
FT                   ENPHSQKLLEVLQTATEVANAVTEEAAKLKDISKDPPKADSQLVKGWQEKFHPQAPLMA
FT                   TTEDPAVQIAKTNAKSAQAQAGLAAAKDRLHTTQQTFLSTQKIYQEASSTLIEQENKLT
FT                   AIQAELQRQTKLEPSLTEIKSVLRQCISLVMVVKDNIMQLCRFFKAISSTIDVVVEHTV
FT                   NDFIETISSGASDVQMSNFTLSVLQKSMIYKYAVILRAYFETFGDIATMWKELSEENII
FT                   PGLKMIDGLSVELTKDQMATKVAELSSWSQNASANIVSIASAKRKEIEGGMEERVEDIA
FT                   QSTQSLPPSPPAKKAIEEAAKEVTTTATTAVKENAQNNPLSRFEL"
FT   CDS_pept        join(complement(166863..167189),complement(165766..166710))
FT                   /codon_start=1
FT                   /gene_family="HOG000216988" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057185"
FT                   /orf_name="AFUA_5G00580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86243.1"
FT                   /db_xref="HOGENOM:HBG055582"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniParc:UPI000051E49F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDT4"
FT                   /transl_table=1
FT                   /translation="MLGWRENGSSIMRPLQRIVFIVSCSFLIYLGIRLRAGGYAPGSPA
FT                   PPSFPGDKGPTQQSFGNLSWTQAQCAAAFPGLFDEIEDAVSRGPFPLTWPRLGEPLQGR
FT                   IKDNQERTAALNQLYRAIVTSPEPLPDTVFALNIQDRPMAQSWSYARPADPTATKAGSF
FT                   LMPHFAFWAWPLKYIGSMHRALTAITEIETKQTFQAKIPQAVWRGTPWFNDVQNHDLRK
FT                   RLIRVTTGKPWADVQSLKWETNGQTASNGLAIEDFCRYKYIIYTEGVTYSGRLLFHQAC
FT                   RSIILTPPMAWMLHTTHLVRPVFSSALLQTTPSWGPTNQSDRIQRAWPTDLSAEDANLV
FT                   MVSPDWSDLEATIAWLEDHPTMAEGIADRQRQLFHDGGYHSPAAEACYWRALIRGWSKV
FT                   AEPEGREWSEHEGVRWELFSLGGL"
FT   CDS_pept        complement(167534..168580)
FT                   /codon_start=1
FT                   /gene_family="HOG000162167" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751819"
FT                   /orf_name="AFUA_5G00590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86242.1"
FT                   /db_xref="HOGENOM:HBG055581"
FT                   /db_xref="HOGENOM:HBG327200"
FT                   /db_xref="UniParc:UPI0000520817"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDT5"
FT                   /transl_table=1
FT                   /translation="MADGNISPSRSRLLLISVPRTASNLMLKLLNVPCQKLVTSERGGY
FT                   FFFNAFLKVSGDGRRCVPIGERNEAEKREIRDAFQEAVDALEDCSERAEREAKIAFAKE
FT                   HAFWFTNPAVLGSVTEDAASFRPRIPDKYGPSHTFSSLNHTVLPDEYLRTWRLTFIIRH
FT                   PALAFPSLCRAMEKFRQSGFMQSVDTIGTQETNLTLKWTRMLYDWCLEQPDLPGKPLVL
FT                   DAQDIIHNPQVMVRYCEETGLNPNALQFEWDNKPPSEAVETEAVRVKCPIPEKTDLDFD
FT                   KAEAIMLSTLSASTGIIKDKTPTAVDVDAEVKQWKEEFGDEVATKLEMMVHDAMPDYEY
FT                   LRSRRITV"
FT   CDS_pept        join(complement(169826..170037),complement(169273..169765))
FT                   /codon_start=1
FT                   /gene_family="HOG000216987" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267354"
FT                   /orf_name="AFUA_5G00600"
FT                   /product="NPP1 domain protein, putative "
FT                   /protein_id="EAL86241.1"
FT                   /db_xref="HOGENOM:HBG055580"
FT                   /db_xref="HOGENOM:HBG327470"
FT                   /db_xref="InterPro:IPR008701"
FT                   /db_xref="UniParc:UPI000051F2D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDT6"
FT                   /transl_table=1
FT                   /translation="MAFLLTLAALGCSAQGAVLPRASIDSDAVVGFPQTVPSGTTGEVY
FT                   LAYQPYLKVVNGCVPFPAVDAEGNTNAGLAPTGASNGDCASSTGQIYVRGTTYGNYYAL
FT                   MYSWYFPKDEPSTGLGHRHDWEGVIVWLSSSTSTAADNVVAVCPSAHGGWDCSTDGYTL
FT                   SGTKPLIKYYSIWPVDHQCGLTSTVGGTQPLIAWESLPTVAQTALEDTDFGDANVPFKN
FT                   ANFASNLAKATF"
FT   CDS_pept        join(complement(172078..172252),complement(171870..172049),
FT                   complement(171616..171765),complement(171247..171567),
FT                   complement(171023..171197),complement(170630..170960))
FT                   /codon_start=1
FT                   /gene_family="HOG000216986" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267355"
FT                   /orf_name="AFUA_5G00610"
FT                   /product="Oxidase, putative"
FT                   /function="peroxidase activity"
FT                   /protein_id="EAL86240.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="HOGENOM:HBG055579"
FT                   /db_xref="HOGENOM:HBG326528"
FT                   /db_xref="InterPro:IPR000028"
FT                   /db_xref="UniParc:UPI0000520816"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDT7"
FT                   /transl_table=1
FT                   /translation="MKATISLVILGLGSLASGFPDRMGGSAHMNCPYAALKKGEDAELG
FT                   KRFLFDSLTKPIDVGGGENGAERATVTGVHAFQPPRKGDQRGPCPALNALANHAYIPRS
FT                   GVVSVCGPSLARTFVYGMGVDLATILALMGLVWTGNPLALVPSFSIGGRDPGVNNLLNN
FT                   LGGLLGEPQGLIGSHNFIEADSSNTRDDLYVTGNNYALNMDKFLEWYNMSTDGTFSMDL
FT                   MAERAKTRFEQSIQTNPEFYYGPVTGFIARNAGYLFPARFFRNHSSENPEGVLTKEIVR
FT                   NFYGIYGEEGNLTYREGWERIPENWHKTPLDYGLVQFNIDLVDWVLKHPELASIGGNTG
FT                   TVNSFTGVNLADVTGGVLNGTTLLEGNNLLCFVFEVLKFASPNALAGLYKTLAVPLDLV
FT                   NRIIAVPLLDMSCPAFKDMQMGGRPLWDAIKDDFPGAMKSGGAL"
FT   CDS_pept        join(174613..174765,175021..175412,175744..175945)
FT                   /codon_start=1
FT                   /gene_family="HOG000048451" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267356"
FT                   /orf_name="AFUA_5G00620"
FT                   /product="Integral membrane protein, putative "
FT                   /protein_id="EAL86239.1"
FT                   /db_xref="HOGENOM:HBG055578"
FT                   /db_xref="UniParc:UPI000052080C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDT8"
FT                   /transl_table=1
FT                   /translation="MPVRDRTRVVSIAGVAGGALALFAFVLRMIARLPCCGGQFGMDDL
FT                   AMIVTMSPKIYFYDELLYLSIIPLTKISICLFYLRVFPARPFRMMTYIVIGLNTGFLIA
FT                   FVLISVFQCRPIKGAWLHWDGEGHYSCNNINAQGWSAAAINMVLDLIVMALPLRELYRL
FT                   NLSLRKKLFVMSMFSLGIFFQAERDSVRESCFQRGGKYSQSSEPERLARRKVCAVGGLG
FT                   TSPKRRRSPSMIWTASGRKSRTSYCK"
FT   CDS_pept        join(177277..177332,177409..177852,177905..179441)
FT                   /codon_start=1
FT                   /gene_family="HOG000139601" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751820"
FT                   /orf_name="AFUA_5G00630"
FT                   /product="Choline dehydrogenase, putative "
FT                   /EC_number="1.1.99.1"
FT                   /function="choline dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="alcohol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86238.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0008812"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG055577"
FT                   /db_xref="HOGENOM:HBG734713"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI000052059E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDT9"
FT                   /transl_table=1
FT                   /translation="MHISKGFSICTLLFGTLVSGHDADHQAYHKPWARSTYNAPRATNG
FT                   TAEYDYIVVGSGPGGGPLAARLAIAGFKVLLLDAGDDQGDALQQQVPALQLQSTEYEPM
FT                   RWDYFVNHYSDLERQKQDSKMTYRTPAGELYVGQNPPANSEPLGILYPRAGTLGGCSAH
FT                   NAMITIYPYESDWQDLAMLTGNDSWAPHKMRGYFTRLERNRYLPSSLAGHGFDGWLTTS
FT                   LTQLTLVLEDQKLLSLVIAAATAVGKSLLGMIITTVTGLGEILLRDINNPLPTRDQETG
FT                   LFQIPIAVDVPEYKRTGPRDFLMKTVNSVNKDGSRKYHLDIQLNTLVTNVRFDTTGERP
FT                   RAIGVDYLRSQSLYRADPRASKASAGTPGSVNAAKEVILSAGTFNTPQLLKLSGIGPKE
FT                   ELSKWNIRTLVNLPGVGKNLQDRYETGLVGKAPTDFVLTSKCTFMYSMPDPCLDQWKNN
FT                   AINKGTYTTNGIAIAIVRKTSTAEGKPDVLISGAPVNFPGYYPNYSYEGLKDAQYWTWI
FT                   TLKAQSRNNAGTVELRSADPRDTPIINFNSFDSGVTDNGADEKDLQAVYESMLFSRKIF
FT                   NDLVPLDGKFEEVWPGPNVTSEADLKDFIKREAWGHHACCTAAIGADEDPNAVLDSDFR
FT                   VRGVDGLRVVDASVFPKIPGWYIALPIYMISEKAADVIIADAA"
FT   CDS_pept        join(complement(180655..180774),complement(180552..180600),
FT                   complement(180166..180486),complement(180012..180105),
FT                   complement(179606..179948))
FT                   /codon_start=1
FT                   /gene_family="HOG000044064" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267357"
FT                   /orf_name="AFUA_5G00640"
FT                   /product="Peroxisomal dehydratase, putative "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL86237.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG055576"
FT                   /db_xref="HOGENOM:HBG329298"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="UniParc:UPI0000520815"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDU0"
FT                   /transl_table=1
FT                   /translation="MSGPGAGYEFPAQEVSWLKRDALLFANSIGVTADELHFLYELHPN
FT                   FAVFPTYPIILSFKLTDSEVTDFYARQKANPVPGVPKFDPKRSVDGQRKLTVLKPLPPS
FT                   SAGKQFELRSKVIGVYDKGKAGSVMETEQTIVDKATGEIYTKIVSSGFFVGQGNWGGPK
FT                   GPSTPNYPPPEGRKPDATHEVQTTAETPLLYRLNGDYNPLHATPEPGQQMGFGGTIIHG
FT                   LFSWNSTAHAVLKAFGGSDPNNFREFQARFASPVRPGDRLTTEMWRVSNATDGFEEIRF
FT                   VTKNDKGKVVLSNGRALIKVAKSGSKL"
FT   CDS_pept        complement(182941..183963)
FT                   /codon_start=1
FT                   /gene_family="HOG000179684" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267358"
FT                   /orf_name="AFUA_5G00650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86236.1"
FT                   /db_xref="HOGENOM:HBG055575"
FT                   /db_xref="HOGENOM:HBG332439"
FT                   /db_xref="InterPro:IPR022085"
FT                   /db_xref="UniParc:UPI000051E94E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDU1"
FT                   /transl_table=1
FT                   /translation="MHDLLRDSPSSPPRDRPSGFAACDPADRADLEEAARAGDFDLLRS
FT                   VAHNRAWIVGQSYCRSRDSIDSCERYLHSLWYVYYQCARHVSHESFEQDRWILDILRTR
FT                   GRGPLTRPAPGAGIDIARTPDGTVWNDLPLLATDMTGFWINDCAAMSSKQRLNAASFLA
FT                   KLASTRVANDRLCQIALILFRETFEAVRPLGSSNEPEDEDPRRPIHVLTIASLLPSTCA
FT                   WIREAGHNIILLSDVLWNDCSNSTIGKGGFTFVQSELGQRAPDGFSPWRWLYWLKRLHQ
FT                   IADEASKADEKILAEQAAKAIDIMLSHVKQRNFKILRVFEAAGDAVTQDKDFLGLTKEW
FT                   "
FT   mobile_element  184740..185858
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        complement(188199..189638)
FT                   /codon_start=1
FT                   /gene_family="HOG000048452" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267359"
FT                   /orf_name="AFUA_5G00660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86235.1"
FT                   /db_xref="HOGENOM:HBG055574"
FT                   /db_xref="UniParc:UPI000051FA3A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDU2"
FT                   /transl_table=1
FT                   /translation="MVVDVGSVLSYATTSGVEALKILNKWLDNNEVAQAWYGKDKDFFI
FT                   KKRNRISKLFRGKFKKPEIQYVFTIQKEDWQLVIKESLPVAHTWYRKRKDKSGECSWLP
FT                   LFWACRSPLGEDRVCSKADEAFTSLGIVSNLPAARLDLWGLVVMAYSNGGWSRVALSGD
FT                   GGFNATLLCRNFILNISQSNVNAPTIGHLEPREHPAEDHEPLGIDDSRALLEHGHSFST
FT                   NNVSIGWPLNGETDPPPLELADGQWDKILKKMVLDYFQVRKLKAKFHSGITKYWEEWAS
FT                   FMAKVRRGFDGKVIGSIPTKLDQVREYPVRDTEQRVHEKSPGVRLDDRVIQEVESRQEL
FT                   RAEIASLASDYDESQRLSDTELPEKMKDILEKVRKLINKQLWRLKLLLYNDIMLVDNLD
FT                   HNDVLYFFREDGQLIKMLTHCHLAEEHIDHSRAGIATKQELKRLLSSHYVVMARARMLN
FT                   FCEQIDLNLSVRNTGHNVLLA"
FT   CDS_pept        join(192036..192351,192426..193807)
FT                   /codon_start=1
FT                   /gene_family="HOG000216977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267360"
FT                   /orf_name="AFUA_5G00670"
FT                   /product="Beta-galactosidase, putative "
FT                   /function="beta-galactosidase activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="beta-galactosidase complex "
FT                   /protein_id="EAL86234.1"
FT                   /db_xref="GO:0004565"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0009341"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG055573"
FT                   /db_xref="HOGENOM:HBG417782"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051E92A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDU3"
FT                   /transl_table=1
FT                   /translation="MASQNVEIPHLRSIESGKQLIVNGRPFLILGAELQNSSLTSAEHM
FT                   DTIWPNLVESHVNTVLGCVTWEMIEPVEGQFDFKELDKIIADARKHGLHLVLLWFGSFK
FT                   NGMSTYAPAWVKMNPKRFPRMKLRKAGGVLQTTEILSIFHEEAQKCDARAFKQLMRHLK
FT                   DFDQNHSTVIMVQVENETGLLGDSRDGSAAAEERFSKPVPDDLLDFLANDWDSLHRDLK
FT                   RNLVRFKAQTNRPGSWAEVFGKGPHTDELFMAYHYALYVNQVAAAGREEYPLPLYTNAW
FT                   QNYAGEDIDNNLLGIVGGGGMPGDYPSGGCTTNVLDIWQRFAPSLDFFTPDIYLNDYES
FT                   CCAKYCHRGQPLFIPEQRRDEYGARRSWAAIGSYRALGVSPFALDTLDPEQNPYIKHYA
FT                   LLESVSQIVLEAQQRPGSLVGFFFDELAADGSDPSKPVTRQYGGYEITIERAFVFGKPG
FT                   PGSGMVIHRGKGKFLLIGWGFQVRATSLSPTAAYTGILRFEEKVVVNKGTGELRTRRVL
FT                   NGDETRSGQFAIMPNEDPDYGGFPIAITIPAKTMIAELEVYALDESDV"
FT   CDS_pept        join(complement(194916..195046),complement(194720..194885),
FT                   complement(193874..194665))
FT                   /codon_start=1
FT                   /gene_family="HOG000216976" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751821"
FT                   /orf_name="AFUA_5G00680"
FT                   /product="CRAL/TRIO domain protein "
FT                   /protein_id="EAL86233.1"
FT                   /db_xref="HOGENOM:HBG055572"
FT                   /db_xref="HOGENOM:HBG328395"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="UniParc:UPI0000520801"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDU4"
FT                   /transl_table=1
FT                   /translation="MAAHETAILAQFSRLCLDKGLLQVCDDVKDGDRADGIADETTLRE
FT                   NQIEPSRRFLQARRMDLPSALGQFEEAIQFRREKDALRVYDRISVDDFEHTRKLYPHWT
FT                   GRRDKQGSPIVMLETVHLDQKAITHWHQTRQLSGQSSSPDMEQRALAYFDYLTRFVFPL
FT                   CSALQDRPLPSEPVTKAIYLIDGSSICLRQAWNLRDFSQDVSWILATCYPETIDRIFVS
FT                   ERVIGPWAFGLTCVQLCNPPSYFPKMWSMLKKFIDPVTAEKIVMLDPADVYGTLNKYIH
FT                   HDNIPVQFGGAFEFTHGMLPDLCPVTRQTLRWSPPFNGTFPPGPIKWTEHARGQIKAVA
FT                   IGTVDGVERGFDVATLDIEEEK"
FT   CDS_pept        join(complement(196246..196456),complement(195893..196176),
FT                   complement(195384..195647))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751822"
FT                   /orf_name="AFUA_5G00690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86232.1"
FT                   /db_xref="HOGENOM:HBG055571"
FT                   /db_xref="UniParc:UPI000051EB9F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDU5"
FT                   /transl_table=1
FT                   /translation="MITLDRIRLVPRVERTVWHSVSSRTMSFALMFNYAIANLPNQSTK
FT                   KGIHTNDLVADSTTYYMNASAAHQSLYPACKREVHISQVTFPWVAAAPSLNGIDKLVPI
FT                   SAALQCPFVGFVLEPMSPQRIPLTDPFNAWRRALYEIGCSITGSVILLSLHLGRLARED
FT                   VLICANKRAFTRGMTLCVCSWVHPRGGDRHMVIHEAAPVRGKNLILLAGSLIQYQHRGI
FT                   LEDQPIAALESFRRQLILILGTPPVSTTRM"
FT   CDS_pept        join(complement(199323..199424),complement(198845..198987),
FT                   complement(198333..198753))
FT                   /codon_start=1
FT                   /gene_family="HOG000048453" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267361"
FT                   /orf_name="AFUA_5G00700"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86231.1"
FT                   /db_xref="HOGENOM:HBG055570"
FT                   /db_xref="UniParc:UPI00005205AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDU6"
FT                   /transl_table=1
FT                   /translation="MSIAQSVAIAMAVKNGYGSHLTSLDDSRVDSIMKEAFFIYLGVSN
FT                   ILTDVAIIAQAVQVIAIVQTTWKRRANIIAVFLFRVITINSSDATSETWPVTVASQLVQ
FT                   CLSIVTASAPQFIPFLKQLQSTGMRLDGMTRYTLSSHHKSSRGRYYLSTDRRRTGNEST
FT                   HELDNIPLATTKTVVTSNANGLEEDHDNESQLSQTGIIRETRTWTVTEEHTCLPGHNG"
FT   CDS_pept        join(201642..201764,201834..201904,201961..201984,
FT                   202037..202126,202184..202664,202715..203044,2
FT                   03097..203579)
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903927"
FT                   /orf_name="AFUA_5G00710"
FT                   /product="GABA permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86230.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG325555"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051EB92"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDU7"
FT                   /transl_table=1
FT                   /translation="MLPHELKTLEPSSPQELGGSVSSKDIDEIHLARLGKRPVLKRNFG
FT                   MLSMLGFSCTILVTWEGFTVLFLQPLTNGGPAGAVYGFLFVWAGTASIFVVLSELASMA
FT                   PTSGGQYHWISMLAPRSTVKFLSYMSGWLTVIGWQATFATACYLCGTMVQGVAVLTRPN
FT                   YQPQSWHPTFYFWAIVAFAVSINVVGRNVLPKFEGLILVVHILGFFAILIPLVSLADIG
FT                   SAKDVFTEFVNQGGWPTQGLSFFVGLIGSVFAFVGGDAAVHMSEEIQNAPVVVPRSILL
FT                   SVLINGSLGFGMLLALLFCLGDINEALESPTGYPFMHIFYKGTGSLGGAATMASIVIVV
FT                   CICSATGMMAATSRQFWSFSRDRGVPGWRLWSRVSPTTAIPVWSVAVTTVVAVLLALIP
FT                   IGSAVAFNDLCAMSITGLFLSYIMVAVLLLWRRTTGAISLTAGADETVNTIGAKLVWGP
FT                   FRIPGVWGIVINVFAIIYCVIAIFFSMWPTYSEVTVQTMNFSSVGTVSVILLSVIYYVL
FT                   RARHVYEGPIVETVPR"
FT   CDS_pept        join(complement(204099..204504),complement(203702..204042))
FT                   /codon_start=1
FT                   /gene_family="HOG000162145" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267362"
FT                   /orf_name="AFUA_5G00720"
FT                   /product="GNAT family acetyltransferase, putative "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EAL86229.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG055568"
FT                   /db_xref="HOGENOM:HBG333084"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000520800"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDU8"
FT                   /transl_table=1
FT                   /translation="MQPQFRVEVVSDDDFPELYRALWEAFENPYQGIVRLFFPIHNDDR
FT                   EGSLKACVKSQLEEYHKEQPHVTWIKVVDTEANKIAAAAKWYFYPENPFAKKEGPIVAD
FT                   WFPEGVTREWATQAVRQFEHPRESMARRPHAFLHIAFALPEYRGKGLSHLFMRWGVEKA
FT                   DTLGLEAWLDASEFGAPVYKKYGFREVLTNSVKPIPTRKLSDEEQIEWTRCEEIFLPID
FT                   ERVMWRPVLGQYVEGETPLARLDETD"
FT   CDS_pept        join(complement(208545..208755),complement(208037..208513),
FT                   complement(207774..207984),complement(207418..207658),
FT                   complement(206953..207347),complement(206544..206892),
FT                   complement(205893..206479),complement(205171..205843))
FT                   /codon_start=1
FT                   /gene_family="HOG000265622" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903928"
FT                   /orf_name="AFUA_5G00730"
FT                   /product="H /K ATPase alpha subunit, putative "
FT                   /EC_number="3.6.3.10"
FT                   /function="ATP binding"
FT                   /function="hydrogen:potassium-exchanging ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86228.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0008900"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG456486"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006069"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051F07B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDU9"
FT                   /transl_table=1
FT                   /translation="MSDEKLSNADKNSSFDIDEAKEREEREKAQAQTGVAAGMETLTIV
FT                   CHCRRCTILTRINLRSFPSRLAYHRHISQGLSPNQVQERLHQYGKNALSPLPHQWFWQI
FT                   FGYFFKGFGAILLVGCILVFISWKPLGQPPALANLALAIVLLAVFFIQAAFNAWQDWSS
FT                   SRVMASITAMLPESCLVMRGGSLAVVSAPDIVPGDVVHLKAGNKLPADVRFVEVSNDAC
FT                   FDRSILTGESLPINGTVDPTDENYLETHNVGLQGTHCVSGSVTGIVVSTGDATVFGRIA
FT                   KLTSEPKTGLTTLEKEVLRATWLRRDHPGWINVPTLIVDCVSVAIAFIPEGLPIALTAN
FT                   LTITANLMSKNKILCKSLKTVETLGSVSVICSDKTGTLTKNRMLVTDCAVSISTFTLDG
FT                   ARDEMVLKGKASAIHQLRAVAGLCNAAEFDAATMNLPVHGRKVIGDATDQAILRFSEEL
FT                   GPVAELRSMWKKTYDLAFNSKNKFMVRTFDLVDRAGLGHAMSPAESAQFGHDDTLLTIK
FT                   GAPDILIDRCTHVVNVDGNVQALNASTLTRLKQIKDQWSNEGKRVILLARKTFSAGQIQ
FT                   SSPLSHLFEAEVMNQIKTGLVLVGLVGIVDPPRDEIPDVVRTLRRAGIRIFMVTGDFGL
FT                   TALEIARQCGIVTAGVTVDDATALKRYPSVNDKFNEKSRSPAISLSGRELMALNEHQWD
FT                   QLGQYEEIVFWRTTPEQKLRIVREFQAREEIVGMTGDGVNDAPSLKAADIGIALGSGSD
FT                   IAIEASDMVLLDSFSAIVEAVQYGRVVFDNLKKTIIYLLPAGSWSEFWPVMTSVVFGLP
FT                   QVLSSFLMIIICCFTDCAAATVLAYEAAEADVLLRPPRKPKKERLVNWKLILQAYGVIG
FT                   MLETLTSFAMAYWYLQRNGIPFSALWFKFGVVPANVDPDWYTARLNEASSVYFINLVVM
FT                   YAAPHSACTRPEMANAHRQWFNLMAIRTRRLSIFSHPPAFNKNTQNLLLFPAILFALGI
FT                   AVFWLYIPPLQRVLDTTSVPAEHYFLPAAFGMGILGLDELRKAAVRRWPHGALAKMAW"
FT   CDS_pept        complement(208770..208994)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751823"
FT                   /orf_name="AFUA_5G00740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86227.1"
FT                   /db_xref="HOGENOM:HBG055567"
FT                   /db_xref="UniParc:UPI0000520814"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDV0"
FT                   /transl_table=1
FT                   /translation="MDQTEHKPADEEVTRLRWQGDDEELGNQTRATRPELIRTASAASS
FT                   SHVSVHSRHRRTIVDPSVSLPIHYRTMYL"
FT   CDS_pept        complement(209199..209402)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267363"
FT                   /orf_name="AFUA_5G00750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86226.1"
FT                   /db_xref="HOGENOM:HBG055566"
FT                   /db_xref="UniParc:UPI000051F7CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDV1"
FT                   /transl_table=1
FT                   /translation="MDDSINNVVSFQQKENKVADKVPSQLNHWVEFFFELREEGFIDVS
FT                   GSLNWYLSHHRHSCWLKSYGHR"
FT   CDS_pept        join(211013..211096,211149..211566,211619..211980,
FT                   212038..213068,213120..213795)
FT                   /codon_start=1
FT                   /gene_family="HOG000162144" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903929"
FT                   /gene_name="chsC"
FT                   /orf_name="AFUA_5G00760"
FT                   /product="Chitin synthase C"
FT                   /EC_number="2.4.1.16"
FT                   /function="chitin synthase activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="chitin biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="EAL86225.1"
FT                   /db_xref="EMBL:CAA63929.1"
FT                   /db_xref="GO:0004100"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006031"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG175045"
FT                   /db_xref="HOGENOM:HBG327157"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="UniParc:UPI000052010C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92197"
FT                   /transl_table=1
FT                   /translation="MGTPRPYSAHSPQESRSSFYSQPSQSPTPTYGRDDAEDQQQSLLR
FT                   RSLASPNGWSYDDPNVSTDSLRRYTLHDPGITAFAPPYPESEAADVRSARMSGYSGIEM
FT                   DAWQRRQGVKPSALRRYGTRKINLVQGSVLSVDYPVPSAIQNAIQAEYRDAEEAFHEEF
FT                   THMRYTAATCDPDEFTLRNGYNLRPAMYNRHTELLIAITYYNEDKVLTARTLHGVMQNV
FT                   RDIVNLKKSEFWNKGGPAWQKIVVCLVFDGIEPCDKNTLDVLATIGVYQDGVMKKDVDG
FT                   RETVAHIFEYTTQLSVTPTQQLVRPQPNDPSNLPPVQMLFCLKQKNSKKINSHRWLFNA
FT                   FSRILNPEICILLDAGTKPGSKSLLALWEAFYNDKTLGGACGEIHAMLGRGWRNVLNPL
FT                   VAAQNFEYKISNILDKPLESAFGYVSVLPGAFSAYRYRAIMGRPLEQYFHGDHTLSKRL
FT                   GKKGIEGMNIFKKNMFLAEDRILCFELVAKAGYKWHLTYVKASKGETDVPEAAPEYISQ
FT                   RRRWLNGSFAASLYSIMHFGRIYKSGHSFVRMFFLHIQMIYNCCQLIMTWFSLASYWLT
FT                   SSVIMDLVGTPSSHNKYKAWPFGNDASPIVNFFVKYGYLLVLMLQFVLALGNRPKGTKL
FT                   AYTMSFLWFSLVQFYVLILSFYLVANAFMGGMIDFDFDQGVGNFLSSFFSSTGGGIVLI
FT                   ALVSTYGIYIVASILYMDPWHILTSSWAYFLGMTTSINILMVYAFCNWHDVSWGTKGSD
FT                   KADALPSAQTKKADGSKSNFIEEIDKPQADIDSQFEATVKRALAPYQEPKEDSTISLDD
FT                   SYRNFRTSLVLLWILSNLLVSLLITNDGIRKMCLTVRLGSPGCA"
FT   CDS_pept        complement(214069..214476)
FT                   /codon_start=1
FT                   /gene_family="HOG000162112" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057186"
FT                   /orf_name="AFUA_5G00770"
FT                   /product="Integral membrane protein, putative "
FT                   /protein_id="EAL86224.1"
FT                   /db_xref="HOGENOM:HBG055565"
FT                   /db_xref="UniParc:UPI000051F2B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDV3"
FT                   /transl_table=1
FT                   /translation="MSQSASVSLLTTVVGFIPISFGINAILRPEHALTFFEFEPPVAPS
FT                   GRSLVDNLMIIYGVRDIFMGLTIYAAGFLGTRKSLGWTLIATSAVAFADGAVCWSQGHG
FT                   QWNHWGYAPVLAIIGGLLVGSDCKNTTDKTH"
FT   CDS_pept        join(complement(218535..219590),complement(216944..218479),
FT                   complement(215944..216885),complement(215650..215883),
FT                   complement(214941..215588))
FT                   /codon_start=1
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208502"
FT                   /orf_name="AFUA_5G00790"
FT                   /product="ABC multidrug transporter, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86223.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000051E71A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDV4"
FT                   /transl_table=1
FT                   /translation="MALNSTDNRWSTGEDTPSEAQLPDGEERLDAAPDEKVTAEDIDRR
FT                   LTNLVRKISAQSRRSHHSFLFGAGENSSLNPQSPSFDARKWARAFYNARYRQDDGHPPR
FT                   VVGVAFKNLNVFGYGSPVDYQMSVGNALLKVPTMVRQALGGGKQRVDILHDVEGLVLPG
FT                   EQLCVLGPPGSGCSTFLRTIAGETHGLNVDAASYINYHGISPKQMSTAFRGEAIYTAEV
FT                   DAHFPMLSVGDTLYFAALARAPQVIPGGLSRQEYAKHLRDVIMAMFGIGHTINTRVGND
FT                   FVRGVSGGERKRVTIAEAALGYSPLQCWDNSTRGLDSANAVEFCRTLRTQSDVFGITSC
FT                   VAIYQAPQAAYDLFDKVLVLYEGWQIYFGAAHEAQAYFEQLGFQCPESQTTADFLTSMC
FT                   SPAERIVKPGFEHMAPRTPEEFAQRWKESPQRQSLLHAIEKYSTEHPLDGPDLHQFALS
FT                   RRAEKSHRQREKSPYTLSYRGQVKLCLWREWQRLKNDPSVTLAMLIGNFFEALIIASIF
FT                   YNLTGDTSSFYYRGALLFMMVLLNAFASVLEILTLYEKRTIVEKQSRYAYYHPSAEALS
FT                   SFIMSLPYKFVNSSLVNLTLYFMSNLRREPGPFFFFLLISTSMMLAMSMFFRWFASLTK
FT                   TIDQALAPSSIILLALVLYTGFTIPVSYMRGWASWIRWLNPVSYGFEAVMINEFHGREF
FT                   PCSSFVPSGPGYEDVSRTQRVCSTVGATSGSDVVSGDVFVRSSYGYVNSHRWRNFGIII
FT                   AMTVFLAVCHFVTTELVASKRSKGEVLVFRRGSAHIARAKQGQRDEEQPSASAVPSEKY
FT                   SEAPTPVEGVETQTSIFHWEDVCYDVKIKNETRRILDHVDGWIKPGTLTALMGVSGAGK
FT                   TTLLDVLASRTTVGVVTGETLVDGRQRDSSFQRKTGYVQQQDLHLATTTVREALEFSAL
FT                   LRQPPQYSREEKLEYVEKVIDLLHMRDYADAIVGVPGEGLNVERRKRLTIGVELAARPK
FT                   LLLFLDEPTSGLDSQTSWSICNLMETLTRNGQAILCTIHQPSAMLFQRFDRLLLLAKGG
FT                   KTVYFGEIGSGARTLMDYFVRNGGPPCPKGANPAEHMLEVIGAAPGAHTDIDWPAVWRN
FT                   SPEYQQVRQELSRLRQLASQPSSVHSDDPSSYSEFAAPFPAQLGQVGRRVFQQYWRTPS
FT                   YLYSKAILTVGSSIFIGFSFFKGDNTAQGLQNQVFGVFVFLFVVIQLIFQIIPTFVTQR
FT                   TLYESRERQSKTYSWQAFVLSNIAVEFAWNTIAAVLCFLAWFYPVGLYRNAEYTDSVHS
FT                   RSTLVFLIIWATFLFASSFAHLLIAGVESAELASALANIMGIMMYAFCGILAGPHALPG
FT                   FWIFMYRVNPFTYLVSGLLSASLGDAPMHCAANEFLAFSPPANRTCGEYMEDYMALAGG
FT                   YLLDSAARGDEQCQYCRVDNTSQYLRNFSIDFATRWRDFGLLWVYVAVNTFGAVFLYWL
FT                   CRVPKGKKRL"
FT   CDS_pept        221289..221651
FT                   /codon_start=1
FT                   /gene_family="HOG000216974" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267364"
FT                   /orf_name="AFUA_5G00800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86222.1"
FT                   /db_xref="HOGENOM:HBG055564"
FT                   /db_xref="UniParc:UPI0000520333"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDV5"
FT                   /transl_table=1
FT                   /translation="MKIAALAATFALALVPSVSAWRVYFYQLKEGEGPSITNAGPGNPG
FT                   FRCHPNVDPLNQKISSMRYYSDNPEGTTRCCLRVYDSPGCKGDFGYSFCRNQFLNFADI
FT                   GHDNDVSSYSTECFKI"
FT   CDS_pept        223385..224440
FT                   /codon_start=1
FT                   /gene_family="HOG000162046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16267365"
FT                   /orf_name="AFUA_5G00810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86221.1"
FT                   /db_xref="HOGENOM:HBG055563"
FT                   /db_xref="UniParc:UPI000051F2D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDV6"
FT                   /transl_table=1
FT                   /translation="MAFHSDDRPLLPADLEQTSPDMASADDHSSIYYIYRERNDPMLIT
FT                   TTQQPKTQKQRRKKQKEDPSSIQDPNGYFVHRPYLSFARPPRTLRSGASRDGRTICLIH
FT                   SYAGWRRWRLQFGRDLGEAIDPRGVVQWQRRSNADNSVKADGDLKGYRVRSWRLWGESG
FT                   KAYHREANSKREQGMWTEDDPAGYRPLRATEACWLTWTAPFSKRTREYAFSYEGVDFVW
FT                   KGTKNLPEECKLARRLMPVHHLKLVAILPAKLAEEAEEVVVGYFICSAEADEYGTLVIE
FT                   NSKICDILGIDKMPEDMELARVKGARPAKMHDMIMATAVCMIIGEWQKRKTAVGVLFGL
FT                   LFAGAMSPAQM"
FT   CDS_pept        226212..228128
FT                   /codon_start=1
FT                   /gene_family="HOG000216973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208737"
FT                   /orf_name="AFUA_5G00820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86220.1"
FT                   /db_xref="HOGENOM:HBG023985"
FT                   /db_xref="HOGENOM:HBG055562"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniParc:UPI000051FA10"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDV7"
FT                   /transl_table=1
FT                   /translation="MNIPAHAPNCTTKQKRRSMNWNAFALAVSIPAIVIQAEIVLQAET
FT                   PPVPQPEPIAVTELPLPPVAPSNHSGACTKSINPHGTGCIGITSDTFQAGDFTPDGNHV
FT                   LANVEFVGAPTAPDPASVYTGQQLIAVKVDGSLFPNGDPWKCLSCGVPAGQAQSLDPAR
FT                   DYPHAARNGRQALWGHNILDCGDALLVSDECTPNKTHVYPIYWSSGSMRELRMHPDDVH
FT                   MGWSSFTKGGQNAFFGRLLFNPNPTTGSPVVPRYELIDVNILVDPNGRPSIMAEGTQLR
FT                   LHDEAIVVGELRGFSGAGDEILYIGPTREANNVDLFAVHVTSGAVRRLTSHPEYADPIA
FT                   FSHDNRWFVVMDTRGSNRQMWMSGMQYVPPLIDLVTMTAASSTRNNGARRFFQPILVDR
FT                   YGDRGSYFGQQVNAAGNGTSGSVNDPNWNGRADPAFSPDGTKIVFWQSLVIPPACGDPN
FT                   PLPCPVSTAPGGRTYRVILAHLTSRQPAAPAPVYKVPDMIPWARAFSPGASTPPPYQLT
FT                   AGLYSLPGKVHGIAQVHLTAYPGFGGFKTVAVNYTNYSDDGRHFIHGRETVTLTLSESN
FT                   PWWNHLDWYSDLTQTGAVQATKRTGPGGFQLSIDAMQNIFEANGTLTTTVGGVVYLQPA
FT                   NGT"
FT   CDS_pept        join(complement(229944..230413),complement(228632..229895))
FT                   /codon_start=1
FT                   /gene_family="HOG000234697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904159"
FT                   /orf_name="AFUA_5G00830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86219.1"
FT                   /db_xref="HOGENOM:HBG055561"
FT                   /db_xref="HOGENOM:HBG332256"
FT                   /db_xref="InterPro:IPR021514"
FT                   /db_xref="UniParc:UPI000051F07A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDV8"
FT                   /transl_table=1
FT                   /translation="MKIISRMAVATGTSAYAPVQIHNHEAVHGAPSQPTTMPPYRPPND
FT                   QERIRWSLWDWSWELAACVVAILTLIGMIAVLRIYDGKTQPNWPAGINLNAIIALLTTL
FT                   MKAAMATYIAEALSQLKYSWFKDTRRLSDLAALDSASRGAWGAAQLLVNYVPRHLASLG
FT                   AFVLVFAAAIGPFTQQVIDVRSRSIAREGGAAIRVCNTSMYEDWGAGQAPGMNLVPLET
FT                   TGAMYNGIMQTSLNHQSSVTCPTGNCTFAPYQSLGFCSTCSDLTSELTLASSDDDTYSY
FT                   NYTLPNDLFFNTTAASPYTIKATTNVDLVRLDASGLPLILNFSAITTSGKTMPPQVTAM
FT                   ECAFYFCVSTHRAIVRRGDLTEESFPTTTISNYSTNNFTMNAVASAQPCLNDGQCHYAI
FT                   NWLSILAMRNTISPLVSGFGMLPVSNRPYFTSDTLRALYGGSGNLTQINGTFASIAAAL
FT                   TANARNRVCQGAVLGDAWTNVSYIRIRWLWMLLPIVLVVLSILFFIVTIVHTRNQYIWK
FT                   SSPLALLCADLQIDGSAQPLQSGKIDPDHKRLDEMAKLAKVRLEAGTWGLLVHGHLVHR
FT                   E"
FT   CDS_pept        join(complement(232240..232572),complement(231588..232102),
FT                   complement(231473..231540),complement(231101..231417))
FT                   /codon_start=1
FT                   /gene_family="HOG000216972" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752044"
FT                   /orf_name="AFUA_5G00840"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL86218.1"
FT                   /db_xref="HOGENOM:HBG055560"
FT                   /db_xref="UniParc:UPI000051E6FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDV9"
FT                   /transl_table=1
FT                   /translation="MQLFGWAVPLRRHNIPECARSVRLHTMHRQRIITYVERAIIEGPR
FT                   LTVSVAKRLGDRACNVPVHQGRPEVEAATLVPLILASVFFFNRMAAKSMGLAGGWGSDD
FT                   YTIIGAYSVIQVGFGKNMWDVIPMDNITEVNKVGGRLSLSPTASALTYHSQRFFAFVVL
FT                   YKTQISLAKISVCLFLLRIFQTLAFRYTTYAIIGLNAAIGVTWVLVDSLRCNPVHLAWD
FT                   GWTGETPGTCINFTSATFANAFVNIAVDTVMVLMPVYEISKLNLSGRKKLGVSVMFAMG
FT                   LVLTVVAILRVVVFYLNRWGKNPTVELQPIVHWSVIEVSIAVLCACLPTGRAMLAHFFP
FT                   GLLGGSADKSYPQPTTPSARALGPSRQGQRSQIAKTVSYSVDYQTKPQKRDSNSFVRLV
FT                   ELDPLKEGSVH"
FT   CDS_pept        complement(234649..235431)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057430"
FT                   /orf_name="AFUA_5G00860"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL86217.1"
FT                   /db_xref="HOGENOM:HBG055559"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051E708"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDW0"
FT                   /transl_table=1
FT                   /translation="MTPQHLFKLPVELVVETAQYLARWASSSVVGPGGPGGPLSPHQTG
FT                   QREHRPTYCTKRTRQWKEYRHLVDSDGDNLLHRAVKRSRPIADIAFLLDEELDINHRNG
FT                   QGRTPLAVAIAIKNSARIKKPDIVELLLQREQRPTFQTTGPDILCIERLSTRKHGLNDC
FT                   WRNMTPTSRLGLLTVKDHFIWPGASTRNVSSSKHCWTLGRTWMYLQVTRSGGRFSNTPS
FT                   FMDTWTSCTCCLLLRGCQYLRRRQQLYGVNLGCSRWQA"
FT   CDS_pept        join(236240..236453,236527..236663)
FT                   /codon_start=1
FT                   /gene_family="HOG000048454" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268431"
FT                   /orf_name="AFUA_5G00870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86216.1"
FT                   /db_xref="HOGENOM:HBG055558"
FT                   /db_xref="UniParc:UPI000052010B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDW1"
FT                   /transl_table=1
FT                   /translation="MSSTIDHVGIHAPKDQFESIIDWYKKALGPVNYREIMRFPGAVGL
FT                   GSEHPDFWISETDEQCGGFHFAFIAHGCYSSWRKVQWRSWNSSRVSSTVLWGICVGSTG
FT                   QQCGSGWSSIHR"
FT   CDS_pept        join(237323..237337,237392..237508,237774..237943,
FT                   237993..238057,238110..238237)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904160"
FT                   /orf_name="AFUA_5G00890"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EBA27263.1"
FT                   /db_xref="UniParc:UPI0000F51CC8"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA01"
FT                   /transl_table=1
FT                   /translation="MVTAMFFNIGFGTCTIIGATFGMGKQLVDFDSDDSPLDFRNAFLG
FT                   HCMDMDLLVGIVYMYSAAAAVCDFTIGLLPAFMIGRLKMDRHTKMAVIGVLSIGCVAST
FT                   AVIVRIPFVRPSKSREFLYETPQVSIWSNIETRLGITAGSLMTVRPFLRAIRWLHIDDS
FT                   S"
FT   CDS_pept        238540..239406
FT                   /codon_start=1
FT                   /gene_family="HOG000216971" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904161"
FT                   /orf_name="AFUA_5G00900"
FT                   /product="G-protein signalling regulator, putative "
FT                   /function="signal transducer activity"
FT                   /protein_id="EAL86213.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="HOGENOM:HBG055555"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI000051F538"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDW4"
FT                   /transl_table=1
FT                   /translation="MRAPSGSLYHLQPRLDDILNDVAPFPYTLGAFIAFLSERQCLETV
FT                   EFLLETKRYCRIYHWLEQRTETCEAVRKAHLCGLWNRLINQYIRPSAEREINIPCDIRQ
FT                   RLMQQFHLQEDDPPPPEILDQVVCNVKELLRGSILIPFLRRSSATARVQPLSMPCLNGS
FT                   LPGEAMSGPSVTDDIWMNRCPREDYPRGQGDSTRRYGFYGEPASSSLEDDGTYTSSAVM
FT                   SSASDQSDIQDFAVQRNGLTETNSRARGLSDRTSPENRRSRGWRKRIKEGLAKRLSRSS
FT                   DGSSSQA"
FT   CDS_pept        join(complement(239852..240114),complement(239708..239804))
FT                   /codon_start=1
FT                   /gene_family="HOG000161978" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057431"
FT                   /orf_name="AFUA_5G00910"
FT                   /product="MBL2-like secreted peptide, putative "
FT                   /protein_id="EAL86212.1"
FT                   /db_xref="HOGENOM:HBG055554"
FT                   /db_xref="UniParc:UPI000051EDE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDW5"
FT                   /transl_table=1
FT                   /translation="MKYLGLAVAFLPLLAAAAPAADPEVEADGELDLEKRASAQTCKIV
FT                   NVDTYVNCRYDAKLDAGAIFGFPKGEKLTFACWKHGDCYNGVCSWDQVTYLKTTCYVNG
FT                   YFTDSNCSSSMLSRC"
FT   CDS_pept        241535..242761
FT                   /codon_start=1
FT                   /gene_family="HOG000042598" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268432"
FT                   /orf_name="AFUA_5G00920"
FT                   /product="Transesterase (LovD), putative "
FT                   /protein_id="EAL86211.1"
FT                   /db_xref="HOGENOM:HBG055553"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniParc:UPI000051F079"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDW6"
FT                   /transl_table=1
FT                   /translation="MANDIETSFQAAIDAGQINGAVICTTDTNGTFVYNTALGQRTLLS
FT                   GEKLPQQLDDVLYLASATKLVTAIAALQCVEDGLLSLTGDLSSVAPDLAAKQVLTGFSD
FT                   DGETPILEPPARPVTLEMLLTHSSGLCYHFLMPHIGQWRDKFAPPQEGQRLSVEELFCY
FT                   PLGFQPGTGYMYGPGLDWAGKLVERVTGRTLGERMQERIFDPLGINDAQFCPVTREDLR
FT                   ARLVDLNPDDPDGHGRAVLGGSADMNKRGRGDFGGHGLFMSGESYFKILRSLLVNDGKL
FT                   LQPKTVDELFEPHLSPEATAAHQAALASPMGVYFRVGLDAGTKLGHSLGGLLTLQDLDG
FT                   GYGERTLTWGGGMTLFWFIDRKNGLCSVCAIQASLPFNTDAVMALRQTFRHDIYRKYAA
FT                   FKAQERQGV"
FT   CDS_pept        242866..244662
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268433"
FT                   /orf_name="AFUA_5G00930"
FT                   /product="Amino acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86210.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051E48C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDW7"
FT                   /transl_table=1
FT                   /translation="MVAAGSPQISPQMKFPGSLRKLGTSWSGGKKSNLSSFWVLLVRIP
FT                   LLVSASTATMPLESELGIQLTEGEGSSASDGDIAFIRRGFGEVQAVRQGLYQRHLQMIA
FT                   LAGTIGTGLFLSSGQALVMGGPLGAFLAYTIVGLGVSSVVLTVGEMGALVPLSGGLVRY
FT                   AEYFFDPAMAFANGWNQVYLYTVTIPAEIVAAPVLVQFWITVNNAIWITVFSLLVLITA
FT                   LVFVRIYGELEFAFAILKILLIIGVNIMALVITCGGGPDGQSIGFRYWRDPGPFVQYLG
FT                   IKGSLGQFLGFWTCLNNAVFSYSGIQNITIPAAETRSPRRSIPEATRRVLYRIFLFYVL
FT                   SIFMIGLVVPSNDPTLLRLTGTASQSPFVIAARRAGIKTAPSIINAIILTSAWSAGNSY
FT                   ILFASRILYGMAVHGHAPAVFERLNRFSVPSVAISCIGLFMSLGYMSLTESSTIVFRWL
FT                   RDVVSVATLVDWIIVCIVYLRFYYGCKKQGVDRHKELPWAAPFQPYFTWASLILFALLL
FT                   ITGGYSTFIHGHWDTETFVSSYINIPIVLGLYYGYKFWKKTHIITLENMPLVGLLQFYL
FT                   SQDEDEPEPRPRKGLAKLNILW"
FT   CDS_pept        complement(244784..245107)
FT                   /codon_start=1
FT                   /gene_family="HOG000216970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268434"
FT                   /orf_name="AFUA_5G00940"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86209.1"
FT                   /db_xref="HOGENOM:HBG055552"
FT                   /db_xref="UniParc:UPI000051EB89"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDW8"
FT                   /transl_table=1
FT                   /translation="MSTDTLVPILIYLTGETRTNEVVLVDENVSSFEEFAEALYTSLRP
FT                   KIPDYYLESGERSITKAFVTWQPSDIFPRETEIVEGNIQAVLRLLAARRGVDTVRVWLN
FT                   EID"
FT   CDS_pept        join(246184..246282,246335..247567)
FT                   /codon_start=1
FT                   /gene_family="HOG000235016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268435"
FT                   /orf_name="AFUA_5G00950"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86208.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055551"
FT                   /db_xref="HOGENOM:HBG328109"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI000051EDE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDW9"
FT                   /transl_table=1
FT                   /translation="MPARRGPYSGQVSRRSHRKSRLGCRNCKRRRVKCDEVKPNCGNCL
FT                   RHSIECDYTLNTEGTSTPSTEEETRAPTSLNDNYTFISSSQSNFTPPRRGRSSRPLPTQ
FT                   EDIEPKPQLHLPVAKKLFQFTATDMALFHHFITSADLGGSQKHMQTQLSQLEFTFHYVL
FT                   RLLLAFSAFHLARHSTNDSLLGSRTELYALAEQHYEIAVREVTEAIPHLDTTTSPALYA
FT                   SSIFIFLCSLAKGPQPGEYLAYRDDGGPGCLSLFMGLRSILEICTATLSVDFSSIHTKD
FT                   SADMAPQPEEPPFRSQALTSQAYGDHLDKVRHLISTTFPVGGPGYRDYCQVLDRLGHCY
FT                   DVVFGDSHLPESQLWPQIFGWLYTQPDLFLSDAARRRPAALVVFAFFTILLKRLDAAWF
FT                   IRGWPEHIINSIYSNLDEHHRQYVQWPMQQIAPQQLMFAKGDVP"
FT   CDS_pept        join(complement(248121..249317),complement(247752..248072))
FT                   /codon_start=1
FT                   /gene_family="HOG000234503" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057432"
FT                   /orf_name="AFUA_5G00960"
FT                   /product="Feruloyl esterase, putative "
FT                   /EC_number="3.1.1.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL86207.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG055550"
FT                   /db_xref="HOGENOM:HBG325868"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="UniParc:UPI000051F7BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDX0"
FT                   /transl_table=1
FT                   /translation="MSHIGPAIECSPSAIPTPAVFGAEILSLEASWVRNFTLDVPGNFN
FT                   YNHGAQSVQNVDFCNVTVTYSHPGYDDRITVETWLPRHWNQRLQATGGGGWRAGRFVLS
FT                   QFFMGGAIGEGYATTTTDAGLGDTMPDAWALKSTGNVNLEYLHNLGYRSLNDEAIIAKD
FT                   LVRSFYGIPPAYSYWSGCSQGGRQGLMLAQRYPHAYDGIVASAPAQSWPEFVTAVYYPL
FT                   LAPLWAGEPSPLSCELEFLTAEAVKHCDSQDGIVDGIISDPNNCDFDPFSAVNKTFSCT
FT                   ATGKPMRLTRAAAITAKAAWTGPRTVAGDFLWYGVNPGSDITGLGVAPGQNLTTSPDEW
FT                   LSLFLVKNQSFDATQLSHEEYGTLFHFSVKEYTDVMAANDPDLTAFKKAGGKLLTYHGM
FT                   ADESIPTKGTEHYYRAVSQLIPDVQDFYRYFESPGLAHCAGGRGGQPTTAFDALRKWVE
FT                   NGTAPEFLPVRVNGTDGEHNRILCPYPAKPIQQGGNASGVGSFRCVH"
FT   CDS_pept        join(250045..250186,250241..250338,250390..250620)
FT                   /codon_start=1
FT                   /gene_family="HOG000217043" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752045"
FT                   /orf_name="AFUA_5G00975"
FT                   /product="DUF614 domain protein"
FT                   /protein_id="EAL86206.2"
FT                   /db_xref="HOGENOM:HBG055549"
FT                   /db_xref="InterPro:IPR006461"
FT                   /db_xref="UniParc:UPI0000F51C92"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDX1"
FT                   /transl_table=1
FT                   /translation="MISVDKTYRSVPKGPTDNHFKPDEARAITHNPDWNHSLFDCCSPG
FT                   SLCFTSCCLPCITFGRTQARVQDPTLQNYSSINSECAIFTVLALGYCQWIIQTIRRSEM
FT                   RQKHGIEGSCPGDCCVTFWCGCCALIQEEKEMELRTRPELTGYQSSAPMKYP"
FT   CDS_pept        join(254324..254445,254490..254495,254545..254679,
FT                   254743..255862)
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904162"
FT                   /orf_name="AFUA_5G00980"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86205.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51C6B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDX2"
FT                   /transl_table=1
FT                   /translation="MANFPAPRVDIEAKEPMPTDQSIQLEEQENPRRWPAGKKCMDLIY
FT                   TAAIPSISHAYGCSSTVATLGITTFLLGFASGPLLFAPLSEVWGRNTIFRVVLGLFVLF
FT                   QIGCALAPNVASMIVFRFFSGFFGSPTVTNSGGSITDIWPQDNRSVPLALFSAASFLGP
FT                   VIAPTVGGFICQYTSWRWNFWVVLILSGVCYGAMMVFLPETYSHKLLMDKKRCMPGYSP
FT                   AKQPPVKEMLYTTLTRPWLMLFTEPILFLLSLYMALVYGILYLDFTAYPVVYRETRGWS
FT                   ASIAGLSFLGICVGMAIATLISPYVNRIHGIYVRRLGGPQPEARLPHLIVISWLIPVSL
FT                   FWFAWTASPPTHWISGIVAGVPFGFGLILLFLGITSYLTDCYGSFGASALAANAVLRSL
FT                   FGAVFPLFSTSLYHSLGTSWATSLLGFVALAMAPLPWVFYRFGPRIRSRSKYHLRTREY
FT                   DQ"
FT   CDS_pept        join(256002..256071,256124..256245)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208738"
FT                   /orf_name="AFUA_5G00990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86204.1"
FT                   /db_xref="HOGENOM:HBG055548"
FT                   /db_xref="UniParc:UPI000051FA0F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDX3"
FT                   /transl_table=1
FT                   /translation="MRSARRIAPRPLDTPAEKKKLDKSQNDYNRGYEVMYGQMIEKDTK
FT                   HDLKEGFLEVRPWTEPLA"
FT   CDS_pept        join(256276..256447,256495..256850)
FT                   /codon_start=1
FT                   /gene_family="HOG000048457" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208739"
FT                   /orf_name="AFUA_5G01000"
FT                   /product="Oxidoreductase, 2OG-Fe(II) oxygenase family,
FT                   putative"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL86203.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG055547"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000051F2E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDX4"
FT                   /transl_table=1
FT                   /translation="MDYLNQVTALTEKVLQAIGVSLGYDESYFDEICTEPMAFYQLLHY
FT                   PPQPADADPLQRGDVPGLEVWDEESQSYYPVSPIEGAYVVHLGNLFQQWPNDKYMSNVH
FT                   RVINRSDVDRYCIPFNYNGNLDFVIRCIDSCRAKPEDEKYAPISVDDYIRQKYKDVYGR
FT                   VGIYSVAERVKT"
FT   CDS_pept        join(258208..258378,258406..258552,258634..258708)
FT                   /codon_start=1
FT                   /gene_family="HOG000216969" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208740"
FT                   /orf_name="AFUA_5G01005"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27262.1"
FT                   /db_xref="UniParc:UPI0000F51C98"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA00"
FT                   /transl_table=1
FT                   /translation="MSSSDTTSIVRPLSPSAMETSIPEHDPEATLLEMEDMGHDMAPDE
FT                   DTLAIFLEMGNMTQAIHLEMEDTARDIVPEQEFGVLLLQMEDMVQDMSDMLLEAATMQE
FT                   TKSFLDAAIGFQKTGANTVKGISRGR"
FT   CDS_pept        join(261795..261931,261982..262167,262224..262839)
FT                   /codon_start=1
FT                   /gene_family="HOG000161889" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268436"
FT                   /orf_name="AFUA_5G01010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86202.1"
FT                   /db_xref="HOGENOM:HBG055546"
FT                   /db_xref="UniParc:UPI000051FA39"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDX5"
FT                   /transl_table=1
FT                   /translation="MNASDDSSFYLYGMGERPEALTLGSLVLERYWEPLVARHYTHELL
FT                   SQEALQEHAYVSNVSNVIFHGRSRLTPGISLSGGDIIDLTLAWNKDSERIVVAKKGVRI
FT                   ILKDPEEFLATSVLRNPKAQEKLKLWLSAARSAYVLNFKFARRPKIWMLSGLYLLEDAC
FT                   TMVSRHSSSKISAGVSGSLVGALSSVPVGGFLNLGEGNSWEMTMELTEQHVWAAQYRLL
FT                   DARFVKVDKRGADSVKLPLSMGLYRDVLSVGTVRGAETDEVELELKNKDQAGGESGQDV
FT                   EDQDGEELEAYEKRLEEAISVFEKAPLHFLR"
FT   CDS_pept        263249..264001
FT                   /codon_start=1
FT                   /gene_family="HOG000161910" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057433"
FT                   /orf_name="AFUA_5G01020"
FT                   /product="DUF858 domain protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL86201.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG011760"
FT                   /db_xref="HOGENOM:HBG737783"
FT                   /db_xref="InterPro:IPR008576"
FT                   /db_xref="UniParc:UPI000051E4A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDX6"
FT                   /transl_table=1
FT                   /translation="MSSPTVSAKLEGSKEQSKSAPDSRIDHAASLKYWNDVPATSNGML
FT                   AMLGDYPWYSRIDLRGSRAFLAKVRRLLPSCSTEGKLKLAVDCGAGVGRITEGFLSHVC
FT                   EVVDVVEPVAKFTEVVRNSSLKKDGTVGDIYTVGLENWYPEKKYDLIWTQWCVGHLTDA
FT                   QLLEYVKRCRAALTETGIMVVKENQSTDINGEDMFDEVDSSVTRTDEKFKKIFKEAGMT
FT                   VFLSEIQTGFPKNFRLLPVRSYALRPNS"
FT   CDS_pept        join(complement(267314..267439),complement(266868..267248),
FT                   complement(266546..266834),complement(266294..266496))
FT                   /codon_start=1
FT                   /gene_family="HOG000071678" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268437"
FT                   /orf_name="AFUA_5G01030"
FT                   /product="Glyceraldehyde 3-phosphate dehydrogenase,
FT                   putative"
FT                   /EC_number="1.2.1.12"
FT                   /function="NAD or NADH binding"
FT                   /function="glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating) activity"
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86200.1"
FT                   /db_xref="GO:0004365"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG269967"
FT                   /db_xref="HOGENOM:HBG571736"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniParc:UPI00005200EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDX7"
FT                   /transl_table=1
FT                   /translation="MTVKVGINGFGRIGRIVFRNSFSHDELEVVAVNDPFIDPKYAQYM
FT                   LKYDSTHGRFEHEISQDEGSLTIQGRKVKFYAEKDPARIPWHETGAEYIIESTGVFTTV
FT                   DKAKAHLRGGAKKVVISAPSADAPMYVMGVNEEKYDGTADVVSNASCTTNAIAPLVKVI
FT                   NEKFGFTAIHAYTATQKLVDGPSSKDWRGGRAAAENIIPSSTGAAKAVGKVIPELQGKV
FT                   TGMAMRVPTSDVSVIDLTCRIEKSATYEEIVAAIKEAAHGPLKGILTYTEDDIVSKDII
FT                   GNPHSSIFDIKAGISLNANFVKLVSWYDNEWGYSRRVLDLVAHIASVDARE"
FT   CDS_pept        271173..271976
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268438"
FT                   /orf_name="AFUA_5G01040"
FT                   /product="Oxidoreductase, short-chain
FT                   dehydrogenase/reductase family, putative "
FT                   /EC_number="1.1.1.159"
FT                   /function="7-alpha-hydroxysteroid dehydrogenase activity "
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86199.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0008709"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00005205AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDX8"
FT                   /transl_table=1
FT                   /translation="MTLSGCVVVVAGASKGIGRAIVLRAAADGASVVINYMSDVKGANA
FT                   LVAQIGSDRAIAVRADISKTAEVDELIEATVARFGRIDVLVPNAAYVPESDLRSVTEED
FT                   FDRAFAVNVKGPCFLAKAGAPRISLEFGTHAEILPSSQKALPYMQPGSTIIFISTDLTD
FT                   ASSVPPHFLLYVSTKGAMNQMVKVLARDLAGAGIRVNAVSPGATSTASFHKAMDETRVQ
FT                   MIASHNPFNRIAEPDEIAAAVSLLWGKDSGWISGQVLRANSGGIV"
FT   CDS_pept        273337..274032
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208741"
FT                   /orf_name="AFUA_5G01050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86198.1"
FT                   /db_xref="HOGENOM:HBG055544"
FT                   /db_xref="UniParc:UPI000051E4AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDX9"
FT                   /transl_table=1
FT                   /translation="MHTVLDQAPPDTSKYKTTSLAEVFEKVRQDPRLDDLFSEPGIANL
FT                   DVLSQEQNIAVVLEHWNAWEITDLVAQFEECCDLAVVLALSNGNRRDSFDFFNAHIMTV
FT                   AHALRVLWHYVPTDRRASILKQYALFGIMTYICQLRPRFSLDWIDAVEVDGRDWNWVVE
FT                   TALAHKWALDAHFFKVVRAPKVFQETFGRKDDFYLKAAIKYVTEFAGWEGYGQGVAGFI
FT                   PSRDGYRPE"
FT   CDS_pept        complement(274190..275278)
FT                   /codon_start=1
FT                   /gene_family="HOG000048459" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268439"
FT                   /orf_name="AFUA_5G01060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86197.1"
FT                   /db_xref="HOGENOM:HBG055543"
FT                   /db_xref="UniParc:UPI00005205AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDY0"
FT                   /transl_table=1
FT                   /translation="MLSVALRIAQALSLHMTDPPFPVTPFEREMRRRLWHVIGWLDLEA
FT                   SLNRGSESMMRSAWIQTHSLTNINDDDFGCDSEDPLPAAQRGPTEATLLILFAHGQCAL
FT                   RALDLSHFAEPGITDIQERQQTVDHFRRTTKELLAGCDPENVPFHWFSIQIQEQISAVL
FT                   QLIALRPLQRSPTFVPAELPAPQMLALAADILERRQRIFNDPRGQPWRWFGLLFFPWHA
FT                   LVVAMTEVCVCTDRLVMDRYWPTVERSYDLFQKQAVGTHYDWLSASMDSLMNNARAARQ
FT                   KVVDSDAPGLQAPDSHLYMDMASLERPLLPESLPPVPDAALAPEGLTLLPDQEISAWAQ
FT                   YGEFTDRFDELHAIFNSGLTWR"
FT   CDS_pept        join(complement(275828..276184),complement(275333..275776))
FT                   /codon_start=1
FT                   /gene_family="HOG000048460" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904163"
FT                   /orf_name="AFUA_5G01070"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86196.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055542"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051F7CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDY1"
FT                   /transl_table=1
FT                   /translation="MPPALAVRLTCQACTRRKVKCDKKSPCTNCLKHGITCVVVERPRW
FT                   PRGRSGNQAISREQDLSDRVAKLEQLIEGLSHSKRGTGNGSSSGGENTIPSSGRSPKSP
FT                   SERAQTTEDLFHLQPSVIRQSADSRERHPENHPELPSEPVRRRILVDIFLRQVDPILKV
FT                   LHRPSLCAYLLEGKPYLDYAPEHPVPAALASAVFYMASSSLAEDQCLALLAERKETVLA
FT                   RYNDETMTALARVDFLVTNHLTVLQAFVLSLVSAWLRRGDCKIS"
FT   CDS_pept        join(complement(278334..278495),complement(277754..278284),
FT                   complement(277051..277701),complement(276701..276853))
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057434"
FT                   /orf_name="AFUA_5G01080"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86195.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000520590"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDY2"
FT                   /transl_table=1
FT                   /translation="MFQVKISSSVSIMAIFPLTRYTAHMGASGLTLNFLVAGIATCAFW
FT                   LFGYDMSVMGGLITEESFTSVFPEMKDANIQGIVIASFELGALAGALACLDLGDRLGRR
FT                   LTVWFGMLFMLVGGTLQTSAWALSQLTVGRVLSGIGLGLQVATIPSWQSECAKAHSRGR
FT                   WVMIEGGLQTFGVACGQLVGYGFFFVKGQAQWRAPVGIQLIPALIVFVFINFLPESPRW
FT                   LIKHGLVEEGAYNLSKLRNLPLDHPELMFERDAIIASFEAQSELAPFSYREMLRNGKTK
FT                   MFHRVAIGFFMQSAQQLSGINLVSTYANKILQESFGLAASTSHLIAAMGGLEYAVCSLL
FT                   SVFLIEGLGRRRAFLWTTVGMSSCFAVIAGLQSTDSRTCQLTAAGFLFLFNTFFGLAWV
FT                   GGPFLYSAEIAPLRCRAQANAFASAGNWLFCFVVVMIIPPAFQNIGWKTDVIFAAGGDP
FT                   VEKEKTMPYNIPIEEARRILGLAESPSIAEVLYHDAKPSV"
FT   CDS_pept        join(279110..279956,279999..280402)
FT                   /codon_start=1
FT                   /gene_family="HOG000256309" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057435"
FT                   /orf_name="AFUA_5G01090"
FT                   /product="UPF0075 domain protein"
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="amino sugar metabolic process "
FT                   /biological_process="peptidoglycan turnover"
FT                   /protein_id="EAL86194.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006040"
FT                   /db_xref="GO:0009254"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG001132"
FT                   /db_xref="HOGENOM:HBG324434"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniParc:UPI000051E939"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDY3"
FT                   /transl_table=1
FT                   /translation="MRLGSNSSLKVIGHNAGTSMDGVDLVHVHFTQDSPKMPLKMQLLH
FT                   YGEYPMPKKLKARVMKLIKENKTTPEEMAIVNIQLGEVITDAVKWFAQENNFSLASDVD
FT                   LIGGQGQTIWHLPLPELFEGNQSRAHLDMGEIAIIAAGTGVTSLGNFRVSEMALGRQGC
FT                   PLFAALDSLLLSHPTLNRAVQNIGGIANFSILPRGAVEECYDFDTGPGNVFIDAAVRYF
FT                   TNGEQEYDKDGAMGQKGKVDQSVVDRVLQGPYFVHDIPKTTGRETFGDRMAEDICDEML
FT                   AQGVNTGGATPEDCVATITRITAQSLADAYERWGPPGGVDEIYMGGGGSYNPNIINYLK
FT                   ERMPNTRIVPISEIGIPIGAKEALGFALLTHECFVGRPMIVPKRTESDRPGVVGQIQPG
FT                   TNMHRIRQHVAQVSRAF"
FT   CDS_pept        join(281249..281333,281490..282003,282123..282903)
FT                   /codon_start=1
FT                   /gene_family="HOG000216967" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268440"
FT                   /orf_name="AFUA_5G01100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86193.1"
FT                   /db_xref="HOGENOM:HBG055541"
FT                   /db_xref="UniParc:UPI000051E94D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDY4"
FT                   /transl_table=1
FT                   /translation="MKHAISVVEATSSVINHGLALYASDEGSTTFVDETEEVADLYQVT
FT                   DASIEVSSVALDQRPSPRPGLSSHGTPITDATDAFFLWRYIDFIGPRFDMFDDAPRYFS
FT                   TVVPQLALKDPLVLLACVAVAARQYSLVNDQQQHSHEQALTYYNAAIHLLSKRLHDSGP
FT                   DPAVFASCLLIAHCEMVESKASAWDLHLKGTGDLLKMMIILASLCAGKPAALEPREWLP
FT                   GGVFCDPPTWTLKSWQKKVVFLLGMVHDFWSRTPPDDMDRPTKQRHDAQWKELEAELVS
FT                   LQTQAPAVCSPISILPPNGEDTPFQSVRYLNGPVSAAWQMLHTAFLIHTICTPCSPASS
FT                   RLSVLSRPDVTGRAQMYARQIVANSLANRCTIAWANAVQLLTLAGQCLVVEAERNACVR
FT                   VLQEIQQQTGWNTRASIDRLGAAWENAWSYESRGRHAAVGQVDAGKLLYHVWLGEERRP
FT                   S"
FT   CDS_pept        complement(282982..283083)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268441"
FT                   /orf_name="AFUA_5G01110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86192.1"
FT                   /db_xref="HOGENOM:HBG055540"
FT                   /db_xref="UniParc:UPI000051F06C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDY5"
FT                   /transl_table=1
FT                   /translation="MEINVISEVDIGRPALMKEIPFMKAIDEILDNF"
FT   CDS_pept        284364..285428
FT                   /codon_start=1
FT                   /gene_family="HOG000216966" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208742"
FT                   /orf_name="AFUA_5G01120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86191.1"
FT                   /db_xref="HOGENOM:HBG055539"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniParc:UPI00005200FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDY6"
FT                   /transl_table=1
FT                   /translation="MVKFAILTGVIALATTVSAQCGSGTPDATVKGADGSYTATVGSKK
FT                   VYSGADYYTAIQTALDAISSGQRLSVIASGSIGTNVISISSGKTFEGCGTIDVGYKRAR
FT                   GAIESLNTDGVSIPYLTVTGNPYFGMRFYGVKRLSLGNITMKLSGGLGIRFERDKAANS
FT                   DVSMDTITVTGAGSHAVETWNIDGLTINKVVARDVGECGLLLQTTTNAKVGLVDGDNVA
FT                   AGTGYATFRMANANGRLADGSYKTNVFVDKVVSRGGGRGVFCVSESGGVEISNVDLADN
FT                   GNNAILIENCYGVSIRGGTVKGGGEVRLAARDEFKNNHDVSITLKVNGNTVRENPCGEN
FT                   ITWNISGDASLNVC"
FT   CDS_pept        join(286431..286515,286713..286852,286925..287116)
FT                   /codon_start=1
FT                   /gene_family="HOG000216965" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268442"
FT                   /orf_name="AFUA_5G01130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86190.1"
FT                   /db_xref="HOGENOM:HBG055538"
FT                   /db_xref="UniParc:UPI000051FA38"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDY7"
FT                   /transl_table=1
FT                   /translation="MRFTSSEWRASGLLNTAEDELLDLGVGTNLWLNGCNQVNAVVLLK
FT                   WSKTSNDRVKGTAEVWRRGVGGCGLTAHTKIIFPAPNPAPAPGTDIIEFSRQDLFGHHM
FT                   RPGRSLTDVFPLDLEDLRDFARERLMVLMGLTPA"
FT   CDS_pept        join(complement(288206..288453),complement(288056..288156),
FT                   complement(287879..287998),complement(287645..287820),
FT                   complement(287426..287590))
FT                   /codon_start=1
FT                   /gene_family="HOG000161878" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268443"
FT                   /orf_name="AFUA_5G01140"
FT                   /product="Plasma membrane ammonium transporter (Ato3),
FT                   putative"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86189.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG055537"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI0000520581"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDY8"
FT                   /transl_table=1
FT                   /translation="MNEKSDETLRRMQTAESVFLPISREAFEKLYLNPKSPTVSGDLRK
FT                   KVGNPTPISLLGFLLASTTNACIVMGWRGAGGNGAAIIPVLIFFGGMVQIFGGIGEWII
FT                   GNTFSCALFFTYGTFWIVQGTTLMPFFATGIHFSSTGNFLEGQQTPMYNASIAFYFVAL
FT                   TVITFIYMICSLRTNVCLFSALFLLEITLGLFAGAFFSVSAGNIHLAEKLQVAGGAFNF
FT                   ALCIPIWWIFITQILEAVDFPVSLPVGDLSTMIPGRSQRMRSKQAEA"
FT   CDS_pept        join(complement(291606..291926),complement(291299..291555),
FT                   complement(290147..291248))
FT                   /codon_start=1
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268444"
FT                   /orf_name="AFUA_5G01160"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86188.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FC75"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDY9"
FT                   /transl_table=1
FT                   /translation="MLFRKPKLPQANPDAYYQDDNVASDTHSQAAIAGEDGQLVDTHIP
FT                   LLTWRSFVMGVFVSMGGFLFGYDTGQISGFLEMKNFLQRYGQKKSDGTFYFSNVRSGLI
FT                   VALLSIGTLMGALVAAPIADRIGRKWSITSWSLMICVGITVQISSPTGKWYQVALGRWV
FT                   AGLGVGALSLLVPMYMAESGPRHIRGSLVSTYQLFITLGIFVANCINFGTEARPDTGSW
FT                   RIPMGITYVWALILGSGMALFPESPRYDYRHGKIDKAITTLSKMYGIPKNHRALKVEFE
FT                   EIKQKYEEEVASGQVTWVHLFKAPRMAYRVAVGVSLQALQQLTGANYFFYYGTTVFKGA
FT                   GISNSYVTQMILGGVNFGTTFLGLYLIENYGRRRSLIAGALWMFVCFMVFASVGHFSLD
FT                   REFPERTHTAGVVMVVFACLFILGFASTWGPMVWTIIAELYPSQYRARAMSLATASNWM
FT                   WNFLLAFFTPFITGAIDFRYGYVFAGCLFLAAAMVYFTVMEGQGRTLEEIDTMYVWKIK
FT                   PWHSSKYVFPDQTDRRDESEKRTAGTNEHMETSGAQPETEIV"
FT   CDS_pept        join(complement(293896..293906),complement(293794..293848),
FT                   complement(293285..293744),complement(293165..293229))
FT                   /codon_start=1
FT                   /gene_family="HOG000039675" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268445"
FT                   /gene_name="sym1"
FT                   /orf_name="AFUA_5G01170"
FT                   /product="Protein sym1"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL86187.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG472290"
FT                   /db_xref="HOGENOM:HBG750297"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI000051EDE0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDZ0"
FT                   /transl_table=1
FT                   /translation="MFQWYQRSLIQRPLLTQSLTTACLFAVGDSLAQQAVEKRGIAQHD
FT                   VARTGRMAFYGGGNVQPFPYKLPLLTVVAVFGPLATKWFQVLQRRINLPSAQRTVVGRV
FT                   AADQLLFAPTMIGVFLSSMSVLEGGSLSEKLERSYWPALKANWTVWPFLQLVNFALVPL
FT                   QFRVLTVNVLNIGWNCFLSLSNNVGSQDVPLVA"
FT   CDS_pept        join(complement(295932..295991),complement(295791..295883),
FT                   complement(295592..295745),complement(295319..295542),
FT                   complement(294359..295270))
FT                   /codon_start=1
FT                   /gene_family="HOG000161844" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268446"
FT                   /orf_name="AFUA_5G01180"
FT                   /product="RAN small monomeric GTPase (Ran), putative "
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="EAL86186.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG055536"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000051E719"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDZ1"
FT                   /transl_table=1
FT                   /translation="MTKDTRTFNVLLVGNSGVGKTAFLHRYLKKRFEHSPPVTANVEKH
FT                   DVLLHTTVGPVRYEIWDVSGKQKPTVLASREFDDIDAAIIMFDLTDRVSYNNVPNWYKS
FT                   LVNKDGMRLGRYIPICICGNKNDASMDAKLPPNAITFPKNKGTGYVEMSVMVLDNVHEP
FT                   FLDLARQLLKNPTVWYKPRPDIGPIVLEFPTVRHQWSHQDNRSQYPKHEFEPRVLTKEV
FT                   SPLASPPVIAADISAERPPAVIELPKKADASNGQLKFISSTNRVPNGLKSPVNGTISVL
FT                   SETEPAVKGTAPVAKAEQTELHIVPTETHEPTREHHGSRNEHRESNNTLESLEKQPTPL
FT                   KDESLFVLCIHCIRMVLIKCIQGTPLAQLSNDNPSFALITTACRACRHDSQKSQSDEVR
FT                   MSPDLIRYTAMYECARKVAEDEVEVLTNKKSVAHISLDNLTDSIGRECQIQGISTSSDT
FT                   LQRLRQIPRKDVLLGYVPGAFL"
FT   CDS_pept        join(complement(299092..299567),complement(298822..299048),
FT                   complement(297099..298774))
FT                   /codon_start=1
FT                   /gene_family="HOG000161832" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208743"
FT                   /orf_name="AFUA_5G01190"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86185.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG398422"
FT                   /db_xref="HOGENOM:HBG695124"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="UniParc:UPI000051F52E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDZ2"
FT                   /transl_table=1
FT                   /translation="MWLTPVLAVLAALSPTIAISFNPSTYTWYTSPAADFASTLPIGNG
FT                   RLAAAIWGGAVDNITVNENSIWSGPFQDRVNPNAYEGFTDSRAMLEAGNLSSANDVVLR
FT                   EMVSIPSSPREYHPLGPLKLDFGHEASSLHNYTRFLDLGTGVAGVRYHVGDVVYSREYV
FT                   ASHPDGVLAVRLRASKDSALNVVVSLERNRYVESLTAVSSKGMGTLTLKANSGQNTDPI
FT                   RFTSQARVVSREGRITTNGTSVVVTGASTVDIFFDTQTSYRYPDETERDSAVKKQLDAA
FT                   VKLIYPAVKQAATSDYQSLSGRVKLDLGSSGSAGNQPTDIRLTNYKTNPNGDPELVTLM
FT                   FNFGRHSLIASSREGSSSALPANLQGIWNQDYSPAWGGKYTVDVNLEMNYWHAQVTNLA
FT                   DTFEPVIDLMDKVLPHGQAVARKMYHCDTGYILHHNTDLWGDAAPVDNGTKWTMWPMGS
FT                   AWLSMNLMDQYRFTQDKTLLRERIWPLLKSAADFYYCYLFEFEGYYTSGPSISPENAFR
FT                   IPEDMTIAGKSTGIDLAPTMDNLLLHELFLAVIETCKALDITGEDLANAQKYISRIRQP
FT                   QIGSYGQILEWRREYQETELGHRHMSPILGLYPGSQMTPLVNQTLANAAKVLLDHRITS
FT                   GSGSTGWSRAWTMSLYARLFDGNSVWHHAQYFLQNYPTDNLWNTDYGPGSAFQIDGNFG
FT                   FAAGIAEMLLQSHAVVHLLPALPDAVPDGRVSGLVARGNFVVDMEWSNGELKSAKIESR
FT                   NGGVLALRVQDGRPFTVNGEEYKEQIQTVAGKSYTVRLN"
FT   CDS_pept        join(complement(301270..301514),complement(300890..301220),
FT                   complement(300327..300852),complement(299993..300292),
FT                   complement(299899..299963))
FT                   /codon_start=1
FT                   /gene_family="HOG000157125" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268447"
FT                   /orf_name="AFUA_5G01200"
FT                   /product="Carboxypeptidase S1, putative "
FT                   /EC_number="3.4.16.6"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL86184.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG055535"
FT                   /db_xref="HOGENOM:HBG323860"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="UniParc:UPI000051FED9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDZ3"
FT                   /transl_table=1
FT                   /translation="MWCQKWLFAFLVAGAGAAPASTAKDSISSVVKNGVKYTVFEHAAT
FT                   GARMEFVKNSGICETTPGVNQYSGYLSVGDNMNMWFWFFEARNNPKQAPLAAWFNGGPG
FT                   CSSMIGLFQENGPCHFVNGEDTPSLNKYSWNNYANMLYIDQPIGVGFSYGTNDVTSTET
FT                   AAPYVWKLLQAFYAQFPEYESRDFGIFTELIFQSYGGHYGPEFASYIQEQNAAIKAGTV
FT                   SGENINLVALGVNNGWTDSAIQEKAYIEYSYNNTYKQLINSSDRTRLLSVYNSQCLPAI
FT                   QKCAKTGTNADCRNADSVCYSNIEGPISESGDFDVYDIRQPQNDPFPPQTYSTYLANPN
FT                   VVKAIGARTKYQECPNGPYNKFSQTGDTDDVDPRSFLATLSDVVKSGINVIVWAGDADW
FT                   ICNWLGNYEVANAVDFPGQSKFTAKDLAPYTVNGVEKGTFKSVDNFSFLRVYEAGHEVP
FT                   YYRESFLTSQPETALQVFQQILQKKPIFST"
FT   CDS_pept        complement(302633..304030)
FT                   /codon_start=1
FT                   /gene_family="HOG000161810" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268448"
FT                   /orf_name="AFUA_5G01210"
FT                   /product="Amine oxidase, flavin-containing superfamily "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL86183.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG055534"
FT                   /db_xref="HOGENOM:HBG328703"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000051F05A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDZ4"
FT                   /transl_table=1
FT                   /translation="MYISMRTTKSFLASLLLGQAIAHPGFPGPDISIFDNAATIERDVA
FT                   IIGGGASGTHAAIQLRKMGRSVAVVEREPLLGGHTNTYLDPVSGQHIDYGVLIWQNTPE
FT                   AREFLAHFNISTTVAQFRRSNSTRVDLRTGQIVPPPQGNVTDAMMRYAMQLLQYPYLEE
FT                   GWNLPDPVPEDLLLPFGEFVEKYDLAAAVETLTLYAQGLKDWLQCPTIYIMKQFSLGVA
FT                   LGAQNGFLASVDGNNGALYEAAQKELGNDALLSSTVVSMERPADRLHRILVRTPTGYQL
FT                   IRAKKTIITTPPKVENLVNFDLDDTERGVFGQFENAFYYTTVVSVAGLPAGLDIINRAA
FT                   DTPYNIPHLPGVYAMLPSRVPDIYTIFYGGREAKTEDEVKKSIRDGVMMLREAQFTPSE
FT                   PEILAISNHSPFALFVSADQIAKGFYRDLYALQGQRNTYYTGAAFHTHDSAAVWSFTDN
FT                   LLTTMFA"
FT   CDS_pept        join(305420..306082,306140..306622)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057436"
FT                   /orf_name="AFUA_5G01220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86182.1"
FT                   /db_xref="HOGENOM:HBG055533"
FT                   /db_xref="UniParc:UPI000051FA1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDZ5"
FT                   /transl_table=1
FT                   /translation="MQSSHFWTLKIKSEEFEFAFELHELEPSKFDNARLLHRLICIQRA
FT                   TSLHNRARIWGLARCLKGILDLSEPDTTTMVNNPSDPVGLDWGKLHWSIKPPNSGQEYA
FT                   KGCQILYTQRVILTGHLRQITVSSINMEDTVHITGLKLSFDDGTSTQLGYRSQDNSSTD
FT                   VVAFGGFVVAVGTTGIHGLQIIDNRSDSTKWFGSNRRCPQTRKLKSEKEIVGIKAFFDG
FT                   FKLVSLALGRPLRPKRKSRRSLLDTALWYPSIPPENLRIADGFSVGQSPTTSRHSLLFW
FT                   VWFGGPGGSYLQYLTGISGTRFKGSLGGIEFHFSTDSVPITSRKLGLCDDKEGPDFAID
FT                   GAGGEYITFVYGKFSPMSYLSVLVVCQKQVLRVLIKADIRG"
FT   CDS_pept        join(308615..308889,308954..309665)
FT                   /codon_start=1
FT                   /gene_family="HOG000169819" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752046"
FT                   /orf_name="AFUA_5G01230"
FT                   /product="RTA1 domain protein, putative "
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86181.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG052458"
FT                   /db_xref="HOGENOM:HBG332244"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI000051F2B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDZ6"
FT                   /transl_table=1
FT                   /translation="MVSNTTDPSDYCTLDTCPLSLANFNYVPNLAGNLLYLALFGTMLV
FT                   ANLGLGIYYRTWGYLVGMIGGLALEVIGYVGRIQLHYNPFPFSPFLQYLICLTLGPAFL
FT                   SAAIYICLGHIVVVYGEGISRLKPRTYTIIFVLCDFLSLVLQAAGGAITSIADNDQQDL
FT                   RQTGINIMIAGLASQVASLAVFLFLCADFAWRVYKNPNKLNESMDHVRKTLKWKAFLIG
FT                   RFLFPGISPRYIYLTAKGLTVATLAIFVRSVFRVAELQEGFDGPLANDEVTFMILEGAM
FT                   MAMATLCLTVLHPGYCFGGYWDQTSWRSIKQSSQLSLMELKAQNSRA"
FT   CDS_pept        join(310446..310763,310812..311081,311136..312056,
FT                   312219..312371)
FT                   /codon_start=1
FT                   /gene_family="HOG000158126" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752047"
FT                   /orf_name="AFUA_5G01240"
FT                   /product="General amidase, putative "
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="EAL86180.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG327754"
FT                   /db_xref="HOGENOM:HBG348222"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR015830"
FT                   /db_xref="UniParc:UPI000051F059"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDZ7"
FT                   /transl_table=1
FT                   /translation="MDSQNSISGWQHKVAQKQQECLQKIPAEWKIPESLLSSLQLPLAE
FT                   NRNDLIQGDAVRKAGILTERELQITEQYTVSGLLSALADGRLTSLEVTLAFSKRAAVAQ
FT                   QLVNCLTETMFPEAQERAKYLDELKVQGKSAGPLHGLPISIKDLFHVKGTHASIGMISF
FT                   LDEKSTDNSPLIDILLSLGAVIYVKTNIPQTMMTADSHNNVFGRTLNPHNTILGPGGSS
FT                   GGEGALIAMRGSPLGVGTDIAGKKAPGRQEVANKPGSIRIPALCCGTYGFRPSASRIPN
FT                   GGGRSCSTPGMKFILSCAGPLALDMDAVEVFLKTVIDARPGLYDSSVIDVPWRQATVKH
FT                   PLRIGVVPPDSSFPLHPPVKRTLAKAVKLLKAQGHHIIELSAEECKVMEINEVAWNIFT
FT                   LDSGAMEHLQATGEPPVPALINVQRQVEILRQAGKTYLPDFSHLDRLGRLAALNTKRAD
FT                   LRETWRKMWISHDLDICLAPSAQNTAVPHDMFGLAPYTTFLNCLDRPIPLTNSHLDNFA
FT                   QLEGAPCSIQVFTTTMRDEECLEMAKIIDQCLKSEA"
FT   CDS_pept        join(312721..312771,312851..312961,313007..313114,
FT                   313200..313499)
FT                   /codon_start=1
FT                   /gene_family="HOG000253035" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268449"
FT                   /orf_name="AFUA_5G01242"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27261.1"
FT                   /db_xref="UniParc:UPI0000F51C78"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Z9"
FT                   /transl_table=1
FT                   /translation="MDMIDSNRKASLHARDATKLTLSIHTIRYPDTQITPKWSPSTPQS
FT                   KGQTPPYSQDRRHPHHHKIQKWHVPRPPEQTILVAELLRKAASKRVTGTINHLSFDTVM
FT                   EVHVAGLCLGAFTGNPQLSFTIGVDLECANGELQLTAVGDDIYLKVDMALVQVGKDKKA
FT                   ERVKLSESVCIKSLPQELCEPWMPTQ"
FT   CDS_pept        join(314943..314978,315035..315115,315171..315371)
FT                   /codon_start=1
FT                   /gene_family="HOG000216964" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268450"
FT                   /orf_name="AFUA_5G01245"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27260.1"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniParc:UPI0000F51C79"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA04"
FT                   /transl_table=1
FT                   /translation="MNPKESQNPSAEPLSEREKHLLSIYGKLPHKGLLGAAAKHRTYFD
FT                   SGDYALAAAHKVTDEGDIQTGTAHPLRESIPHPYAPVPSSGNVAGDANKDSHCRRSSSP
FT                   E"
FT   CDS_pept        316370..316927
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208744"
FT                   /orf_name="AFUA_5G01248"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27259.1"
FT                   /db_xref="InterPro:IPR019268"
FT                   /db_xref="UniParc:UPI0000F51CA3"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA03"
FT                   /transl_table=1
FT                   /translation="MEISWLFRAAINIKSGDTNDSRLVYWIDRDFSQHSIIDRLSVLKP
FT                   GFHLLEDTKSSPDGPRVGFIRSNLFNVNSGRVLPQNIEGPDNNIIDLLEPEVRQAIERQ
FT                   AEVYVFGARFDTKDGIHDVHMNQGNKGRWKGITPSFKTEHSLFISQILTDGLAFSSALH
FT                   PRQPIPMIGLGMPYHRRLGVTT"
FT   CDS_pept        318205..319062
FT                   /codon_start=1
FT                   /gene_family="HOG000080284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268451"
FT                   /orf_name="AFUA_5G01250"
FT                   /product="Oxidoreductase, putative "
FT                   /EC_number="1.1.1.31"
FT                   /function="3-hydroxyisobutyrate dehydrogenase activity "
FT                   /function="coenzyme binding"
FT                   /function="phosphogluconate dehydrogenase (decarboxylating)
FT                   activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="EAL86179.1"
FT                   /db_xref="GO:0004616"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0008442"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG219367"
FT                   /db_xref="HOGENOM:HBG729179"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EDDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDZ8"
FT                   /transl_table=1
FT                   /translation="MSSVSIFGLGAMGTALASRFLEEKYKVAVWNRSPEKASSLLGKGA
FT                   TLSHTAVDGINASDLIIICLLDNAAVEATLAGALDHLHGKTIINLTNGTPDQARKLSDR
FT                   FVSHGARYVHGGIMATPSMIGSPYALVLYSGSPDAFKAAEGDLSVLAKCVFLGEDAGTA
FT                   SLHDLALLSGMYGLFSGFLHATALVRSSTPAVKFMDLLVPWLGAMTEYTKGMAKQIDEG
FT                   KYTSEGSNLAMQLVGIQNIIDASEAQQVSAEFIRPMKEFMQKAVAAGHGGDDISSLIDF
FT                   VKST"
FT   CDS_pept        complement(319339..320223)
FT                   /codon_start=1
FT                   /gene_family="HOG000216963" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268452"
FT                   /orf_name="AFUA_5G01260"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL86178.1"
FT                   /db_xref="HOGENOM:HBG055531"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051F078"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDZ9"
FT                   /transl_table=1
FT                   /translation="MPALVSRQISTPESNISVQNGTKVPSTTSCGLLVNAARKGNVDVI
FT                   RFLIYLGADVNEYYDGVTPLLAAAIAGQEAAMTELLQNDASPTARDSEGCTIFKLLLDN
FT                   GHYNIAEMLIKKYPDLTVTDPRLPKGEKWLREQFEEISDNVKDPKSKPSKEILEYLISG
FT                   QLPQEEGRSVSDVYWEHILLRYIGDVPLDIKRNYSRSLRLSLMGTFDRFFLGHEGIKES
FT                   ARLLNSKLPTTAYTIEGTVVDGDGGWVTERWSYHDAYGIDVRDGIDSFLIDSEKGKIMV
FT                   KMINYNVCEKTKG"
FT   tRNA            complement(321610..321680)
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        join(322314..323171,323216..323502,323549..324173)
FT                   /codon_start=1
FT                   /gene_family="HOG000161788" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752048"
FT                   /orf_name="AFUA_5G01272"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27258.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG324956"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000F51C80"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA02"
FT                   /transl_table=1
FT                   /translation="MPDLGTSKHRSSRACTACRAKHVRCDAALPRCTRCVGEEKECVYV
FT                   KSRRGGRRRVLNTLTSSMNGTKMDQESFISILPILSQTGTRELNPGFNLTTSTSAPSGT
FT                   VDDQLLSLYYRYFHSAHPCAVPRFAIQRYAVSDRRAIQPLYAVMKYIGSLHNALIPSSQ
FT                   LKDHVEAELAVARSTDHVVSPFAVQAVLLYSIAVYWCDETEKGLDLLEEAIQMALGLGM
FT                   NRSNFATEHGRNDPILEESWRRTWWQIYITDAHIAGSTHSYPFRTDGILMDVHLPCEEE
FT                   EYESGNIPNPRTLEEYDMREFSGDEREFSSFAEMVGLTRSLDLALAARKDLDLKIITTV
FT                   CANVDAIHVSWTSLLPASKRTVFRPDGSLDETLFKAHAIIHTWIVDLHRQLSNLAYSAI
FT                   EGVSKCCPQAPPESLLQSNSPESDLHTRRVLHSIEQFESLLTLPTNIVSHTPFIICMIA
FT                   VVAVAHLSACRYVFKGQDLRLDRERIRVTMGTLKAMGEHWALGKRTYQEISVIAREILS
FT                   LDRPLPSPSMPQEPQHAMTGISGVTADMTASSFALAMAAESLDFCDLFDIDYHEATIRD
FT                   ALTQDLVVAECCV"
FT   CDS_pept        324793..325785
FT                   /codon_start=1
FT                   /gene_family="HOG000294678" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268453"
FT                   /orf_name="AFUA_5G01290"
FT                   /product="Zinc-binding oxidoreductase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86175.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EDF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE02"
FT                   /transl_table=1
FT                   /translation="MSIPKTMRALLQPSIEEPRLVITADHPVPTATEGTDEHLIHVHCV
FT                   SPCANELNWAKAFPALQQREQIPCYDVAGTVVTAPPSSDFQPGTEVYARSNYLRPGCAR
FT                   DYAVISGADLARRPQNLSWVASTAIPLSAQTALQALFVQSGIGELGDQAWKGKRVLVTA
FT                   ASGGVGIWVVQLARLAGATVIGTCGPRNVEFVKSFGASNVINYREADLKEWGQRPENQV
FT                   DLVVDCTGKKSLEDAWWCVRDGGILISICQPPEQVQPEECKGKNVRNFFFIVSANRADL
FT                   EKVTKLVEEGKCRGVVDSVWPLEQFEDAFKRLDEGHARGKIILDLSLNH"
FT   CDS_pept        complement(326045..327838)
FT                   /codon_start=1
FT                   /gene_family="HOG000161777" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268454"
FT                   /orf_name="AFUA_5G01300"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL86174.1"
FT                   /db_xref="HOGENOM:HBG055528"
FT                   /db_xref="UniParc:UPI000051F2CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE03"
FT                   /transl_table=1
FT                   /translation="MAYINFYLLVLLLQSLPVSAQYVVSSTAAWSSQIVAFWGAILIAA
FT                   HVGKVASGATALFSSVRMALRIRSMTRALARGNWFLHAGWVTNKVRTDVAVVCWRTPED
FT                   LQGLVRRVAMQIETFAAGRDWQVLVVGCQLKDQPPRESIVHWIKCPRSESLCGAKVKET
FT                   NENLFPLRDADLAFALAMLEQSPPATTEDIVREMETRMDVRASRCTYIKEQQQELQVTE
FT                   STLSWGWIFTSVDHNITPFLKLRKWTSPYGSDRGARMACATRMYLLVHLLVACAVGLMA
FT                   AATGRGLAVWFMTVRPTLATMGGKNVNGNDILQSLLCMDEAVFQYETADGSPLLAGDVL
FT                   ASSLPWWATMLAVAMPALEMALIIAGWLYGGLNAKRLAPSGVVGHGMLWLSVVVGLSLC
FT                   IRALFTLRNQGKGRLVGIWHKHEFAQYTIGAESLEISAADLARMAGEPSPIGLVVRLLR
FT                   ENNPDTIPVIESLLRLPILAVLVEYLLATRVLQYQYQGDEIVARGSRAISPKSESPWRQ
FT                   SYCCVVVTMACACLSAVYAYYPLPKWVKLVTELLLALSAVWFNSIDLVGSFMHEKETSV
FT                   CFMVATLVVSSVWYVGLDNVG"
FT   CDS_pept        join(complement(330315..330462),complement(329968..330216),
FT                   complement(329464..329900))
FT                   /codon_start=1
FT                   /gene_family="HOG000179260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208745"
FT                   /orf_name="AFUA_5G01310"
FT                   /product="RTA1 domain protein, putative "
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86173.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG123771"
FT                   /db_xref="HOGENOM:HBG447992"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI000051F537"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE04"
FT                   /transl_table=1
FT                   /translation="MAFKLYHYDPSAGAAVSFAAVFGLTTVVHIWQMAKTRAWFMTAFI
FT                   IGGFFEAIGYLCRYISAKQTPNWTTKPYIGQSLLLLLAPALFAASVYMILGRIIRLLNA
FT                   GSLSLVRPNWLTKVFVAGDVISFFMQCGGGGLLAGAKTQDKVNMGEHMIIAGLFVQILF
FT                   FGFFMLVSVIFHRRMLATPIHHMMSTQLPWNYYMKILYTVSVLIMIRSVYRVAEYVQGS
FT                   DGYLQSKEAFIYVFDAALMFACCVILNVSHPSKLLSHSQADQKVDSDLEMLNPER"
FT   CDS_pept        join(complement(333757..333834),complement(333189..333666),
FT                   complement(332286..332991),complement(332169..332196),
FT                   complement(331954..332123),complement(331691..331901))
FT                   /codon_start=1
FT                   /gene_family="HOG000048461" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904164"
FT                   /orf_name="AFUA_5G01320"
FT                   /product="Phosphate permease"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86172.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG055527"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00005200F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE05"
FT                   /transl_table=1
FT                   /translation="MRRPRLAALGLRIYPWKDYQDFRHQTSRKRTTAGMDVDRHRSRHR
FT                   LFQLMHMLYVTAPIRQGSSTDFADLLCQHGSTHNKYCLLEPFELDRVKCSPTRLRGGSE
FT                   YSHFRRCTAWPDRLWLRCGCLGTKQGVRHGVGYSDLPHSGTRIIVFWGREFHVCYLPFL
FT                   VLAWTARDWFGRGLSCRQLSVQKTCVRSLDTIWRLLVGLGAVPAFIALWFRLTIIESPR
FT                   YTAEVTKDSLQAVNDVSQFYQRVSIDSASVNSVEPPSPESGSFRLSATQSVDHQPDRPA
FT                   SAAPFAEQDAASPLAILNDFKHFFGQKDNFRKLAATSLCWFCLDLPFYGLGLISPRITR
FT                   IIWFGSKLPRTSLYQLLFQTAYQSTVVVSSGAVVGNLLSILTIDKLGRRNIQLNGFFWL
FT                   FLLNVVIGASFQHLVNHDDSSALGPNTTTYMLPAELFPTRFRCTCHGIAAAFGKLGSVL
FT                   AQCFLAYVDFGNGADYTNVPDWLGYALLCLSFFMLMGLLITYFFIPDVRDKDGRTKSLE
FT                   ELTDGMMPGDEFSRAVANGHPVRGASPEMTQVDGDSASV"
FT   CDS_pept        join(337894..338249,338308..338613,338674..339063,
FT                   339110..339550,339600..339936)
FT                   /codon_start=1
FT                   /gene_family="HOG000161722" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057437"
FT                   /orf_name="AFUA_5G01330"
FT                   /product="Acid phosphatase AphA"
FT                   /EC_number="3.1.3.2"
FT                   /function="acid phosphatase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="EAL86171.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG055526"
FT                   /db_xref="HOGENOM:HBG327197"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR014390"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="UniParc:UPI000051F2E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE06"
FT                   /transl_table=1
FT                   /translation="MKAATASALLVALTATAAQARPVVDESYPYTGPAVPVGDWVDPTV
FT                   NGNGKGYPRLVEPPAVKPATANPKNNVNVISLSYLPDGMHVHYQTPFGLGVRPSVKWGK
FT                   DPKHLDRVAHGYTHTYDRTPPCSAIKAVTQCSQFFHEVSLDKLESGTTYYYQIPAANGT
FT                   TQSEVLSFKTAHRAGDRRPFSVAVLNDMGYTNAGGSFKQLVKAANEGTAFAWHGGDLSY
FT                   ADDWYSGILPCADDWPVCYNGTSTELPGGGPVPDEYRKPLPAGEIPNQGGPQGGDMSVL
FT                   YESNWDLWQQWLGNVTRKIPYMVLPGNHEAACAEFDGPGNVLTAYLNNGVSNGTAPKAN
FT                   LTYYTCPPSQRNFTAYQHRFRMPGPETGGVGNFWYSFDYGLAHFISMDGETDFANSPQW
FT                   PFAADIKGNETHPTASETHITDSGPFGAVDGSYKETKSYAQYKWLKKDLASVDRKKTPW
FT                   VFVMSHRPMYSSAYSSYQKNLRAAFERLFLQFGVDAYLSGHIHWYERLYPLGANGTIDS
FT                   ASIVNNHTYRTNPGKSITHIINGMAGNIESHSEFGKGQGLQNITALLDTTHFGISKLTV
FT                   LSEKEVKWEFIRGDGSVGDYLTLRKEKTQSKEK"
FT   CDS_pept        join(complement(342283..342310),complement(341519..342143),
FT                   complement(340346..341459))
FT                   /codon_start=1
FT                   /gene_family="HOG000189547" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057438"
FT                   /gene_name="plb2"
FT                   /orf_name="AFUA_5G01340"
FT                   /product="Lysophospholipase 2 "
FT                   /EC_number="3.1.1.5"
FT                   /function="lysophospholipase activity"
FT                   /biological_process="phospholipid catabolic process "
FT                   /protein_id="EAL86170.1"
FT                   /db_xref="EMBL:AAF64039.1"
FT                   /db_xref="GO:0004622"
FT                   /db_xref="GO:0009395"
FT                   /db_xref="HOGENOM:HBG397277"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI000051EDF0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P8P4"
FT                   /transl_table=1
FT                   /translation="MYKNRVELTTTAPVNRALPNAPDGYTPQGETCPSKRPSIRNATAL
FT                   SSAETSWLKARRNNTKDALKAFLSRVDLGSFNGSDYIANHSANASALPNIGIAVSGGGY
FT                   RALMNGGGALQAFDNRTTNSTHSGQLGGILQSATYLSGLSGGSWLVGSIYMNNFSDVSS
FT                   LQDNGSVWQFQDSIFSGPTQSTTWDIGTVEYYSQLLGAVDGKSNAGYEVSITDYWGRSL
FT                   SYQLINASEGGVGYTWSSIALSKDFQAGTMPMPLVIADGRAPGEILVPANTTVFEFNPW
FT                   EFGSWDKSLSAFVSLEFLGSNFSKGTLATGEKCVRGFDNAGFIMGTSSSLFNQAFLQMN
FT                   NTDAPSVVKDAISAILGKIGSENNDIAVYKPNPFYRYASQSKYTSSPSLTLVDGGEDLQ
FT                   NIPLDPLLQPQRHVDVILAVDSSADTTTRWPNGTSLVATYERNVDSSQRNSSLPFPSVP
FT                   DQNTFVNLGLNNRPTFFGCNSSNATGAPLVVYIPNAPYIYPSNVSTFDLQYNTSERNAI
FT                   IENGYDVATLGNGTVDSNWPACLACAILSRSFERTNTTVPKTCSTCFKTYCWNGTINAT
FT                   TPGDYYPTLKLH"
FT   CDS_pept        join(complement(344534..344871),complement(343492..344478),
FT                   complement(343308..343439),complement(343014..343260))
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208746"
FT                   /orf_name="AFUA_5G01350"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86169.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00005205AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE08"
FT                   /transl_table=1
FT                   /translation="MDHPETSTLDSHSPKAFDDDHHGSHPLDSASDCLSDETVDHLEPL
FT                   ELTRINTYRLQQKTTVGSTRGPAPRETWLPMGAGKEYPPLLPDPETYVVEFDGAEDPLH
FT                   PYNWSMTRRIFLVCILCYGTFAGSFASAVFSAAIASSSKEFHISQEVGSLGVTLYVLGF
FT                   AAGPTIWAPASELIGRRWPLSLGLLGCGIFTVGCATGKDVQTLMICRFFAGLFAASPIS
FT                   VVPAVFADLFNNAQRGIVMSIFCMAVFIGPFAAPFVGGFITMSALGWRWTMYISAIMVL
FT                   LGFVLVVLFLDETYAPVILVRKAATLRRQTHNWGIHAKQDEVEVDFHELVRNNFTRPLK
FT                   MLFTEPILLLISLYISFIYGLIYALLGAYPVVFQRVYGMNMGEGGLAFVGLIIGELLGG
FT                   VFILFLQGSYIKKLAANGDVPVPEWRLPPAIVGGITFAAGMFWFGWTGYTSSIHWMVPI
FT                   SSGVLTGFGIFCIFLQCFNYIVDCYPTLAASTIAANTILRSAVGCAFPLFSRQMMENLG
FT                   VQWAGTMLGCIAAVMVPIPIAFMVYGPWLRSKSRSAGAPVYPETKKQYDV"
FT   CDS_pept        join(349312..349534,349664..350520,350574..350599,
FT                   350650..350734,350781..350944,350995..351157)
FT                   /codon_start=1
FT                   /gene_family="HOG000161708" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268455"
FT                   /orf_name="AFUA_5G01360"
FT                   /product="Cytochrome P450, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86168.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG055524"
FT                   /db_xref="HOGENOM:HBG327222"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000051F064"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE09"
FT                   /transl_table=1
FT                   /translation="MELFRLLLSHPVSSAVALGAVYLLWVVLDRLYLSPIAGFPGPKLA
FT                   ALTHLYEFYWDTICCGQFTFQIGRLHEKYGPIVRISPTELHINDPDYYEVLYSRDSPRN
FT                   KYEYYQKTLNAPLALLNTIDHHLHRQLRAQLNPFFSSTRIRRQEPAIKALVNKLCRRLD
FT                   ELKNTGQPLNIEHALTCYTTDVITDYSMGDGYHYLDAPDFIPQWHGTLNGTAKTMVFIR
FT                   PVAWALPLLLALPEAVTAWLNPGMELFFDFQRRCRKMIKRIVAAHNEKGNQGVQNEGFV
FT                   NIFDDILRSNLPAKNKSETRLAQEMQVLVSAGAETTAKAITYILFYLLNDPETMAKLKA
FT                   ELETVGEDPALVQLEQLPYLTGVMLEGIRLSYGVSARLPRIAPYNALKFRDWTIPPGVP
FT                   VSMSCLLMHHNETVFPDSHRFKPERWLDPAERKRLEKYMVAFSKGSRQCIGMHLAKAEI
FT                   LLAVSTLLRRMDLELYETTVEDVAIKHDIFIPFPRMDSKGVRVLIKG"
FT   CDS_pept        join(complement(351943..352115),complement(351293..351890))
FT                   /codon_start=1
FT                   /gene_family="HOG000262685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904165"
FT                   /orf_name="AFUA_5G01370"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="EAL86167.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG055523"
FT                   /db_xref="HOGENOM:HBG560543"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00005200EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE10"
FT                   /transl_table=1
FT                   /translation="MASDQSTTLDQLLVPSLLPRIYTFWFQHIPSNKRLLLPSQEDWMK
FT                   WFLKSDDFDSACTSQFSTILTAIRDTNTTAEDLLSRANPSTPQDWLALIILLDQLPRNI
FT                   YRGESSRIVFEFFDPLARTIALKAADAGFPSGTSPFRYRQGQRIWFYMPFIHAEDLDMQ
FT                   ELARIKYAEMAEDFTRLLDGDATGLSDDEAQCRQILLENRARLEEQLTTHFRVQREHYE
FT                   PIARFGRFPHRNVALGRETSDEERRFLEEGKIFG"
FT   CDS_pept        join(353268..353308,353350..353793,353841..353913)
FT                   /codon_start=1
FT                   /gene_family="HOG000161687" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752049"
FT                   /orf_name="AFUA_5G01380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86166.1"
FT                   /db_xref="HOGENOM:HBG055522"
FT                   /db_xref="HOGENOM:HBG328836"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="UniParc:UPI000051F06A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE11"
FT                   /transl_table=1
FT                   /translation="MAPSSHRFLFGGDQRWSLTYWTSSDDRVRGGSSYSTLTILPNNTV
FT                   QFHGHLDITTLGRAGFASQRTTDDISWDLSDADGLELDVAGSDGKVYTLVVKDRLLPTR
FT                   ADGREQSTISWEYDFQTVERAIVRVRWEDLRASYRGRKVDAEPLDLRNVKRISIMVRSF
FT                   FGRQEGDFLLDVASIAAFCGDR"
FT   CDS_pept        join(complement(358314..358566),complement(357733..358237),
FT                   complement(357449..357638),complement(357358..357382),
FT                   complement(357150..357299),complement(357030..357086),
FT                   complement(356749..356962),complement(356639..356685),
FT                   complement(355988..356574),complement(355874..355931),
FT                   complement(355486..355824),complement(355225..355395),
FT                   complement(354393..355177))
FT                   /codon_start=1
FT                   /gene_family="HOG000253037" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268456"
FT                   /orf_name="AFUA_5G01400"
FT                   /product="Class V chitinase, putative "
FT                   /EC_number="3.2.1.14"
FT                   /function="cation binding"
FT                   /function="chitin binding"
FT                   /function="chitinase activity"
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="EBA27257.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0008061"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018371"
FT                   /db_xref="UniParc:UPI0000F51CC2"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA09"
FT                   /transl_table=1
FT                   /translation="MRHLRPSFAFSFLIFPTFVLSDDIPCDSTHPCTEGCCSKLSNVCG
FT                   YGPDYCSSTNCIAAASTNGTCSQLAECDPGVYPGWGDKWGSQYAKSENCPLNVCCSEYG
FT                   FCGTTTGFCGDATVAEPVCDGTSATKKTIAYYEGWNSERACDTMPPENIPIGGYTHINF
FT                   AFLYIDPDLYTIKPMETSQQELYSRVTALKKRKNGLEVWISIGGWAFNDPGPTANTFSE
FT                   LAASKSKQSTFFESLLSFLDKYGFDGVDLDWEYPVDAERGGSDADYDNYPTFLANLRSA
FT                   LDSADKGYGLTITLPSSYWYLQHFDVVKMAKSVDWFNMMTYDLHGGWDADDPWIGSVVN
FT                   AHTNLTDIISAMNLLWRNDIHPSQVVMGLGFYGRSFTLNNTSCVTAGCPFSTVGKAGDC
FT                   TNSAGTLSFSKIEAILKDASRNATQTYDEASSVQIVTFDGNQWVSYDNWASFQAKLDYA
FT                   NSHCIGGTMVWAVSLDVDGTATDGLTGASVVFPGDDGSNGGSEDVYIGPDLWKNATKEI
FT                   SCKPPCTMILPPFPLVSPITIDWPAYQTTIASSSGGTTLTKTTTITVAPFTISEIPFWP
FT                   ITVAEPGRNAYLSPMQSIAPPTFGLTLPPTEATFPLFHTDYSATLTTTASTANATVPSV
FT                   STPAAVQSGIVSDCTEFYKAIAGDGCYAIATAHDITLAQFIAWNPAVNSDCSGLWVDEY
FT                   YCVAVAKATSTTSYTPIPVTFFGNSHVITVAPQPTATSIQPPGTSMPILTYSDGKTPSN
FT                   GGCSSGGETTGCGKIDCSLFGCGGECGFFGCDGGCGLGFCGGGCGLLGCGPGCGSGSCL
FT                   QEGGGGGSEEEETSTSESCSATATASVTIVCDYACPDGASTSCAILCTSLTISYALPLT
FT                   LLEASDEAMTSAAESVASWLNPKYTSLDPVMISGTTITASATAPAVTTSASITSATAIS
FT                   ASSCDIKSASSSSYCSCDGGYGVTLSTKANKSKTTFLVCDVTPALTISTIKPTTTSTKP
FT                   QSTSTTTSASGSTSTGFALYMSYWSASECPIGLTCEDDGKWNAVMVENLWSDEAAVPIK
FT                   GTWNQNGMVDGSQATFCDQTSTFTIDGDDIKGSSSVSKYGSYVCKKRAIPEENTGYDPE
FT                   NTVSYDIEGAWACLTDICT"
FT   CDS_pept        371862..373565
FT                   /codon_start=1
FT                   /gene_family="HOG000048462" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268457"
FT                   /orf_name="AFUA_5G01410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86163.1"
FT                   /db_xref="HOGENOM:HBG055519"
FT                   /db_xref="UniParc:UPI000051FC83"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE14"
FT                   /transl_table=1
FT                   /translation="MMASPVRVSSQLIIAAVFQDEDNGKIQLLPKDVTNEYIIKACSCF
FT                   LLYDQRTDAFDFSHRSAWKYLKTQFSAETCNLYLARLSLKILSKTQKCDKAIAQKPPFD
FT                   CIRPIVIHSAGFWFLYVRSLGNKAADDSQLQDLLREFLQPRGTQSGYGWWYKKCHQFGT
FT                   EIMQELDMHHRYAFSDVLSSPPSPWFLVGAFGLSSIIETLTKQPELDVNGVNEVDETGF
FT                   SLAIKHHHVRTTQALLHRRVHVRPRDFSKALQVGEDMNIVLSIWRSPHIQQQTLLSTDT
FT                   LIAAARNWHYRNQTLRGLLRHWPSTVPIQVNRELVMAFSFGYHFPSKLTDSYMRRLLEN
FT                   NRIIVDDEALPLIAADWSSVIMKTVLERRVPKLPTKKLLKLLFSAVRNTEAAEVMVSVL
FT                   LRHVQGDIPLAIWQRLLTRAAKNAGCGQSLVDFFLKDNRKIRVTEKDLIVASANEEPDQ
FT                   ALRIFNSLLKHSNRDKVTGALLQQVVKNLKYWSEREREELAQTIWKSKGFEYSKCADLA
FT                   WEMALESRNAIRLTPCNKEAMPVAMKIGKRRGRQTTSRTRWTAEASRLAN"
FT   CDS_pept        join(complement(374420..374613),complement(374199..374370),
FT                   complement(374007..374145),complement(373849..373961))
FT                   /codon_start=1
FT                   /gene_family="HOG000240322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268458"
FT                   /orf_name="AFUA_5G01420"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86162.1"
FT                   /db_xref="HOGENOM:HBG170630"
FT                   /db_xref="HOGENOM:HBG649658"
FT                   /db_xref="InterPro:IPR018532"
FT                   /db_xref="UniParc:UPI000051F552"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE15"
FT                   /transl_table=1
FT                   /translation="MTRLLLSVLLGIPLVAALPVALPTPPGIPSAATAESELAALTVAA
FT                   AGSNDGYSRDLFPHWISQGGSCNTREVVLARDGTDIVKDSSCYPTSGSWYSPYDGATWT
FT                   QASDVDIDHVVPLANAWRSGASKWTTAQRRAFANDLTNPQLIAVTDNVNQAKGDDGPEA
FT                   WKPPLTSYYCTYAKMWVRVKYVYDLTITSAEKNALVSMLDTC"
FT   CDS_pept        join(complement(375924..376001),complement(375630..375867),
FT                   complement(375182..375576))
FT                   /codon_start=1
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268459"
FT                   /orf_name="AFUA_5G01430"
FT                   /product="ThiJ/PfpI family protein "
FT                   /protein_id="EAL86161.1"
FT                   /db_xref="HOGENOM:HBG301781"
FT                   /db_xref="HOGENOM:HBG646910"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI000051F077"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE16"
FT                   /transl_table=1
FT                   /translation="MAPKILIVLTSQDKIPSNGHPTGWYLPELAHPWEVLHEKAELVIA
FT                   SPKGGEAPLDPASVKMFENDPVASKFLNEQKSLWTNTVKLSDVLPKVSEFDAIFYVGGH
FT                   GPMFDLVNDETSIALIEAFSAARKPIAAVCHGPTVLLKAKAPSGVPLLSACTVTGFSNT
FT                   EEDQAQMSSAMPFMLEDELQKVTGNRYVKADEPWGEKVVVSKAAGSGATVITGQNPASA
FT                   TGVGKEILRALGVA"
FT   CDS_pept        join(complement(377533..377687),complement(377376..377488),
FT                   complement(377164..377327),complement(376973..377113),
FT                   complement(376891..376926))
FT                   /codon_start=1
FT                   /gene_family="HOG000255884" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057439"
FT                   /orf_name="AFUA_5G01440"
FT                   /product="Allergen, putative"
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86160.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000051E4A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE17"
FT                   /transl_table=1
FT                   /translation="MTRLKAPRNPLAISITDRFILSPISLSSKTYSQDLKMALKPGDKF
FT                   PDNVVFQYILYAEESSDINACGIPINYNASKEWADKKVVLFSVPGAFTPTCSANHLPGY
FT                   IKSLPQLKEKGVQIVAVLASNDPYVMSAWGKANQVTGDDILFLSDPQARFSDSIGWATA
FT                   GRTGRYAIIIDHGKVTYAQIETEKGVVKVSGADAVLAHL"
FT   CDS_pept        complement(377840..379168)
FT                   /codon_start=1
FT                   /gene_family="HOG000116232" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208747"
FT                   /orf_name="AFUA_5G01450"
FT                   /product="NADH-dependent flavin oxidoreductase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86159.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG255608"
FT                   /db_xref="HOGENOM:HBG583461"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000052033B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE18"
FT                   /transl_table=1
FT                   /translation="MGSNAFRSPAVTKSSSTPYYTPANNGGAALHPDDPTTPTLFRPLQ
FT                   IRNVTLKNRIMVSPMCMYSCESDPSSPHVGALTNYHLAHLGHLALKGAGLVFIEATAVQ
FT                   PNGRISPNDSGLWQDGTTSEQFLGLKRVVEFMHAQGAKVGIQLAHAGRKASAVAPWLAA
FT                   QAGKSSLKADESVGGWPADVVGPSGGEEHIFSPEEDAYWVPRALSTAEVRQVVAAFAKS
FT                   ARLAVQAGVDVIEIHGAHGYLINEFLSPVTNKRTDAYGGSFENRTRIVREVAAAIRAVI
FT                   PEGMPLFLRISATEWLEGQPVAAESGSWDMQSSLELVKKLPEWGIDLVDVSSAANHKDQ
FT                   KINLHTAYQTDLAGQIRQAIRAAGASTLVGAVGLITDSEQARGLVQGADEATAAEAMLS
FT                   GPEPKADAILIARQFLREPEWVFSTARKLGVPVTVPVQFGRAI"
FT   CDS_pept        join(complement(380910..381009),complement(380315..380865),
FT                   complement(379479..380270))
FT                   /codon_start=1
FT                   /gene_family="HOG000161676" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752050"
FT                   /orf_name="AFUA_5G01460"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86158.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055517"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051E707"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE19"
FT                   /transl_table=1
FT                   /translation="MPAMEDCTTRTQTSYRRPRRRPAHLRTKTGCLTCRSRKKKCDESG
FT                   SPCQNCVQRKIECVWPGRRAGLLAHSGGSSVSAESASETECQVVRTQTPSMITLSNGPA
FT                   SYSSVLAPANSQLFHFLQTIFLPQLIHPVTTGAVNELVTRESLRWAFQSPFCMHALLAC
FT                   AAAEIPVNNPQYRRMAELHYIEAVAGLRQSLVPTADSSQWTVVLWTVLMLCIYERSKPH
FT                   HSQGVDVHLAGAAQLIQLYFQRKTPDASIIETGAWARVFLESFVFHVATSIPFQLTSTR
FT                   STTIDSAFALAKSILEVVCRPQISVDATSPVLGVPPKLFQYVYTIARMYERYPDSVDLR
FT                   QCKELEQDLRRWDTLMAVTATPELLTGPRLYVLCSRILLNRLLNLDNRTDDLVVSELVS
FT                   QAMVLVTQLQPALDYFAEYYSWPFLVLGTCAEKQSHRQILLSQIQGFWQATNNGTMKRL
FT                   ENMLTAHWTGGESTSKANLWLI"
FT   CDS_pept        complement(381384..383369)
FT                   /codon_start=1
FT                   /gene_family="HOG000250947" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268460"
FT                   /orf_name="AFUA_5G01470"
FT                   /product="Peroxisomal copper amine oxidase "
FT                   /EC_number="1.4.3.6"
FT                   /function="copper ion binding"
FT                   /function="primary amine oxidase activity"
FT                   /function="quinone binding"
FT                   /biological_process="amine metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86157.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008131"
FT                   /db_xref="GO:0009308"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG061830"
FT                   /db_xref="HOGENOM:HBG325455"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR015802"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="UniParc:UPI000051F2B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE20"
FT                   /transl_table=1
FT                   /translation="MADPLSADEITTAATLLRQRAHPTALKFNCITLHEPLKAELNAFL
FT                   SGTGPRPARRAFSIILKTGTPEVSEAIVNLTAKKVESWKNVKNVMPTLTLDDLNIIEHI
FT                   ASKDSRIIEACREIGITDMSRVYYDAWAIGIDERWGFERRLQQALPYYRSSQHDNQYAH
FT                   PLDFTVVADTETQEILSVDVRRVNGERTPVPLDEHNYLPQFIKDQYRPERLKAIEITQP
FT                   EGVSFKMNGNEIEWAGLKMHIGFNYREGIVLSNVRIDDPYENRERKLFHRVSVVEMVVP
FT                   YGCPKPPHHKKHAFDVGEYGSGSMTNSLKLGCDCKGAIQYLDAVLATSTGEATVIENAI
FT                   CIHEEDNGLLYKHTDFRDGNVISARDRKLIISQIITAANYEYAFYHTFTLDGTYKLEVK
FT                   LTGMLNTYCLHPSEQAAPFGTEIARGLDAQNHQHIFSLRVDPEIDGPGNTVVQSDAVPM
FT                   ADPVGSPANPYGNGFYAKKTPLRTALQGASDYCHETSRGWDIINPSRLNPSTRKPIAYK
FT                   ILNNNCPRLLAKPGSTVYKRAGFARHALWVLPYRDHEIFPAGQYVCQSTGEENHPHNPT
FT                   IVDWAARNESIENTDIVCYIQFGLTHFPRTEDFPIMPAEPVSVMLRASNFFQKNPALWV
FT                   PPSDMVKDVSSRNAVEARELMETPRL"
FT   CDS_pept        383966..385567
FT                   /codon_start=1
FT                   /gene_family="HOG000064644" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268461"
FT                   /orf_name="AFUA_5G01480"
FT                   /product="Amidohydrolase family protein "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="EAL86156.1"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG442147"
FT                   /db_xref="HOGENOM:HBG670532"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniParc:UPI000051EDDF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE21"
FT                   /transl_table=1
FT                   /translation="MKTIFTNGRIFAPSSNDLNADNAFAESMVIEDDHIVNVGVQDKAP
FT                   SGDYTIDLNRRIVVPGFIDGHVHILNFGLSLGKLDLMDCTCLEDIQAAIRSFAASHPTA
FT                   PRLLCRAWIQSTTSGVALASMLDDLDPRPIHIESLDLHSVWCNSAALEEMGISSTRDPP
FT                   GGTIHRDETGRPSGLLSESAVIDIVWPFLASITTQEEKLEALGRAFTAYTQAGYTGLVD
FT                   MAMDETTWDVLQLYRQRHDPPLHIAAYWLVPFSQNEETNFSHVDRAIQLHAEFHPTKSP
FT                   NFCIMGIKLICDGVVDGCTAALSQPYGSLTDPVEPIWPAEMLKAVVQRADQAGLQCAIH
FT                   AIGDKAVTQAIDVLAEVGTPGRRHRIEHLELAAPEDARRLGELGIIASVQPVHSDPVLF
FT                   RAWPELIGERCQRAFAYSEFVDGGARLAMGTDAPTAAHLPLPNLYNATTRRSALEPGEP
FT                   AATNPRFGLGLAEAVTAATEGAAYARFAEGWTGCLREGRSADFVVLDMQWEAEELLEGK
FT                   VCETWFGGKRVYSVER"
FT   CDS_pept        join(complement(388082..388165),complement(387550..387813),
FT                   complement(386888..387118))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057440"
FT                   /orf_name="AFUA_5G01490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86155.1"
FT                   /db_xref="HOGENOM:HBG055516"
FT                   /db_xref="UniParc:UPI000051E929"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE22"
FT                   /transl_table=1
FT                   /translation="MPHFCLVASTSMLSASYDVSQDLSSALYTSSSTYKYESASARIDC
FT                   LSTTCTQVLKTLEIEHKLSMKVFATLFLLAASATAALAAVPAPNAGCSQPGQYCNGGTF
FT                   LCCNNRQCNNNVRVPYSVPGYARNPSYAFSRHHGRNGSSQLSMSIWDALEELLVSGGDW
FT                   VSYNQWAKYEAGARVVGTIHERRGMNEID"
FT   CDS_pept        join(388348..389238,389285..389425)
FT                   /codon_start=1
FT                   /gene_family="HOG000265278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904166"
FT                   /orf_name="AFUA_5G01500"
FT                   /product="Homocysteine S-methyltransferase, putative "
FT                   /EC_number="2.1.1.10"
FT                   /function="homocysteine S-methyltransferase activity "
FT                   /protein_id="EAL86154.1"
FT                   /db_xref="GO:0008898"
FT                   /db_xref="HOGENOM:HBG166538"
FT                   /db_xref="HOGENOM:HBG328248"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="UniParc:UPI000051EDDE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE23"
FT                   /transl_table=1
FT                   /translation="MTSIQILDGGLGTSLQDQHGVTFDSSTPLWSSHLLVSDPTTLLAC
FT                   QRNFITAGCDVLLTATYQVSIEGFARTKTPEFPDGIPRPAIGKYLRTALAVAEQARVSP
FT                   SAAKIALSLGPYGACMIPGQEYSGKYDAEHDSEETLFQWHLERLRLFLEADEKLAERVQ
FT                   YVAFETLPRLDEIRAVRRAIRTAGLNVPFWVACVFPGEEATLPDGSSIGQIVQAALAEM
FT                   DGAAVPWGVGINCTKIHKLDGLVREFGEEVASAVGQGQVGAVPSLVLYPDGTNGEVYNT
FT                   TTQTWEKQEGYTSDARGPWEVQLAQIVTNARATGPFTSFLVGGCCKASHRDIRKLAEQL
FT                   KNE"
FT   CDS_pept        join(complement(390056..391289),complement(389543..390009))
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268462"
FT                   /orf_name="AFUA_5G01510"
FT                   /product="Amino acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86153.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051EDDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE24"
FT                   /transl_table=1
FT                   /translation="MWGNTAYRREMISHTGPSLEKSDSKIESHPSRPYGEDVAPYPKED
FT                   ALQLNVGGRGATQRRLKNYQVTMIGFCGGIGTGLFVGTGAAYAKAGPAGLLLAYAVVGL
FT                   VLWCVMQSIAELATLLPTAGSFPHWATRFIDPSVGFSLAISYGYCYTIAIASEVSAAAV
FT                   IVSYWTDITPAVVITVGLVLILAINLMNVRFYGETEVLAGSIKILCFIGLVIVSIVITS
FT                   GGGPNHEAIGFRYWHNPGAWTNYNGITGSTGHFLGFLSAFVNASFSFIGVETVVITAAE
FT                   SVDPHRAIPKAAQRVTYRIAFFYILGAFLIGMIVDPRNADLVSGSGNANSSPWVIAIRQ
FT                   AGINALPSIVNACILISAWSAGNSYCWVGSRMIVAMTTDHQLPQVFGKVTKKGVPYVAV
FT                   IAAWLFGPLAYLSLGSGGAAQAFSWLLNLSTVAGLIAWATLSFCYIRFYAALKAQGIHR
FT                   DTLPWKGPLQPYAAWVGFIGSTIITLVAGFPVFLKGNWNTSDFVASYIGIPIFIVPIIG
FT                   WKFWHRTKVRPRSLYVGKEANGCSLLARPLLTYGLAVSRRERLLRNTGR"
FT   CDS_pept        join(complement(393609..394016),complement(392241..393551))
FT                   /codon_start=1
FT                   /gene_family="HOG000167003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057441"
FT                   /orf_name="AFUA_5G01520"
FT                   /product="MFS transporter, putative "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86152.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG058554"
FT                   /db_xref="HOGENOM:HBG738000"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EB88"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE25"
FT                   /transl_table=1
FT                   /translation="MNEKCGLPGNQGDSAAEHPGNCTRAEPDEGRQKKLEDEIGTTIKV
FT                   AAERQERTAENPHLVPETVKVTGEHASAAAATGPPYCILSERKKIFVILLVSFAAIISP
FT                   ISSSIYFPALNSLAKDLNVSVSLINITITTYLIFQGIAPSFIANFADTHGRRPAYLICF
FT                   TIYLAANIGLAVQDSYASLLVLRCLQSSGSSGTIALGSAVVADLSTRAERGKYIGYASL
FT                   GVTLGPALGPIIGGLLDHYLGWRAVFWFLVILSSVLGTVIAIILPETCRAVVGNGSVPA
FT                   AKWNRPAWQILRQNRRAQRQTPTPDYHTIEKRRRRANPIASALIATDKEALIILIYGSL
FT                   LFSGYMAVLSTLTSQLQSRFHFNSIQVGLCYLPIGIGSLSSRWTVGRILDWNFRREARR
FT                   QGLAIEKNRQQDIRHFNIEAARLAVTIPLVYCACLCIVAYGWVMEFKTALAGPVVMLFF
FT                   MGHLTSGAFSSLSTLIVDLNRQSPATAVAANNLFRCLLGAGVVAAADPVIQHIGIGWTA
FT                   TLIAFLWVLLSPLMWAVSRWGHGWREKRISNEKEASPAEELSRPVGEVPTAKEGV"
FT   CDS_pept        join(complement(396100..396105),complement(395738..396029),
FT                   complement(395174..395688))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268463"
FT                   /orf_name="AFUA_5G01530"
FT                   /product="Short chain dehydrogenase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86151.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG055515"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51C7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE26"
FT                   /transl_table=1
FT                   /translation="MELNTVASKIVLITGANTGIGFQVVCALCNSTQTYSIIVGGRSPA
FT                   KVHSAIRAIQSEFTNCQSQLYPLQIDLESDDSIKHASEDISTKFGRLGALVNNAGAWFD
FT                   AQANATMTERQMWAKTWDVNVTGTHLLTSALMPLLLKSPDPRLLFVTSGAARLAGTDDL
FT                   RLPINRSPPAGWPEPAGITATAYRSSKTGLSMFLREWGRMLRNDGVKIWGIAPGYLATG
FT                   LGGGTAEEMKKNGAEDADVAGPFIRSVLEGDRDTEVGRVIRREGVQER"
FT   CDS_pept        join(396854..397087,397142..397402,397448..397783,
FT                   397836..398016,398065..398747)
FT                   /codon_start=1
FT                   /gene_family="HOG000239129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752051"
FT                   /orf_name="AFUA_5G01540"
FT                   /product="MFS aflatoxin efflux pump, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86150.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG032742"
FT                   /db_xref="HOGENOM:HBG330720"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000520813"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE27"
FT                   /transl_table=1
FT                   /translation="MTESESLGSPEKGDPTANLSDINNTQRSETGDDEEIKRAKSDQDD
FT                   AYQEQSTTKVVLLLVSIMMTMFLVALDRTIISTAIPQITNEFDSLSDVGWYGSAYLLTC
FT                   CAFQLLFGKIYTFYPVKAVMLSSILLFEVGSAVCGAAPNSTAFIVGRALAGIAAAGIFA
FT                   GSVVCIVYAVPLEKRPKIQGLFGAVFGLASIVGPLVGGAFTSHVTWRWCFYINLPCGGL
FT                   AMAAIPFCLKVPDRNTTKVTWTEKLKQLDVPGMCCLVPGVVCLVLALQWGGQKYDWNNS
FT                   RIIVLLTLMGVLLLGFVAVQILLTRTATIPLRIFSRRSIFAGVWATICIGASQYVFIYF
FT                   LPIWFQSIKGVSAVDSGLRLLPLMLSMVAASILSGVTTQKVGYYTPLAIIGSCIMAIGA
FT                   GLLTTLQIHTGHGKWIGYQILYGFGMGMCFQQPNLAAQTVLPTKDVPVGIAVMFFSQLL
FT                   GAAAFVPVGENVLANQLMMRLSGIPGIDSDIVTSGGATSLLSLVPSDLRGTVLTAYNEA
FT                   LRKVFQIGLIVACLTILGTASFEWVSIRKKSEASSGVGNGHAPEEEQ"
FT   CDS_pept        join(399917..400314,400489..400957,401014..402216)
FT                   /codon_start=1
FT                   /gene_family="HOG000181301" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904167"
FT                   /orf_name="AFUA_5G01550"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86149.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055513"
FT                   /db_xref="HOGENOM:HBG324458"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051E4A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE28"
FT                   /transl_table=1
FT                   /translation="MSTPEQSSPRSPLRAAQRPTRVLACVLCQQRKVKCDRQFPCATCV
FT                   RAQMQCVPATQARRRRRVPERELLDRIRRYEDLLRQNNIQFQPLHNSVAEQASSSRENR
FT                   SFDTDHDEKSERDSQQEETPGTETKYEANTEHDKARFGPREAVFRKTWEEHYDGGSQTL
FT                   LFGARKFDVNVSTLHPSQVEIFRLWQIYLDNVNPLLKVTHTPTLQARIIDAAADVGNIP
FT                   PTLEALMFSIYCLAILSLSEEECRTLFQSSRDDLLNGYQFACQQALLNCEVLRTSDRDC
FT                   LAALYLYLISVRPQTDPRSLSPILSVAIRIALRMGIHSESSYSRCTILEGEMRRRLWWS
FT                   LVLFDNRICEMADYKASNLLPTWDCKIPLNVNDFDLQPEMKTGPTMHGNPSEALFAVVR
FT                   SEVGNFTRRSSFHLDFTNPALKTVAKENPLPAAGSLPAFERMIEEKYFASCNPENPLHF
FT                   MTIWTTRGQLAKNRLLDHYAKYSSVPQTETQRDAVVSHALRMLECDTKLMNSPLTKGYQ
FT                   WFLLLLFPLPAYIHLAHDLRRRPTAGHAERSWAALNDNYAARLGAMKTMNPFFEHLARM
FT                   LLQAWKARETALKDQDQPLEPPYIVSDVRSKLGQGPSRQAGNTEHSTSESTANMNDSSM
FT                   STFVDIGGYGAPHGLEGPGFFDTGSPNTHPPMDLDLDQPFWTSVGWYSLQGRGW"
FT   CDS_pept        complement(402386..402604)
FT                   /codon_start=1
FT                   /gene_family="HOG000048467" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268464"
FT                   /orf_name="AFUA_5G01560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86148.1"
FT                   /db_xref="HOGENOM:HBG055512"
FT                   /db_xref="UniParc:UPI000051E713"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE29"
FT                   /transl_table=1
FT                   /translation="MRFRSRAIDQFREPTQPQHLTYCDHGGPLNGVTAAITCLILVKWR
FT                   RDRKLVMPVRSKYRISRPCLQPAARGS"
FT   CDS_pept        complement(402779..403792)
FT                   /codon_start=1
FT                   /gene_family="HOG000161654" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268465"
FT                   /orf_name="AFUA_5G01570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86147.1"
FT                   /db_xref="HOGENOM:HBG055511"
FT                   /db_xref="UniParc:UPI000051E928"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE30"
FT                   /transl_table=1
FT                   /translation="MPSISDRLTVIITTSPAPSNPATDLIASVLQSFQQHCAGLTDARV
FT                   VVVFDTFARVTSQPRLKKGHASPELAESYALYKRNIKALILQTYRHEQDGQGQAASEKS
FT                   HAEAEFGFDGRVELLITRTRSRKITFIEPVARLGFGLAVRSALRVVETPYVWVQQHDWA
FT                   LEADIPLEPLLEIMQGSEADDAVPVKYVSFPSVRMKRYAVSPHVTDHAALRELTTSLKR
FT                   DFVVRSPSRPERKIALTPLFFWFDKPHVASTAHYLARVFPTPLAMRRGEFIEDKIGQRA
FT                   RAQMKEGQWAKWATWLYYPDEGDLLCLRHLMGRTWRGFGGPINVKDGFHIATDDES"
FT   CDS_pept        join(complement(405484..406072),complement(404985..405433))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208748"
FT                   /orf_name="AFUA_5G01580"
FT                   /product="Oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /EC_number="1.1.1.100"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] reductase
FT                   activity"
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86146.1"
FT                   /db_xref="GO:0004316"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG055510"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EB87"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE31"
FT                   /transl_table=1
FT                   /translation="MRYFHGCVPCQGRVLGAPHTGDDVNSGQGAELISSRLGLHSQSPP
FT                   GTHTPIFTMVKPIAIIAGAGPGTGSAVARRFARAYPVVLLARSQSLDALVQDIQGRGGS
FT                   AIGIPTDVTSASSMTSTIDQIKANFGADVRVAAAIYNVASKFTRKPFLEQSSEDFVGSL
FT                   APSIRGAFHFAQATLPLMLGADQTPYPPTLIFTGATASLKGGSGLSGFAMSKFAIRALS
FT                   QSLAREFGPQGVHVSHAIIDGIIDTEKTKEYSREVPDSKIDPQWVSGQRTSHKSPILIP
FT                   DFRLRNHTGSYTPSPGHRSRMNWTFGHTRKRGKAIAAVFMVDGLCPCSGYRTGPQSQVP
FT                   SPYEQ"
FT   CDS_pept        join(407927..408171,408347..409361,409484..409582)
FT                   /codon_start=1
FT                   /gene_family="HOG000216962" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057442"
FT                   /orf_name="AFUA_5G01590"
FT                   /product="Geranylgeranyl pyrophosphate synthase, putative "
FT                   /EC_number="2.5.1.-"
FT                   /function="transferase activity"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="EAL86145.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG055509"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI000051F057"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE32"
FT                   /transl_table=1
FT                   /translation="MAASALRASLGVGTVSSMHGLKGNAFMSRHLTAFMTKYGAAGKAL
FT                   MARCLDNWVQPQESRVETEPVNFEDSVARRVVTVGTSWEVERNRDPRGQNTVKTVMDSE
FT                   GKSEQQAKEKLRVAILEDERKYKLLMKQFALSTLDAPAHVQRFLVMLEVLLGGHHIWSA
FT                   ACGRYKRRAPSVGNPFLRRESIIPNRVEDANERAASPVALGNSALLDPVHYIQSLPSKN
FT                   MRTKLVDALNLWFQLPHHLVDTVKGTVDDLHNSTLILDDIQDSSYLRRGFAATHHVFGS
FT                   AQCINSATYLLVQAASRLSVHNEQYPAVITVFLDGLKELALGQSWDLNWRSTGYCPSTE
FT                   EYMAMVDGKTGVMFDMIVRMMHCFSSSQTVPVSELSQLTQLLGRWYQVRDDYQNLQDAQ
FT                   YTAQKGFCEDLDEGKLSYPLTRCTPADVGAPAEIQKADRCRPFQPGGHDRSAE"
FT   CDS_pept        join(409993..410288,410339..411503)
FT                   /codon_start=1
FT                   /gene_family="HOG000216961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752052"
FT                   /orf_name="AFUA_5G01600"
FT                   /product="PHP domain protein"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL86144.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG055508"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniParc:UPI000051E6FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE33"
FT                   /transl_table=1
FT                   /translation="MKHICSIAWLVPLLELAIAARAPIKKTLTGHIDPSQVFSFVYVPF
FT                   EVEVGTTSIYVVQNYSNKGRGNALDLGVFDQRGYQMMDAQSGTTGSRGWSGGFRNNFTI
FT                   TPTWATPGYNPGAIEPGIWNVVLGPYESVPDGIDWQLDIEMSFDPVDSWFAPDYATTDL
FT                   DPLCNDCQEDSAFIWLRGDFHMHTVYSDGKYTPDQQIHNALAQNLSFIFFSDHNTDTSN
FT                   QIIGAYQASLAPDLLVGRAIEVTTRSGHWQAVGLDRGQIIEWRYKPDDNPGFAAAAHQV
FT                   HRVGGFVSANHPFATCPACNWSLGWEETDAVEVWNAQWDEKDQQAVQKWQELLVDGKFL
FT                   TAIGGSDSHSPPSLNGWPTTIVKARGRSQAAIVEGVKAGRAYLVQGPGMDLTFEVRVPS
FT                   LDAPAQIGDKVRRTAAGAKAVLVTDGMSKLKACFVSDKGYFYNTTIEDGVRVKTGVLSG
FT                   ARFVRVEVRNGTTDEVLALTSPVWFLGP"
FT   CDS_pept        complement(411933..412139)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268466"
FT                   /orf_name="AFUA_5G01610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86143.1"
FT                   /db_xref="HOGENOM:HBG055507"
FT                   /db_xref="UniParc:UPI000051F063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE34"
FT                   /transl_table=1
FT                   /translation="MLLGPSNRLPGYLSWKLEEDSLSSVSQVQESGMIIIGSVSSSLDD
FT                   YDLVRRTEPNSLGGCQDRAISPS"
FT   CDS_pept        412960..413808
FT                   /codon_start=1
FT                   /gene_family="HOG000216960" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208749"
FT                   /orf_name="AFUA_5G01620"
FT                   /product="Extracellular proline-rich protein "
FT                   /protein_id="EAL86142.1"
FT                   /db_xref="HOGENOM:HBG055506"
FT                   /db_xref="UniParc:UPI000051E4A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE35"
FT                   /transl_table=1
FT                   /translation="MILHSLLLVSALAGSSLAFSGHHSFTNSTTPSHHPSTHTLLPTGG
FT                   GGGKPTHTGGTGTGTGHPQPTTTVVPGGDSGSVSTVTETITKTTFKPCSTPIHTQSGTT
FT                   YYSTWLTTSTYETTTCYTTHIPTTIPASPQTTTVTLPGPGNSCPPPSTVTVTVTVSSGG
FT                   DTGPHTQAPAPGGDSGSGPNPGTGTGTGSGPCKHCETITYTNTYGYTTTIVIPPISEPT
FT                   SSATTRTTGTGTTTTKPTPPVGTGTAPGHSHTRGSPTGTGVGQAPTETKTWHFERRIVR
FT                   V"
FT   CDS_pept        join(414816..415207,415296..416417,416497..416800)
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268467"
FT                   /orf_name="AFUA_5G01630"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86141.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000520109"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE36"
FT                   /transl_table=1
FT                   /translation="MNAADHEIERAEEDAIPVSSRTSLDSSLSSSSDGSQPRLRTMYSR
FT                   RTETDLERYQTSSQVIDRIETQRLQHALTVGESIKTQSRASARGPLPAFGAGKPYPPQL
FT                   PNREDYVVEFDGEDDPLYPQNWSTRRKLCTGAILAFTSICSTFDSAVFSSSTGNVARVF
FT                   GVGVEVATLSSSLYILGYACGPLIWAPFSELQGRRLPILIGMLGFGIFNIAVAVAKDLQ
FT                   TLLICRFFCGVFGSCPLAVVAAIFSDIFDNRSRGIAIAMFSSMVFLGPLIAPFIGGFIN
FT                   MSSLGWRWTAYLPAIMGFAALILNFFFLKESYPPVILIYKAAELRRRTKNWGIHAKQEE
FT                   IEIDLQELLVNNFSRPLRLLVHEPLILAVTLYLSFIYGLLYCFLTAYGLVYQGVYHMNA
FT                   GVGGLPLFGMVVGLFIGGAYICLFASRAYNQKLQANAGVPVPEWRLPPVIVGGALFAAG
FT                   IFWFGWTGFTADVPWIASTLSGLFTGFGLLIVFIQLFNYLIDTYLMFAASAIAANTFCR
FT                   SVLAASFPLFSRQMFNNMGIQWAATLLGCVATALVPIPVIFYLYGKRLRMRSRFAPILE
FT                   LDEAAHVPREMTENKGEEEANTQTEESQS"
FT   CDS_pept        417589..418617
FT                   /codon_start=1
FT                   /gene_family="HOG000161610" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752053"
FT                   /orf_name="AFUA_5G01640"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL86140.1"
FT                   /db_xref="HOGENOM:HBG055505"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051E944"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE37"
FT                   /transl_table=1
FT                   /translation="MANERARRRSLPELPAEILQHSLSFLDDDELRRIAREVRDLASHA
FT                   KEVIKLRFVKENTYTLPDEAAVLKRYGGRLPHNVLPTNHLRHPCEVPFIRAPDAIAGII
FT                   RTNNLEILKVLVEAGLDLMSFSLNGWRLLGLALAWDNNAIAEYLIAQMKPEDLLYGVCR
FT                   VGRRNEAPNFLTLAAYHSADMFRRGWQRVRHLPNWQAQVTDEAQYQLCRHADALLAWGL
FT                   AEDGVDIAVCILPFLGRNAWHAAAESNNNIDFFEYLYGRIPEAINNGSADNGRTALMIA
FT                   AAEQWHDRTHAIRWMLRHGADPRMEVGGRTAAWFASAAHNFQLAGLLSSAASSPYSASL
FT                   RG"
FT   CDS_pept        join(420067..420143,420205..420494,420542..420861)
FT                   /codon_start=1
FT                   /gene_family="HOG000161599" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268468"
FT                   /orf_name="AFUA_5G01650"
FT                   /product="BZIP transcription factor JlbA/IDI-4 "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="EAL86139.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG055504"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI000051E938"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE38"
FT                   /transl_table=1
FT                   /translation="MSVTAIFVQVARQTGPVFFQPQQRAYPTPAFCSPHFVFPDTTLDL
FT                   ASFAPDPSVSDTDPSAFVPLPPDLASFGDLDHASLPTGTSSSPYVPDSFDVTAISTPAV
FT                   DVNDSLPCLDIDSSGTDSDTQIDPGQIHTLTPPLLMPASRPQRVSISAASTAKDNPPKE
FT                   TPNRVLKRQLNTLAARRYRQRRVDRMNELEAELEKVKRERDELKMRVSKLEGETEALRG
FT                   LLKKDK"
FT   CDS_pept        join(421501..421603,421712..422271,422322..422485,
FT                   422531..422707,422762..423097,423159..423816)
FT                   /codon_start=1
FT                   /gene_family="HOG000161587" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268469"
FT                   /orf_name="AFUA_5G01662"
FT                   /product="Pathway-specific regulatory protein "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86137.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055502"
FT                   /db_xref="HOGENOM:HBG324953"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000F51C82"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE40"
FT                   /transl_table=1
FT                   /translation="MSGNNSNHHNTESHTLIENEADEQSKNDGITSKADAPMDTTQNDE
FT                   EDVDDVATKLVMEDASHDWDLLRDLLNAMRLVDDAHVQALLGMVRADCAIEEVKLFVEK
FT                   TLKDVQDAGRGGETVKRLQDMRMRVRIESGDPPFRPQVMDIHYLCDVAPYRVPARPWTT
FT                   VTDDDTLVSHLISLYFTWDYPFYAFVDLRAFVQHMQARNTHSDLCSPFLVNAMLANACH
FT                   YSQYSEAYAIPGDVKTKGCDFLAEAERHMHSYQLERGRSVRLASLQATLLLYERYSMSG
FT                   DDDLGYTMLHRAIDMAESLGIINGPVLDLDKLQMSEEMRSSIQRTAWGLFQVDTVVHTN
FT                   FRKPSKIHRVCVKRIDRDESQPSEQWAPYPTGRAPRPSFLSQYFDEACRLSFIARDVSH
FT                   HLYQDPKPDATHHEQKRELYDRLQEWEAQLPGFFDPAGKPLAHILSLRMRYHAIMISLA
FT                   RDGFGVHTFFSAEDGKSQTTVPPSSQLPAHLREKATEQSLASARAIAALVRVHREEYGI
FT                   GRTHPFTTYAIMVALFTILDHAAFDILDTDFLSLTSAFSVIACRSQVGRNLFHIFRQSV
FT                   RAQDQEGRVLQSDQVPEEIKELFGRYPRSSKPDKWDDYEDGLDKLGTAEGRDVAAADGM
FT                   RMRNHAASGVKDMLSKYESLSLGQQSQDRK"
FT   CDS_pept        join(complement(425699..425737),complement(425337..425586),
FT                   complement(424861..425284),complement(423967..424801))
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268470"
FT                   /orf_name="AFUA_5G01680"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86136.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG328895"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FA2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE41"
FT                   /transl_table=1
FT                   /translation="MAWQFSLQNKITASDRQRRQDEMAEPDHKVSLQKPSKDAPEDIGQ
FT                   GIDIDINIDIDLANVVLDPQKERKLLLKLDLAFVPIIMVTYLSCFLDRTNIGNVKVAGM
FT                   PEAIGASPSEFSTAVSIFYVTYVLLEAPWAVLMKKLTPRNILTGLCIVWSVTTVFTGFV
FT                   TNVPALYATRLILGACEAGLFPCLNLYLTMVYRREEQAKRVSYLMSCAAISGAFGGLLA
FT                   YGLLHMDGIGGKAGWRWVYIIEGLFSLICAVLIWFGLPNDPSNAYFLTADEKHMMRVRN
FT                   AQRAAYMGSSQFSWAEMRIAITDPKLAFSAITQFCQDILLYGFSTFLPTILKGIGYDSL
FT                   MSNILTVPVYFWAAIVFVSVAWAADRYSRFALFLLVTNVFGLVGYILLLAVSNDAVKYF
FT                   ATYLIGIATYTGVGLNIAWLNVNVAPHYRRALEIGVQQTIGNLAGIVSGQIYRTSPYVL
FT                   GNSFSLGALVVAQGVVLGHAVYLRRENHLKVKIGAGEKEDTRRVRTGDKALDFVYHY"
FT   CDS_pept        join(426111..426851,426914..427078)
FT                   /codon_start=1
FT                   /gene_family="HOG000136024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904168"
FT                   /orf_name="AFUA_5G01690"
FT                   /product="DUF1445 domain protein"
FT                   /protein_id="EAL86135.1"
FT                   /db_xref="HOGENOM:HBG000951"
FT                   /db_xref="HOGENOM:HBG289473"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="UniParc:UPI000051EB9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE42"
FT                   /transl_table=1
FT                   /translation="MASSSSSSHMTSSNTSNTSNNQSNAYTTRLLARQNLITNTSGLSP
FT                   GFLQANLLILPSRYAPDFHALCLRNPVPCPLLGIIPQGNPHTVSPAACITNPDFDLRTD
FT                   FPQYRVYQSGRHIASRKDLKEVYTPDHVGFLLGCSFSFEDALCEAGLPPRHQLTGRLVA
FT                   MYRTTVPLMPAGVFSDACMVVSMRPYLLADVEQVRQVTRPYGATHGEPVAWGWDGAERL
FT                   GIKDIKTPDWGEAPVFEEGEVPVFWACGVTPQLAVEMAGEKIEGLVFAHEPGNMLVTDW
FT                   TAGDLEALRDKSGIALPVEL"
FT   CDS_pept        join(complement(429230..429333),complement(429050..429172),
FT                   complement(428349..428991),complement(427157..428275))
FT                   /codon_start=1
FT                   /gene_family="HOG000161576" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268471"
FT                   /orf_name="AFUA_5G01700"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="protein kinase regulator activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="EAL86134.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG055501"
FT                   /db_xref="HOGENOM:HBG324365"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051F2E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE43"
FT                   /transl_table=1
FT                   /translation="MDHTQTPLVPDSWPNARDEDARPRKRRLKYITKACNECKRRKIKC
FT                   NGQSPCQRCGRQQIECVYAGRTRPPDSSDQQDMSRLMEQMAAMQEQISALSAAVYALAR
FT                   PGNSPQDQGRVFRRASSAKELTFQGPTTSAFSFGLAKSSLQRRGIVDGDGDDAGEEGEE
FT                   GDVTLPPTRDGTPVGMLKDPLWTISKAEAIRLCRVYEEEMGIMYPVLELEELLQQVEGL
FT                   YGLSPRLPLRPGDDNVHILRLVFACALTAEASGRSELAMRLFESVRDVADDCVWGPPDI
FT                   DRIILLTLVAIFYFQMDEETLAWRTIGIVERMCLEKGLHRRETLNHPTVVAAGRDRVLR
FT                   LFWSIYTLDMRWSFGTGMPFSLEDSDIDPWLPEPEEKTPYLRVMIRYSRIAAKVWKFIS
FT                   AFNNTGELKKDEMNYLDWQVLQWAAAIPASLRLGADSSTEPRSLRRLRSLLYLRANQLR
FT                   MLIHRPVLHSAGHLVRYPAECQTAVDLAKDTIRFITRLNETSDIYQLQQVAFNWFLVSA
FT                   LAVLFLAVVQAPSQFSSRCKEEFYMALELVKGFSTQSYISRRLWKSIKSLRKLGPQVGL
FT                   RQSATDPRVRAAHQTVDMAPTSNPSQTPQDGAQMTQELMEWFEAVGTLETQIMGVTQVF
FT                   DDGSGRMANGYMYDYGGDLSNVMRDLF"
FT   CDS_pept        join(complement(431304..431519),complement(430597..431230),
FT                   complement(430212..430534),complement(429669..430043))
FT                   /codon_start=1
FT                   /gene_family="HOG000161565" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268472"
FT                   /orf_name="AFUA_5G01710"
FT                   /product="Cytochrome P450 phenylacetate 2-hydroxylase,
FT                   putative"
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86133.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051777"
FT                   /db_xref="HOGENOM:HBG396996"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI000051F7B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE44"
FT                   /transl_table=1
FT                   /translation="MAQTIVLAVLAAVYLLIRYLNRTDIPKIKGLPEIPGVPIFGNLLQ
FT                   LGDRHATVAARWAKKYGPVFQVRMGNKRIVFANSFESVKQLWIKDQSALISRPTFHTFH
FT                   SVVSSSQGFTIGTSPWDESCKRRRKAAATALNRPAVQSYMPIIDLESTASIKELLKDCR
FT                   NGAVDINPTAYFQRFALNTSLTLNYGFRIEGNVDDALLREIVDVERGVSNFRSTSNNWQ
FT                   DYIPLLRIFPKTNREAEEFRVRRDKYLTFLLDMLKERIAKGTDKPCITGNILKDPEAKL
FT                   NEAEVKSICLTMVSAGLDTVPGNLIMGIAYLASEAGQRIQQKAYEEILKVYPNGDAWEK
FT                   CLVEEKVPYITALVKETLRFWTVIPICLPRESTKDIVYNGATIPAGTTFFMNAYAADYD
FT                   DEHFKMPDKFIPERYLDVSEGSGTPHYGYGAGSRMCAGSHLANRELYTAYIRLITAFTM
FT                   HPARDPADQPILDAIECNAIPTALTTEPKPFKVGFKPRDASKLQQWIAESDERTKEL"
FT   CDS_pept        432838..433071
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268473"
FT                   /orf_name="AFUA_5G01720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86132.1"
FT                   /db_xref="HOGENOM:HBG055500"
FT                   /db_xref="UniParc:UPI000051FC8D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE45"
FT                   /transl_table=1
FT                   /translation="MRIHPVPVPLRILIHVPSTKICTRRMTRTRAWKRPRRRSSHQKRN
FT                   VSRWNPPAQRIPQSRILGPPSGQFGLLDVGLD"
FT   CDS_pept        join(complement(435822..439787),complement(433626..435755))
FT                   /codon_start=1
FT                   /gene_family="HOG000161554" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268474"
FT                   /orf_name="AFUA_5G01730"
FT                   /product="MYB DNA-binding domain protein "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86131.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG055499"
FT                   /db_xref="HOGENOM:HBG328335"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI000051E6FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE46"
FT                   /transl_table=1
FT                   /translation="MSSRYPPSSGFNSRDRSPQRFGDRRPPAGPRGSDDANLAPLGREP
FT                   PRGPKALIDHPRGAPFGGRGRGFPGRAEFRDRDRDPRDRDRERDRDFRDPRDGPPPFRR
FT                   DIDRDWPRRERDFDPRDSRIGFGRGRSRSPPPPPRDFRDMREPVGRDSDIVRMRRGSRD
FT                   SLVSVSSNAPDGPALGPNQFPRGGPMRGRGRGDWEVGRGRGRVPYLDDRDSFRRRSRSR
FT                   DGRRDWERDRERDRDRDREREVRDRVMDRDRERERIVDRDRDRDMDRRDRERDRDMIDR
FT                   RDRFDRRDDLDRRADRDERDRPAEAWKRDQLPARADTRTGSGPHPFASMGPVPAASDRL
FT                   PDHAIVELPRKPAMAEARRDSIRPDLAASRPDPVKDLPSLLPIKQSPPPAAPQVPAFGS
FT                   VTAPIPDLSADKGPIDTIPAEVAPSVAEKERNETSSRAPVQPPTGPKAERASAQPPPEP
FT                   RYRREEVRRDDGPETSEKDHSISRAPRAHVSPSLHARKQTPELSPPTAPAAMIGKESSI
FT                   PHAEASLTGRTGSIVGSPELSKARTPSIGATSPGLHIPTGPRALQQRSTPTRGPSKVKA
FT                   QWARPGYNRHPAGAGTVPVPKRDSIDGKEGTMSISEDSRREPPAPADDHGNELEAGEIL
FT                   PDKGMEVDAHMSPESSKADAVCHVTPPRAPEPVVGPEKKVAPEDKPALQEDTLIPDFGR
FT                   SSDEDEDENDVFTQEYLEERKQIFEKDMKALRAEMPPPPLEDPHIVSLLMQIQLLGILA
FT                   NEQPAGEAALPPVPAIEGPKAADEAEEPAPVAVKQDAELETPETSPKLASDLVPPADSI
FT                   SVKDLPFLQSGPPTPISDLDVYQENAAIHARMKDVFSQELMKRRKEIARKNAELREEYL
FT                   SYYKRWRMQVWELDRAKARASATPGAGTSPAPSAPTPPVAEGRRYKGNSELDFQNALRA
FT                   SEISAQEELERRRGNKATAQPDLAREAVIPDMLEPGEAKAQIYKDTNNSVDPANAMDVF
FT                   GFLPPPNDFTPEEHEIFTDAFMAHPKKWGKIAESLPGRDFQQCIIHYYLTKEEIKYKAK
FT                   LNKRWSRRGRARRSARPKSNALMKDLGVVKPDYDGEEEPTPVTDTGRPRRAAAPTFGDS
FT                   SAADTDTNGRRGAGKDGEPGEKPSRRGGRTGTGTRGSRRGKAAQQQQQQQQQQQQQQQQ
FT                   QQQEQQQQTVPLPQPPTEVSKVPHPGPPEQPMQTLSVAAVTASSVPAPKTEPPETFMAG
FT                   MTEAPVRIKEITEREIPEAPPRAKAGRGRQREGMYVFESAEQESLGSTRPVEGGYGSLQ
FT                   PTSYWSVPEQRDFPQLLAHFGRDFEGISNFMKTKTTVMVKNYFQRRIDSGQKDFEDIVA
FT                   DAEAKKARGQPTGPLPVPNFASKRRYEATPSSIMPRPLAPHTDTVAESDEARTAKTKHT
FT                   AAASPLAPLHARPPPEKERTVSRYPPLAQASNVPMSTVPMLGEDQSRAIRSQAGLPPRL
FT                   PGPRLGYFTEERQAPTLVAQANVRAQEPPLSARQTPASVGMEPVHSQSFRTASMDMHGS
FT                   PLLAGQGSMPSSQQAYMQQPQQQQQQQQQQQQQHAFMPAPTHSRQSSLTKPPGSPAQHV
FT                   HRQEAEISPIRRDSTSQRPFYPLPGQHGGLSQPPILSPPKEPPRPSSTPLEPAEAPRQV
FT                   PAKRSNIMSILNDEPEEPQPRKRFASDQASSNAPGKPASPSRPIYSGAHSLPQQAPARQ
FT                   DETFLASAAAQKPLYTPHSQYLPPSRAYSDYQAYSTVPAGSPGPPANNDWMARFDPRGQ
FT                   QQQQQPAPPQPPQPNRPATTLAAQPSYSTYTSGQPHSASSLPNLTAPSPAPTPSPAPTQ
FT                   RPSYPGSMYAQSPSSHTQPAPSGARDLGSQNQIYRPAVGSPTSRHNSIAYGSRQGPPTP
FT                   VQSQTSLLGLGSRPPAPTVSAPAPSNHMSAHQTYQQHVQTMVNGAHQQQSHRGPLGLST
FT                   GYGHNSPQPQAQGSRAAGLPGPPSQAAAMGRSYTPPAILQPNPAGYGSSGPSSGMHPLQ
FT                   ARPSGPGGVGEPLSSGHNPGHQRGYSQGSSGMPPQHGPR"
FT   CDS_pept        join(441134..441379,441433..442335)
FT                   /codon_start=1
FT                   /gene_family="HOG000228838" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904169"
FT                   /orf_name="AFUA_5G01740"
FT                   /product="Deoxyhypusine synthase, putative "
FT                   /biological_process="peptidyl-lysine modification to
FT                   hypusine"
FT                   /protein_id="EAL86130.1"
FT                   /db_xref="GO:0008612"
FT                   /db_xref="HOGENOM:HBG042306"
FT                   /db_xref="HOGENOM:HBG716221"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="UniParc:UPI000051EDF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE47"
FT                   /transl_table=1
FT                   /translation="MSSSKMTNYHSGSAEALPPSSATNAVLVASEPVPKGSHEVRGVDF
FT                   DRFQGRDITVAELVDNMVHMGFQGSAVAEATRIINDMRAYRHPETGEKTTIFLGYTSNL
FT                   ISSGLRDTIRYLVRHRHVSAIVTTAGGVEEDLIKCLAPTYMGSFSTPGAGLRAKGLNRI
FT                   GNLIVPNSNYCAFEDWLIPILDKMLEEQEEAKKKAFRTGDEEDELHWTPSRVIERLGRE
FT                   IDNEDSVLYWAARNNIPIFCPALTDGSLGDMLYFHTYRSSPQRLRVDIVDDVRRINTMA
FT                   VRAARAGMIILGGGVIKHHIANACLMRNGAEHAVYINTAQEFDGSDAGARPDEAVSWGK
FT                   IKADANAVKVYAEATVVFPMIVAASFARSSPTPSAEDSDNHN"
FT   CDS_pept        join(443822..444161,444227..446320,446386..447160,
FT                   447223..447799)
FT                   /codon_start=1
FT                   /gene_family="HOG000161543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057443"
FT                   /orf_name="AFUA_5G01750"
FT                   /product="MATH and UCH domain protein, putaitve "
FT                   /EC_number="3.1.2.15"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="EAL86129.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055497"
FT                   /db_xref="HOGENOM:HBG328336"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013322"
FT                   /db_xref="UniParc:UPI000051F7AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE48"
FT                   /transl_table=1
FT                   /translation="MDTRMDTAVTVEQLPPAVTLSVDAPSSETVTVGTELPEPTSENNI
FT                   TEIPENTPLDNVHPQSHEPSDPIPAPQPPQPELEHAYWAEIEEDTSVPDEAEMKEIEST
FT                   ADGDYSAYEYDYWEKNFHPDLDDPEYRPVEKGRLTWKIKGVRGTKDAPNRSKIMRSPPA
FT                   YIGGYWWTIKFFPRGNNVGSLSIYIECSPTLPQPDKTLPETEFKVLRGPADSGLNNAAP
FT                   ELDMKFARTEDTASWLEQFTAQYPAAAASRQDPPKDTWRVSAQIGVILYNPDEPRTGWM
FT                   QSSCHQFNPHNLDWGWTNFHGPWDQIHRRQRGQRQALLRNDTLAFDAYIRIIDDPTRSL
FT                   WWHASDSEPTWDSLGLTGYRPLGDSVINHSAEVAGLASWLHLAPLCKIIQNAKVLDHYT
FT                   NCDVKPKPLCDALQKFLWRLRSRGQSLQYVDTDIITSILRNLHEYSGDVCEFWERLRRT
FT                   IEFELSDTDAPKELAKIFDSPSPDSLAVSGVDAVNTIPKDFNSRICVPAEQAKTMREGL
FT                   SWYLTQKPGRWALPPVLHVELYRHKLDKAARQWRLVYNKVDLDEELDLTPYLVDGQCGS
FT                   YVLYGYIVHRGRRTSGKFFSILRPGGPGTRWLAFDDGSDNRVECLTRKTALGPHLGLDE
FT                   SQKVDHKTGHDVAIAVMYIRGDVVSEFLPGPQGPWDVSPSLKEYYETGIYPLSSMSAGK
FT                   PAEKEIQVEVYAPPQYDKLPSLFDSYDLMSQAKAANKVMYMTVPRSENIVELRKKIALW
FT                   ASAGSETQASPENIRLWQIGHTRDRFGPTLAFERISDLKSTLDLPVPVARLWMQVVSDD
FT                   EAKYFAIRDPRDTVVAQRKTEEAVVERAGSESSDDRQYTPEVRSGGAEASSSGNVTESD
FT                   FSNGDRVSVEQPPPRASDSEVSESSSQETPDSSEIQPSNASTEDDAAIAAIIAQDVQQM
FT                   DIQLAEEAQQSPIRAEQSSNDTTQSEPAEQRAASPAPEAMSSTSEEPDVPLPVEHVYYF
FT                   IQIFDVEAQALRTVGSFFSRKEEKIKTALRKHLKWPMTKDFSIWQRVDGTTVTTMSSVG
FT                   TFDVYVPDGTCFIVGDKFSKEKRTELSVAGLFSSPDRLIHYLFAAERNHPTRAFTGTKT
FT                   IDASFNSEYYSGEFLKGYYHGKGKHISDSAATYVGDFVFGKRHGSGAMEYPTGDTYDGD
FT                   WYEDQCHGQGTFVEKKTGNKYVGGYKDGKRHGKGISYWEVADEEMDLCQICYSEEQDAL
FT                   FYDCGHVCACVTCARQVDICPICRKNIISVVKIYRT"
FT   CDS_pept        complement(448246..450501)
FT                   /codon_start=1
FT                   /gene_family="HOG000224258" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268475"
FT                   /orf_name="AFUA_5G01760"
FT                   /product="Nucleolar RNA methyltransferase (Nop2), putative "
FT                   /function="RNA binding"
FT                   /function="S-adenosylmethionine-dependent methyltransferase
FT                   activity"
FT                   /biological_process="rRNA processing"
FT                   /protein_id="EAL86128.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008757"
FT                   /db_xref="HOGENOM:HBG460167"
FT                   /db_xref="HOGENOM:HBG726909"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="UniParc:UPI000051E4A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE49"
FT                   /transl_table=1
FT                   /translation="MGKGRRMKKQGPPAPLDESKITLYKKRKAGDVESKAESGKKRRRA
FT                   EDEEEILKAVPKKKVNGAVKGKEDKAVATAVSKKDAKTKSKPAAKEKPTFMDSDDEDMS
FT                   DLDDDEVEMGEDEFDDLDGVSDGSMGSQEEVDSDEEEEDEEDSVVDSEEEGHPREAMFS
FT                   DDEDLSDAEEKLTAANIEGLSRKLDEARQAEEEEAQRELQESAMQTNIAGDRPDVFADA
FT                   EGKPGLAPDLQLLRTRITDTIRILGDLKTLGQPGKSRADYLQLLLDDICTYYGYTPFLA
FT                   EKLFNLFTPMEAFAFFEANETPRPVVIRTNTLRTNRRSLAQALINRGVVLEPVGKWSKV
FT                   GLQVFESAVPLGATPEYLAGHYILQAASSFLPVMALAPQPNERVLDMAAAPGGKTTYIS
FT                   ALMRNTGCVIANDASKPRAKGLIGNIHRLGCKNTIVTNLDARTAFPKALGGFDRVLLDA
FT                   PCTGTGVISKDPSVKTSKNERDFLAIPHMQRNLLLAAIDSVDHASKTGGYIVYSTCSVT
FT                   VEENEAVVQYALRKRPNVKLVDTGLGDFGSPGFTSYMGKKFDPKMTLTRRYFPHRENVD
FT                   GFFVCKLKKTGPTPTPKPSAGGSTAPAAAADKPAKKADDDEVVDKTPILNEDGTTLDIE
FT                   GGAFGPFDEEEDQERIARAERNRLRRKGLDPRAVLNKPKKSASKKTDASKKQEESKKEE
FT                   SAVENGDEKAAKTSDKVDEKADKKDKKADKSKTDSDSKGSKKNKKAASSSPGKKAGK"
FT   CDS_pept        join(450714..450950,451017..451598)
FT                   /codon_start=1
FT                   /gene_family="HOG000161532" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057444"
FT                   /orf_name="AFUA_5G01770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86127.1"
FT                   /db_xref="HOGENOM:HBG055496"
FT                   /db_xref="HOGENOM:HBG328338"
FT                   /db_xref="UniParc:UPI000051FED6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE50"
FT                   /transl_table=1
FT                   /translation="MSTVDQSTVTTALSSSSSNRHQGNDTYSIPKHSGTTSTITITMNE
FT                   VSFVKSYLSTLDSRPIKLRSDHVFDPEQVGLRVPYTLPRLHAPHPEMPKKTKQPLAPGS
FT                   SKSITVHLKSARNPALEFSLPNTALTTTSVQDLKDAVRERVTDAQGNKISLDKIKILYK
FT                   RKPVTGKTIAEVLADEPVRLSGGKEVEFGVMIIGGAQVAVSAGAGERASAEQKESYEPP
FT                   KPAVGPSGESVVATEAFWDDLQGFLEQRLKDYDEANKLRVLFKEAWRSSF"
FT   CDS_pept        join(complement(454970..455057),complement(454623..454901),
FT                   complement(452725..454566),complement(452401..452573))
FT                   /codon_start=1
FT                   /gene_family="HOG000161521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268476"
FT                   /orf_name="AFUA_5G01780"
FT                   /product="Cell differentiation and development protein Fsr1"
FT                   /protein_id="EAL86126.1"
FT                   /db_xref="HOGENOM:HBG055495"
FT                   /db_xref="HOGENOM:HBG328339"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013258"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000051FED8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE51"
FT                   /transl_table=1
FT                   /translation="MAGGGGYVGPGGDGSSNGGQPHGTEYTLQGVMRFLQTEWHRHERD
FT                   RNAWEIERAEMRSRIGRLEGDVRTSKRLHESLGKHVRLLEAALKKEREKVKKLSNNEPI
FT                   EDMRDSKEIARESINALKSQRSKSQADLTTDIDTDHQLGVRQENEREKSRLYLSKCSQE
FT                   VAFHVIPTSHPAPDLNDLELSNHMYANHNMPQQSIEEAYIQQQRQKQQQQQQQANHMMA
FT                   REVALQNHQPIVTHYSDNSNVSRAPNQFLPTVARDIMDKSPLEAQQTHATAIDNRRQAF
FT                   ESGLSDERAGAAKQQYDNTQAAAKEETQSQQEDQIQDTDGWNFDENPAQESRTAHIPPH
FT                   RPDMDAFPNANFAGPKSPSRGGSVSHRRKSSGSKRKTEGATDVGAGAIQKQDPIFKVRF
FT                   ALRGHLDVIRSVIFTGGGSPSEPEICTCSDDGTIKRWIIPASYGAYGSHGGSSGNDLDI
FT                   TSYFTHRGHVGAVTALAACSPSQNFSNGGRALGDGWVFSGGQDASVRVWERGRVDPKAT
FT                   LDGHTDAVWGLCVLPGTAGTVFGDSSSHYGGPDRILLASGAADGRILIWAVSAPPQVSS
FT                   PQAGSRRAGGSRRANSISSGSNFPSSPQPSTATTTPFHYTLVHHILRADSPSPTCISPL
FT                   SLAGVNFVVSYTDASILVYDTRTGEEIVGMASLETYDGTPSTGVNSVVATTIGFDGSAG
FT                   LDPSRTLADEEVVHGATGSSAVEGVIISGYEDRYIRFFDANSGHDASLRFWNLEKRSCT
FT                   QEITSHRLMRGEGVCAVTWSRDGRWVVSGGGDGVVKVFSR"
FT   CDS_pept        complement(455314..455541)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752054"
FT                   /orf_name="AFUA_5G01790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86125.1"
FT                   /db_xref="HOGENOM:HBG055494"
FT                   /db_xref="UniParc:UPI000052059D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE52"
FT                   /transl_table=1
FT                   /translation="MLDEDGSQTTPALKAVRRPCCASTGANKSPASGGAVTFPDLSEEN
FT                   LTRASCLSSFTTTQRPSSFSPFGDPYLSVD"
FT   CDS_pept        join(complement(456274..456859),complement(455798..456117))
FT                   /codon_start=1
FT                   /gene_family="HOG000161510" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268477"
FT                   /orf_name="AFUA_5G01800"
FT                   /product="DNA repair protein Rad14, putative "
FT                   /function="damaged DNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86124.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG435659"
FT                   /db_xref="HOGENOM:HBG738603"
FT                   /db_xref="InterPro:IPR000465"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR022652"
FT                   /db_xref="InterPro:IPR022656"
FT                   /db_xref="InterPro:IPR022658"
FT                   /db_xref="UniParc:UPI000051F7AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE53"
FT                   /transl_table=1
FT                   /translation="MKAKAIREQREAEEAKKRVATPSSLSSVSGVKRTYSSMTASETPA
FT                   TLRDASANRPLDAIKPARNFAKYVEYDFSKMTDTKGGFLTQEDDPYNKALNVRDGKEEQ
FT                   KPAHMTQKEWERQQLVDSLRRERAGPFEPGLSVLEDKSKQKKCRECGSLEIDWKWEELL
FT                   RCCVCHACKEKYPEKYSLLTKTEAKEDYLLTDLEEYAFSPKKWGSPEALDAEFERRENE
FT                   KKRRREAKFKTKLQDLKKRTRVEAYRRNRQGAAGGNFGDDLGKGGRHVHQWGRSVEDPE
FT                   TGIGVKKCVDCGMEIEELEF"
FT   CDS_pept        complement(457314..458468)
FT                   /codon_start=1
FT                   /gene_family="HOG000161499" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI20752055"
FT                   /orf_name="AFUA_5G01810"
FT                   /product="PIG-P"
FT                   /protein_id="EAL86123.1"
FT                   /db_xref="EMBL:AAY42824.1"
FT                   /db_xref="HOGENOM:HBG055493"
FT                   /db_xref="HOGENOM:HBG328340"
FT                   /db_xref="InterPro:IPR013717"
FT                   /db_xref="UniParc:UPI000051972D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE54"
FT                   /transl_table=1
FT                   /translation="MSPPEIDDEKKPRSTDDSRGSARIVSSRESKQPFPPLPADEHATT
FT                   MHDAPNNSYPGLDDSDMLSPTTDDLVEEEEDPDFHSSYSLDNQSFSDESMESDEEAAED
FT                   GIAMHHPFRQSSSSLHGPNAFAPPFYNRPPTPLPPSPSLTSLLRPPFSTTTSRPTTPDS
FT                   SDVETPNDTEAAVAKSARRATTVPRASPKVPTYEYYGFVLYLASSLAFCESNPMRCRKR
FT                   SPILILPTVIYILWSYLPSPFLHQLGIYYYPNRWWSLAIPAWLVMLIIYIYVALASYNT
FT                   GYLTLPMNSIENIVDEVANVAVIDGKGRRRPGGAAKMKPGATSYQIMGPQNRKVNWKDI
FT                   WSEGTDAVMDVPVGGVCEVLYGQERDDGELSDGHTGFAPGTAET"
FT   CDS_pept        join(460848..461029,461085..462799,462868..463583)
FT                   /codon_start=1
FT                   /gene_family="HOG000161488" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268478"
FT                   /orf_name="AFUA_5G01820"
FT                   /product="DUF221 domain protein, putative "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86122.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG175905"
FT                   /db_xref="HOGENOM:HBG327532"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR022257"
FT                   /db_xref="UniParc:UPI000051EB90"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE55"
FT                   /transl_table=1
FT                   /translation="MTSDAIKNLGVNESTSLSALLTTLLPALVIAFFWFGLFLVCRRTQ
FT                   LRWYAPRSHLPCWHQHERSPKLPRGFINWFGQFLKISDAHVLHSSSMDGYLFLRFLRVL
FT                   CSTCFTGCLVTWPILIPIHVTGGAGNTQLDALSFSNVKDPTRYYAHAIMACIFFSMCFW
FT                   GLFQAKSLIRDTAAYVFYVVTRESLFYANLRQAYLNSPAYVRRISSRTVLFMSVPEDYK
FT                   NEQKLRQVFGDSIRRIWITSDCKELMKKVRERDSLAYRLEKAETNLIRTANSARLRAFK
FT                   KGVITSDTCLDCESGTHSWRKKIRRPSHRVKLFGPKVDSICWLRDELVKVSKEVEYLQE
FT                   QHKNGKMKNLSALFIEFNSQSDAQIALQTLSHHQPLHMTPRFIGISPKEVVWSSLNLSW
FT                   WQRIVRKFAVQGGIAALVIFWSIPSAAVGAISNITYLTSLLPFLGFIDKLPSSLKGVIA
FT                   GLLPSAALVLLMSFVPIICRCMSPRLKSNRNKRTLLTLVDSVLARRAGAPSTAHVELFT
FT                   QSAHFCFQVVQVFLVTTLTSAASAATAQIIKNPLSAKDLLAQNLPKATNFYISYFLLQG
FT                   LTMSSMAVVQVAGVLVFKFLSTFFDRSPRLLYRRWASLSGIGWGNVFPVFTNMGVIALT
FT                   YSCIAPLILGFAFVGLYLVYQAYRYNFLFVYDIEIDTKGLVYPRALQHLLTGIYLANIC
FT                   MIGLFAIRAAIGPLIIMALFTVLTVLAHMSLSEALAPLYTFLPRTLDTEEEQQSKEDET
FT                   QALLRHPRNRWEAAWKWFHPNLYRDYAALRRKVRRDHVEIRYSEEEERNAYFEPCIRAR
FT                   TPTLWIPRDKWGFSHQEIIETHPSIPITDEGAHLDEKNKFVWDKYDPSLPLWELKVLY"
FT   CDS_pept        join(complement(465539..465800),complement(465345..465476),
FT                   complement(464939..465289),complement(464864..464885),
FT                   complement(464012..464810),complement(463789..463950))
FT                   /codon_start=1
FT                   /gene_family="HOG000216958" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268479"
FT                   /orf_name="AFUA_5G01830"
FT                   /product="Extracellular endoglucanase, putative "
FT                   /EC_number="3.2.1.4"
FT                   /function="cation binding"
FT                   /function="cellulase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86121.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008810"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG055492"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR005102"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016282"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051E712"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE56"
FT                   /transl_table=1
FT                   /translation="MQNQAMKGLRVAALVALFRSAWAQAGNCPGTFTSISAADFVSRVH
FT                   PGWNLGNTLDAVPNEGSWNNAPVQASTFDTVKSAGFNSVRLPVTWAYHFTGDSPDWTVD
FT                   PAWLQRVSDVLDMITSRGLYAIVNVHHDSWIWADVTQSGANLTMIEEKFYRLWYQIGTK
FT                   LGCKSNMVAFESINEPPVNNAQDAAELNKLNEIFLQAINKAGGFNSKRVVNLVGGGQDS
FT                   IKTSQWFKAPTGFSNPYAIQFHYYSPYDFIFGAWGKTIWGSDSDKTALTNDFKLLRNNF
FT                   TNVPIILGEYDASPTNTEPAARWKYTDLLAHAAAQYNFAAILWDNGLDHLDRTTGNWRD
FT                   PTSLQIITKTKSSTKNSLPDSTTDASATSQSSSAYIFHQVGTPVTSQTLPFIFNGNTLR
FT                   SIRDSSGTTLKQGTDYSVSGSNLVFTASYLSKHFSASTKPGIIADLTLVFSSGASPVVQ
FT                   LVQWQTPTLGSTSVAASSVSGDLSIPITWGGVPKVAAVKALTTSGKYLVDDWTQVLGPL
FT                   QQARTTYSNQWKFEGSNVILTSGAIDAVKSVGQTTVFTFEFYPRVAGGVNTVNFTVTV"
FT   CDS_pept        join(complement(469385..470009),complement(468478..469331),
FT                   complement(467346..468422))
FT                   /codon_start=1
FT                   /gene_family="HOG000161477" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752056"
FT                   /orf_name="AFUA_5G01840"
FT                   /product="DUF455 domain protein"
FT                   /protein_id="EAL86120.1"
FT                   /db_xref="HOGENOM:HBG055491"
FT                   /db_xref="HOGENOM:HBG328341"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="UniParc:UPI000051E711"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE57"
FT                   /transl_table=1
FT                   /translation="MVLRKRAPPHLYSLSLGNARSEPRSPISPTSPTAKSATSPSPKRL
FT                   TRPRRAKSYPYPYQIPSEDSIYSPDLNTSPAFDLMPLEQAQKSPVGTLSSDIANPWADD
FT                   VVERPDRSHSVSEHPPVHARELLQGSPLDNRRADRVPSIVVAGTQRRMAANEWQEANNS
FT                   ADWEPPIQLQSNNPFLRAKQSDENPWGPNNLRVSQGDNSSDRLSQSEGYIPMTARLSLL
FT                   DQSGSESPWAEERPEAATPSPAWQNTRTDSQNMSSMPHVVRGNGSTSPFQTSYIGNEPG
FT                   YSSQYLQQADHGSLAPGSGIETPYVTDSTMTTPSSHELIEVDEPSHAGAEPTTQLLSRN
FT                   TSAAPAPPLPQRPNADANQAPPLPLRNAALSESDEQQQNEQRSETYSIRHVNWTDPTGK
FT                   LRESPVLVQNKNGPCPLLALVNTLVLRADQDTQPPIVRALRTKEQISLGLLIEALFDEL
FT                   TTHVGTDGELPDIEALSRFLTMLHTGMNVNPRLTLESDDAPGTFQNTDDIRLYGTFGVP
FT                   LVHGWVASPASEADGALKRVAQYYEDVQLLPFRKQELEDRVFRGETLTWDEEQAMKDIH
FT                   AIERFTEIENATQLSPFGLDHLTEKMHPGTFSILFRNDHFSTVYKHPQRHQLFTLVTDA
FT                   GYSNHAEIVWECLVDVNGFNAEFFSGDFRPIGHAPPGTVPSGPRNSNNQTNVPPSTSED
FT                   RTSELSPQEQADADYAYALSLQYQEEERRERESNNRSRNQRASAPNHPPGAFWGSGSAH
FT                   QRSASVANGSGSGPTSDGRSSRHGHDPGASNNAEDLPPPSYEQAATSPAHPPRDSHYNT
FT                   LPQQTRYQRHSLGRRVGPGTVAAGSGDRAKDRNKDCVVM"
FT   CDS_pept        join(470948..471033,471088..472720)
FT                   /codon_start=1
FT                   /gene_family="HOG000161466" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057445"
FT                   /gene_name="trm6"
FT                   /orf_name="AFUA_5G01850"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase non-
FT                   catalytic subunit trm6"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86119.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG055489"
FT                   /db_xref="HOGENOM:HBG397982"
FT                   /db_xref="InterPro:IPR007316"
FT                   /db_xref="UniParc:UPI000051E4A3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WE58"
FT                   /transl_table=1
FT                   /translation="MHSYIRPYQHVALRLPSELTKIVRLVPNTVVYLGKYGSFPANTII
FT                   GRPFYLTFEIIDVSGENNDNCLRIVPPAELHAETLIADGEGEGDDVEVNEEGIPIRTNR
FT                   EIVDDASTQKMTAEEIEALKKVSTGAGREIIEKLLESHSALDQKTAFSLAKYTLRKRKK
FT                   FLKRFTVLPVDVSLLTNYMLEGKEAMKTMELRDESIGLIGCWGNVHHGGQSSFEGAVAS
FT                   KPNGRYLVIDETGGLVVAAMAERMGILYPHDQEDEDQELAEGSEENGERQQTNAMAQAL
FT                   ARRRHMAASGNSITVIHANKQPSLSLLRYFGYDQDNPDESHPLYKHMKTVSWMQLLDPH
FT                   ADTIYANEPEVIPDETLATFKSNRRSAYYKKRSRWERVRRVVDEARAGNFDGLIVATLM
FT                   EPASVLKHTVPLLAGSAPVVVYSPTVEPLTELADLYSTPRRTAYITRKREIIAQHSLQQ
FT                   SLQGQSQDNEKKPQEPDFSELDKDFALDPSLLLAPTIETSRVRAWQVLPGRTHPLMSGR
FT                   GGAEGYIFHAIRVFPSHQNIQAAGNPSRKKRKVAAQQESATPAESGSGVDVEMQS"
FT   CDS_pept        join(complement(473979..473984),complement(473871..473916),
FT                   complement(473486..473760),complement(473321..473433),
FT                   complement(473183..473261),complement(473076..473123))
FT                   /codon_start=1
FT                   /gene_family="HOG000161465" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057446"
FT                   /orf_name="AFUA_5G01860"
FT                   /product="ARP2/3 complex subunit Arc18, putative "
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="EAL86118.1"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="HOGENOM:HBG320336"
FT                   /db_xref="HOGENOM:HBG478149"
FT                   /db_xref="InterPro:IPR007204"
FT                   /db_xref="UniParc:UPI000051EDF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE59"
FT                   /transl_table=1
FT                   /translation="MPAYHSIFLEDRDVPVIGNFPVLPLRTRTRGPAYTLPPLPAGVSD
FT                   IDVPPDSESYDCVDEILSLFRANVLFRNFEINGPADRMLIYGTLFISECLGKVKPGMTS
FT                   REAEKALINVSLDHFAIPGDVAFPLNQAFEPPRDRQDAETLRQYLSQVRQEIAIRLHAR
FT                   LYAGGEGPSKWWLSFAKRKFMGKSL"
FT   CDS_pept        join(474353..474492,474544..474631,474679..474853,
FT                   474928..475314,475370..475770)
FT                   /codon_start=1
FT                   /gene_family="HOG000224152" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208750"
FT                   /orf_name="AFUA_5G01870"
FT                   /product="DNA replication factor C subunit Rfc3, putative "
FT                   /function="ATP binding"
FT                   /function="DNA clamp loader activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="DNA replication factor C complex "
FT                   /protein_id="EAL86117.1"
FT                   /db_xref="GO:0003689"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005663"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG533331"
FT                   /db_xref="HOGENOM:HBG541599"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniParc:UPI000051F536"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE60"
FT                   /transl_table=1
FT                   /translation="MSDFEDEMDVDVPAPKSAIQFNSDSASKGAKRPTADLPVEAQDNL
FT                   PWVEKYRPNTLDDVSGHQDILATINKFIEANRLPHLLLYGPPGTGKTSTILALARRIYG
FT                   SNNMRQMVLELNASDDRGIDVVREQIKTFASTKQIFSMAAPSASSGSSLASFKLIILDE
FT                   ADAMTSTAQMALRRIMERYTANTRFCIIANYTHKLSPALLSRCTRFRFSPLKEQDIRSL
FT                   VDQVIEKEQIRIQPEAVSSLVRLSKGDMRRALNVLQACHASSRPLPMKNATNDEPQSEP
FT                   EIITNETIYDCIAAPHPSDIQEIMTTLLSTSDITSCLNTLNTLKANKGLALADILSALA
FT                   EQLQQLEVPPQTRITWLEGLADIEFRLSAGGSETMQTGGMVGVIRNGCELMDAKAR"
FT   CDS_pept        477097..478527
FT                   /codon_start=1
FT                   /gene_family="HOG000161444" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752057"
FT                   /orf_name="AFUA_5G01880"
FT                   /product="Putative uncharacterized protein "
FT                   /function="acid phosphatase activity"
FT                   /protein_id="EAL86116.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="HOGENOM:HBG055488"
FT                   /db_xref="HOGENOM:HBG328349"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="UniParc:UPI000051F7AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE61"
FT                   /transl_table=1
FT                   /translation="MRTSVQPTSVLLALMAIPFASAEKVLGAYIFARHGDRTPKVLGNT
FT                   QLTDLGYKEVFLTGSYYHDRYINSSSSHYIQGISEEIVNLNQISVSAPSDNVLQNSATG
FT                   FLQGVYPPVGTMASQTLGNGTTVEAPLNGYQLIPLALIETGTNSESNTWLQDATQCQNA
FT                   KVSSNNYYSSALYKDLLASTSDFYQSLSPYLNDTFTASKMSFKSAYTIWDFLNVASIHN
FT                   SSSDYPSAEIREKLFLLANIEQYNLAYNTSEPIRAVAGSTLAGEVLQGLNETIASKGKS
FT                   KLNVQFGSYGTFLSYFGLAQLPAATVDFTGIPDYASSMAWELVTNSTLDEFPPASEISV
FT                   RFIFHNGTISSSSTPAEYPLYGQSSVTIPWSDFVTQTEKIAITDDEQWCKACGNTDGAC
FT                   AAYTVSSSGSESSSAGLSSSKDGVSRPVAGVIGAMVTLAVILGLEAIFLLVGGFRITKK
FT                   RSAVSGVETTTVEGPKKV"
FT   CDS_pept        479790..481469
FT                   /codon_start=1
FT                   /gene_family="HOG000161443" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268480"
FT                   /gene_name="cwc27"
FT                   /orf_name="AFUA_5G01890"
FT                   /product="Peptidyl-prolyl isomerase cwc27 "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="EAL86115.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG055487"
FT                   /db_xref="HOGENOM:HBG328350"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI00005200ED"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WE62"
FT                   /transl_table=1
FT                   /translation="MSAHYTTEPPPTASATLHTTFGPIHIALFANQTPLTCKNFLQHCL
FT                   DNYYAGTIFHRIVPDFIVQGGDPTGTGSGGTSIYEYPEFEYDPEARDPNEKVVLRDELH
FT                   SRLRFNRRGLVGMAKSEDGTYGSQFFITLANAERELNGQCTLFGRVEGDSIYNVLKIAE
FT                   AERVERTERPVYPVKVVSCEVGELGPFAGKLKRRETIATAPAAEEKPAAKKKKKAKGGK
FT                   TLLSFGGDEGDEDVPLRPSKPKFNPTLVVDAGIPPANDAPKKTSPEAEQQTRKRPRSPS
FT                   PRRSLSAERKHRPKTPDPLTQLPLPDPESPARSPPQSPPARQSILSRTRAEIENLKASM
FT                   RRTVATGPADTGRKKSALEAMIPETAIRGRKRPPPGTVNGAGRGSSTNGVTGFSSAAED
FT                   ETLRMFNAFKAKLESADAKSGPHGKTSISASDTTKYTSQAKSNTEPEDEEAQLCDLHFI
FT                   ANCQSCKSWDDTGTAEEAPDDDDRDWLTHELRFGKDMLGKDLQWKREHPDDVDSLVVID
FT                   PREREKEFVGGKRRGLERDRERDRKRERVGDQEWDRRRREKP"
FT   CDS_pept        join(complement(484198..484664),complement(482209..484141))
FT                   /codon_start=1
FT                   /gene_family="HOG000161378" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752058"
FT                   /orf_name="AFUA_5G01900"
FT                   /product="Heat shock transcription factor Hsf1, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="response to stress"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86114.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG055486"
FT                   /db_xref="HOGENOM:HBG328351"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000051FEBD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE63"
FT                   /transl_table=1
FT                   /translation="MSSQGVTRKRPAPGTTPTVHPQLSPISNYPAANPGSQLSNDQFLQ
FT                   WGQNPPNVITPPYTDAGSYNVAPYTTNQDVPGATVTASTQLARRQLPNQLVNRGRGYEQ
FT                   TPSVYSDHSGGAGEPGGWGESLDELYRRALVAKREAQAKRKQIPPFVQKLSSFLDESKN
FT                   TDLIRWSDDGNSFIVLDEDEFAKTLIPELFKHNNYASFVRQLNMYGFHKKVGLSDNSMR
FT                   ASERKNKSPSEYANPYFKRGHPDLLWLIQKPKNTAGQGSKSGKGNVRVKTEEVDENEND
FT                   DYGEDGASRDDRNRSRQLSLVPGSMMPKDQLAGVYRELQAIRQQQQIISNTINKLRREH
FT                   EQLYAQAANFQEQHNRHENSINAILTFLATVYNRSLQGQDGPQNLANSFAGVISQDQGN
FT                   VVDVEDDFPLSALGAANLNSPNAQRSMKKQPLLLKAPPTTDRQNGRATTLSPAGSTYNR
FT                   SQSRSHSRQPSVTQAGHVEEVFETSPTQKDATNSQNRQYPQSDIMSVIQNTNARNGIPT
FT                   TFAEFPNVLSSLETSGGNSPLTPNQRADMLRLMANESHTDPNIPVPSDNALITPTPPPM
FT                   PHNYNGRLASTRAEIDNLMKMQAEQDRSVQNLTNLLQPLSPTGTIPGLAGGENGSVPPP
FT                   ALDLDQIFNNDYFTDIGDLEHNKSNMDLGDTTSSVPAPAPADAPVTTGAEDVKDGSDLF
FT                   DFDQIPPEGDLFDTSTAAQQQSPSFFNGYDGAGYPGGSGTNGHTLIGHKNPNGDSGRIV
FT                   ETLTDSESTSPSTNVDEVPQYSGPAGLNESHGGKGNGGGAKRRRKA"
FT   CDS_pept        join(complement(486747..487013),complement(485997..486686))
FT                   /codon_start=1
FT                   /gene_family="HOG000250285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752059"
FT                   /orf_name="AFUA_5G01910"
FT                   /product="Aldo-keto reductase (AKR), putative "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86113.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG520069"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000051E49E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE64"
FT                   /transl_table=1
FT                   /translation="MARAAISKMPWDKYILRSVQEAPPVHLPLFLYGTAWKKDRTAGLV
FT                   YQALNAGFRAVDTAGQPKHYQEELVREGIRRAIHDGILRREDLYTKFTSVHGQDPNKMP
FT                   YDPRTSVTDQVHASVKSSLHNLCAPDASSSVEDAYIDTFLLHSPLSTMAETMEAWLTLE
FT                   SYVPHRIRNLGISNCTLPILKELYARATVKPAVVQNRFYPDTRFDVPLRTFCGAHDIIY
FT                   QSFWTLTANPGLLRSDAVQSLASQVEISPAAALYCLVLGLGNTTVLNGTTNRARMDADL
FT                   AAVRKVEQFSKDSPDAWQMVLDHFKRVIGDDVDTVKK"
FT   CDS_pept        join(488641..488974,489043..489326)
FT                   /codon_start=1
FT                   /gene_family="HOG000216957" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268481"
FT                   /orf_name="AFUA_5G01920"
FT                   /product="GPI anchored protein, putative "
FT                   /protein_id="EAL86112.1"
FT                   /db_xref="HOGENOM:HBG055485"
FT                   /db_xref="UniParc:UPI000051FC8C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE65"
FT                   /transl_table=1
FT                   /translation="MRALQFLALSGLMLASNIALAAELDRDDVPDRCWDVCSPVVGIAQ
FT                   QCDNTHRDDDRAEMNCICNSNRAPTLVPLCEACISQFRNDTRNGTHHDDDDDDDHDHDD
FT                   HRRPHDNDAYDILTSCSFSTTTYNAAAATSILSTATGSITPTATNNASGSTGSGGNTGN
FT                   SQPENTNNGSNAQPNNNAAAGSTVSKAASVAAVVGLIGLAWL"
FT   CDS_pept        join(complement(491624..491868),complement(491018..491285))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208751"
FT                   /orf_name="AFUA_5G01930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86111.1"
FT                   /db_xref="HOGENOM:HBG055484"
FT                   /db_xref="UniParc:UPI0000520357"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE66"
FT                   /transl_table=1
FT                   /translation="MPSMILATDPLSVSWNILSLFAAGEKERPIYCIIKQATIPGDRTL
FT                   PDEGSEPQGDPRIGYAYNRFGYSKSNMTERQAQGVQGLPALMSHTTVVKTIMALIIIAL
FT                   HMHSSQLLPGAPSARHCLSRTEIRVIAGNRMIKASKKQKKNKLVISHSDLSQLPLSPLP
FT                   LPPRTGG"
FT   CDS_pept        join(495595..495939,496003..496546,496644..497578)
FT                   /codon_start=1
FT                   /gene_family="HOG000161365" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268482"
FT                   /orf_name="AFUA_5G01940"
FT                   /product="R3H domain protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="EAL86110.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG055483"
FT                   /db_xref="HOGENOM:HBG328354"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000520332"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE67"
FT                   /transl_table=1
FT                   /translation="MSYQQSQEMYHDNSSARSPGSQRHQQPLHRQPSRQFDAYGPMPVN
FT                   LYDDSMARYDTGRLERLNPSLHNNSYAYDLSGSQTWNPNGFANAQTLGAIRSASASLKT
FT                   TSRTGRAGLPTTWLDQQPGMPSPFSNLGPGPLQSGAVRSETTVPSEGEDELIPTAIVIK
FT                   NIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGVFRGLAFANFTSAEETATVIEVLNHF
FT                   ELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQHRPMAASQLQTQSSMSSLTSHI
FT                   PATSPSPVSQRGQKLEVDLNDSTTLSYYSQLLLFKEDPSRDSVLFPPTLTPIQRRTVHT
FT                   LAHNMGLGHASRGTGEQRQVQVFKVAPGTNVSPPLTSIPTAVQPADTARRGLNRAATID
FT                   FSEARNEGGPGPFSNLRGQTSGFLGVLDSPGNYGSTQNLRAAKSFADLRSYTPSPVPSS
FT                   ASFPAALQSNGTRLQHYEAVTSGASNTPTLTSAPSGSSLGVQRDDNLLVNSLSSLSLGT
FT                   GIGGPNSSPRRLRGMFSWDQPENQPSSAGPIGSNRSIGLGFDGQSQERMPIRQPRGPVP
FT                   EKGSGFRRSNGHQSRGSDELRTNSGVEIIVE"
FT   CDS_pept        join(complement(500231..500329),complement(499837..499906),
FT                   complement(499510..499757))
FT                   /codon_start=1
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752060"
FT                   /gene_name="htz1"
FT                   /orf_name="AFUA_5G01950"
FT                   /product="Histone H2A.Z"
FT                   /function="DNA binding"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="nucleosome assembly"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86109.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG524528"
FT                   /db_xref="HOGENOM:HBG610736"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000051F7B8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WE68"
FT                   /transl_table=1
FT                   /translation="MPGGKGKSVGGKAGAKDAAGKTQKSHSAKAGLQFPCGRVKRFLKN
FT                   NTQNKMRVGAKAAVYVTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDEELD
FT                   TLIRATIAFGGVLPRINRALLLKVEQKKKNKSDA"
FT   CDS_pept        join(501240..501253,501369..501529,501591..501976)
FT                   /codon_start=1
FT                   /gene_family="HOG000161354" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208752"
FT                   /orf_name="AFUA_5G01960"
FT                   /product="Phosphate transporter (Pho88), putative "
FT                   /protein_id="EAL86108.1"
FT                   /db_xref="HOGENOM:HBG055481"
FT                   /db_xref="HOGENOM:HBG328355"
FT                   /db_xref="InterPro:IPR012098"
FT                   /db_xref="InterPro:IPR019263"
FT                   /db_xref="UniParc:UPI00005207FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE69"
FT                   /transl_table=1
FT                   /translation="MNPQVTNLAIILVMMQLAKKVPFDNPDVLFLVRCIYLASNVIILG
FT                   LYMYTQSKINQKKDMTTLKYVEPAPMGSGEEPRPVTTTNMDYDKGQLRQLMKSQLMGVG
FT                   MMGVMHLYFKYTNPLLIQSIIPLKSALESNLVKIHVFGKPATGDLQRPFKAANSFLSQG
FT                   QVKTDKASVENAEKNFRGGVKEE"
FT   CDS_pept        join(503797..503811,503888..503923,504046..504123,
FT                   504194..504881,504938..505108,505166..505194)
FT                   /codon_start=1
FT                   /gene_family="HOG000071678" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057447"
FT                   /orf_name="AFUA_5G01970"
FT                   /product="Glyceraldehyde 3-phosphate dehydrogenase GpdA "
FT                   /EC_number="1.2.1.12"
FT                   /function="NAD or NADH binding"
FT                   /function="glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating) activity"
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86107.1"
FT                   /db_xref="GO:0004365"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG269967"
FT                   /db_xref="HOGENOM:HBG571736"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniParc:UPI000051F7AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE70"
FT                   /transl_table=1
FT                   /translation="MATPKVGINGFGRIGRIIGLNSLSHGLVDVVAVNDPFIEVHYAAY
FT                   MLKYDTTHGQFKGTIETYDQGLIVNGKKIRFYAEKDPSQIPWSETGAAYIVESTGVFTT
FT                   KEKASAHLKGGAKKVIISAPSADAPMFVMGVNNTTYTSDIQVLSNASCTTNCLAPLAKV
FT                   INDKFGIVEGLMTTVHSYTATQKVVDAPSNKDWRGGRTAAQNIIPSSTGAAKAVGKVIP
FT                   SLNGKLTGMAMRVPTSNVSVVDLTCRLEKGASYDEIKQAIKAASEEGELKNILGYTEDD
FT                   VVSSDLNGDERSSIFDAKAGISLNPNFVKLVAWYDNEWGYSRRVVDLIAYIAKVDSQ"
FT   CDS_pept        join(506275..506923,506985..507224,507385..507523,
FT                   507580..507692,507743..507870,507918..508128,
FT                   508521..508642,508711..508906,509108..509118)
FT                   /codon_start=1
FT                   /gene_family="HOG000161343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268483"
FT                   /orf_name="AFUA_5G01980"
FT                   /product="Histone deacetylase HdaA "
FT                   /protein_id="EAL86106.1"
FT                   /db_xref="HOGENOM:HBG055480"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR019154"
FT                   /db_xref="UniParc:UPI000051E718"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE71"
FT                   /transl_table=1
FT                   /translation="MAMEQDGDTLMGEAGPHLPSGSASHGHPTSNPSMPAIPGNLNGGT
FT                   DPWLAPPLLGQSMNLPLPAQLGDQHAAAPVAQAQPTVPSSAPEQSAGLSAAVTEPAKRA
FT                   DSIVEETSDWSEEDLGARVGLPLASLPSGLCYDVQMRYHCEVRPTADVHPEDPRRIYYI
FT                   YKELCRAGLVDDPESSRPLVARPLKRIHARNATEAEISLIHTPDHFAFVESTKDMSDDE
FT                   LIALEHTRDSIYFNKLTFASSLLSVGGAIETCLAVATRKVKNAIAVIRPPGHHAEHDKT
FT                   MGFCLFNNVSIAARVCNGIQKAFYDDPNVLYISLHVYQDGKFYPGGDEGDWDHCGADAG
FT                   IGKNVNIPWPSQGMGDGDYMYAFQQVVMPIAQEFNPDLVIVASGFDAAAGDELGGCFVT
FT                   PSCYAHMTHMLMTLAHGKVAVCLEGGYNFRSISKSALAVTKTLMGDPPDRLHSTLPSDL
FT                   ATSTVRRVMMIQSRYWRCMYPKVPQEQGLWTDRLHGSTAYANKGKADCMKNYIGWAVGK
FT                   GYAVIDVNIPKHVTIEPTRMRIGLRLPRNWPDTCGTTTLSKFLRRLLLGNTVNCPRPNE
FT                   ATEIFFIGIGNAFYGVANLLINRASN"
FT   CDS_pept        511005..511475
FT                   /codon_start=1
FT                   /gene_family="HOG000161332" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268484"
FT                   /orf_name="AFUA_5G01990"
FT                   /product="BYS1 domain protein, putative "
FT                   /protein_id="EAL86105.1"
FT                   /db_xref="HOGENOM:HBG055479"
FT                   /db_xref="HOGENOM:HBG324021"
FT                   /db_xref="InterPro:IPR006771"
FT                   /db_xref="UniParc:UPI0000520331"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE72"
FT                   /transl_table=1
FT                   /translation="MHFTTPLLGLAALIPLASAVGNAVVTNKCDAPVYLWSVGGSVGPK
FT                   QTIQPGKSYSEALHHDPASGGIALKITRTDNGLYDGSPQLNCAYTLDGQTVWYDLSDVF
FT                   GDPFSGSALVVKPATGTCPSICWPNGVSPGGSQVKNCDANGDIVLTLCAEGC"
FT   CDS_pept        complement(511853..513058)
FT                   /codon_start=1
FT                   /gene_family="HOG000084336" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904170"
FT                   /orf_name="AFUA_5G02000"
FT                   /product="Proline racemase, putative "
FT                   /function="proline racemase activity"
FT                   /protein_id="EAL86104.1"
FT                   /db_xref="GO:0018112"
FT                   /db_xref="HOGENOM:HBG015124"
FT                   /db_xref="HOGENOM:HBG333420"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniParc:UPI000051E49D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE73"
FT                   /transl_table=1
FT                   /translation="MDIVQFLEETSSNQPIRCIDMHTTGEPTRIIYSGFPPLSGTLLEQ
FT                   RDQAKQHHDHIRKCLMLEPRGHNGMYGAIIRPETELVSSGAAHIGVLFIHNEGFSTMCG
FT                   HATIALGRFLVDTHDYSVFPRRQDLVFEVDTQTVKLDIHAPCGVVRVTVPVTADGRKSD
FT                   PSRPVTFLSTPAFATRIQMTVPVAPEIRWPELRDRDSIVLDISYGGAFYAIVQASELGF
FT                   SGGLRDLDLDAMTRCIQKLKPCLMGLAEVQAAVQHPHDQRLAFLYSVMIVDDTLGFQPD
FT                   DVQGAETGLCYFAENQIDRSPTGSCVIARMALAYAKGLRSLGQRWAYNSLVSNRFGTGA
FT                   FSAEIVEEVTIDKVDGGCLNAVVVQVEGQAFYTGASVFAVEHEDRISSSGFTMEEVAVS
FT                   RV"
FT   CDS_pept        join(514467..514937,515018..515113,515243..518140)
FT                   /codon_start=1
FT                   /gene_family="HOG000161331" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268485"
FT                   /orf_name="AFUA_5G02010"
FT                   /product="A-pheromone processing metallopeptidase Ste23 "
FT                   /EC_number="3.4.-.-"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL86103.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG006464"
FT                   /db_xref="HOGENOM:HBG328356"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI00005200F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE74"
FT                   /transl_table=1
FT                   /translation="MPPRSFPSLRPWNSGGFYFNPGHLRSFSLVPSIASTAIAPHFSSS
FT                   LRRRLDCPQFLLSRCWPRHTLPRSTVAPFSTAAVTMGSIQRITEHLEKPELDDRSYRVI
FT                   RLSNKLEALLVHDPETDKASASVNVNVGNFSDADDMPGMAHAVEHLLFMGTKKFPKENA
FT                   YNQYLASHSGSSNAYTAATETNYFFEPSSPLYGALDRFAQFFVSPLFLESTLDRELRAV
FT                   DSENKKNLQSDLWRLMQLNKSLSNPAHPYHHFSTGNLKTLKEDPQQRGLEVRSEFIKFY
FT                   QKHYSANRMKLCVLGRESLDELEKWVEELFSEVENKDLPQNRWDDVQPWRHEDLGIQIF
FT                   AKPVMDTRSLDIYFPFLDEETLYESQPSRYISHLIGHEGPGSILAYIKAKGWANGLSAG
FT                   VMPICPGAAAFTISIRLTKEGLQQYREVAKVVFQYIAMLKEREPQQWVFDEMKNMAEVE
FT                   FRFKQKSPASRFTSRLSSVMQKPLPREWLLSGSLLRKFDPDLIKKALSYLRPDNFRLIV
FT                   VSQEYPGDWDSKEKWYGTEYKVGKIPEDFMADIREALDTTPETRLSDLHMPHKNEFVPT
FT                   RLSVEKKEVSEPAKTPKLIRHDDHVRLWFKKDDRFWVPKGTVHITLRNPLAWATPANLV
FT                   KSKLYCELVKDALVEYSYDAELAGLDYHLSASVFGLDVSVGGYNDKMAVLLEKVFTSMR
FT                   DLVVNPNRFHIIKERLSRGYRNAEYQQPFYQVGDYTRYLTSEKTWINEQYAAELEHIEA
FT                   EDISSFFPQLLSQNHIEVLAHGNLYKEDALKMTDLVENILQSRPLPQSQWHVRRNIIIP
FT                   PGSNFIYERTLRDPANINHCIEYYVYVGSITDDMLRAKLLLFAQMTDEPAFDQLRSKEQ
FT                   LGYVVWSGARYSATTIGYRVIIQSERTAEYLESRIDNFLIQTGETLENMSEKDFEGHKR
FT                   SVINKRLEKLKNLSSETSRFWSHIGSEYFDFLQNESDAANVRALTKADIVDFYKQLIDP
FT                   RSPTRGKLSIYLNAQGGAHAKLEGKDQQSRLVSLLGKQLEGAGFAVDTSRLSSVFESAD
FT                   LSASDADQLLAVLKKFLLSEMSLSEQQTALVLEQARQNIGLHAKQLGIETVEKDSKPVT
FT                   NGVGQPKTDRKVTYITNVPEFKARMVMSAGPIAVTDITEFEDFDAKL"
FT   CDS_pept        join(519080..519376,519436..520101)
FT                   /codon_start=1
FT                   /gene_family="HOG000250286" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057448"
FT                   /orf_name="AFUA_5G02020"
FT                   /product="Aldehyde reductase (GliO), putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86102.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000052059C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE75"
FT                   /transl_table=1
FT                   /translation="MANSHAQIIFGGALFGTLPEWSTPEKVEEFLQVLERNNVKIIDTA
FT                   QIYGASEENLGQVKAAKRFIIDTKLGGGFAPGSATKDQAIKTGDESLAKLGTDSVNVYY
FT                   IHSPDRQIPLEETLAGINELHKAGKFKHFGLSNFRPEEVQEVVRIAKEKGYVLPSVYQG
FT                   NYNAVARRIEAELLPVLRENNIRFYAYSPIAGGFLTKTKEQLLAGGEGRWDPNSAIGQI
FT                   YHRLYNKPAMLEVLDDWAEIAKAEGVTKAELAYRWIFFHSHIREDLGDAVIVGATKISQ
FT                   FEETIAAIQRGPLSADAVKRIDAVWEKIKDVATLDNFNA"
FT   CDS_pept        join(520484..520692,520793..521044,521143..521390,
FT                   521459..521754)
FT                   /codon_start=1
FT                   /gene_family="HOG000161320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268486"
FT                   /orf_name="AFUA_5G02030"
FT                   /product="Cleavage and polyadenylation specific factor 5 "
FT                   /protein_id="EAL86101.1"
FT                   /db_xref="HOGENOM:HBG055478"
FT                   /db_xref="HOGENOM:HBG629877"
FT                   /db_xref="UniParc:UPI000051EB9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE76"
FT                   /transl_table=1
FT                   /translation="MPGIRSNVFAGQLRSATTELQHATSDLHINPSNSKGLLASGPQKQ
FT                   IWTLLEYTLSKMSTTTATSMQSSHPPIIPKDFSAQQPKTIRLYPLSNYTFGTKETQPEE
FT                   DPSVLARLKRLEEHYEKHGMRRTCEGVLVCHEHNHPHVLMLQIANAFFKLPGDYLHFDD
FT                   DEVEGFKKRLNERLAPVGSQFSGEGVNEDWEIGDTLAQWWRPNFETFMYPFLPGHVTRP
FT                   KECKKLYFIQLPKKKVLSVPKNMKLLAVPLFELYDNTARYGPQLSAIPHLLSRYNFEFV
FT                   DENDNVVAATPGAPLPEHQIPRTKVLAGETNDGQDAGMTDYTEGGENGGENAQ"
FT   CDS_pept        join(523291..523378,523433..523598,523640..523985,
FT                   524041..524340)
FT                   /codon_start=1
FT                   /gene_family="HOG000161299" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268487"
FT                   /orf_name="AFUA_5G02040"
FT                   /product="Extracellular lipase, putative "
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid catabolic process"
FT                   /protein_id="EAL86100.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="HOGENOM:HBG055477"
FT                   /db_xref="HOGENOM:HBG325409"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR005592"
FT                   /db_xref="UniParc:UPI00005200F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE77"
FT                   /transl_table=1
FT                   /translation="MVHFKSVCTLAVTAFAALGAAAPAMLAKRDVSSSVLQKLSLFAQY
FT                   SAASYCTNNINSTGNKLTCSSGECPLVEAANTKTLSEFYEVGSDSAYGDVAGFLVADTT
FT                   NKLLVVSFRGSRTIDTWLANLDFGLDSISDVCSGCAVHKGFWKSWEVVANALTTELNSA
FT                   LATYSGYTVVFTGHSFGAALATLGAATLRKAGIPVELYGYGSPRVGNKALATFITGQGS
FT                   NYRVTHTNDIVPRLPPRVFGFSHISPEYWITSGDNAPVTTSDVTVVQGIDSSGGNAGED
FT                   STSIEAHNWYIGHIDGCQ"
FT   CDS_pept        join(524906..525285,525346..525788,525860..526068)
FT                   /codon_start=1
FT                   /gene_family="HOG000161288" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16268488"
FT                   /orf_name="AFUA_5G02050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86099.1"
FT                   /db_xref="HOGENOM:HBG055476"
FT                   /db_xref="HOGENOM:HBG328357"
FT                   /db_xref="InterPro:IPR021838"
FT                   /db_xref="UniParc:UPI000051F551"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE78"
FT                   /transl_table=1
FT                   /translation="MLFFGTGVQSPRRRNKEKAIFVTVVIIYALYFLFFTKKSTDRESA
FT                   VSVHHPVHDEGANRDARSGQASPSRDTRIEKDMVVASMKSDNTSWLFENFPDWHKSVYV
FT                   VDDKNAELTVPQNKGRESMVYLTYIIDNYDHLPDVMLFIHSQRFQWHNDDPYYDGVPVL
FT                   RRFQVSYLQKQGYVNLRCAWTLGCPAEIHPHTDTHRDDVHAGEYFKNGFMELFPGVDVP
FT                   DEVGVSCCAQFGVTNWKVRERPKSDYVRFRKWLSETPLKDDLSGRIMEYSWHMIFGQGP
FT                   VFCPTAEECYCKVFGLCDLTCPNERECAGRYVLPPYSTLPQGWPYIGWKGQQQDPSTGL
FT                   PET"
FT   CDS_pept        526816..527634
FT                   /codon_start=1
FT                   /gene_family="HOG000020768" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16268489"
FT                   /orf_name="AFUA_5G02060"
FT                   /product="Dephospho-CoA kinase, putative "
FT                   /EC_number="2.7.1.24"
FT                   /function="ATP binding"
FT                   /function="dephospho-CoA kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL86098.1"
FT                   /db_xref="GO:0004140"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="HOGENOM:HBG460048"
FT                   /db_xref="HOGENOM:HBG650290"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="UniParc:UPI000051EDC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE79"
FT                   /transl_table=1
FT                   /translation="MLIIGLTGSIATGKSTVSALLASPPYSLPIIDADLLARQVVEPGT
FT                   PAYKAIVNYFGPSTPDLLLPPSDGDATSSQPPLNRPALGRRVFGTSEERKRDRMILNKI
FT                   VHPAVRWEIYKALIYYYVRGHWAVVLDVPLLFESGMDLICGTVVVVGVRDPAVQMARLR
FT                   SRDPHLSAEDAENRVRSQGDVRGKVEKAEFRGTGSARGVIVWNDGDKADLEKEVSKAME
FT                   MIKASSPNWWAWVLLLAPPLGVGIAAWNLAVNFATQKSWQKKEREEKAKL"
FT   CDS_pept        join(complement(529017..529406),complement(528782..528856))
FT                   /codon_start=1
FT                   /gene_family="HOG000161277" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057449"
FT                   /orf_name="AFUA_5G02070"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86097.1"
FT                   /db_xref="HOGENOM:HBG055475"
FT                   /db_xref="HOGENOM:HBG330359"
FT                   /db_xref="UniParc:UPI000051F2C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE80"
FT                   /transl_table=1
FT                   /translation="MQRAAATAASKETPQTSSPEGSTTSTPKRPRLSSEGVSQSPGAAQ
FT                   SSDLEAISAALAAEEEKRREAIARQAADAGETEWVLDYSGAEDTGNEYATQPLVLAAES
FT                   LDADDDDLVHGGRQAYGNFKRKGKVELSSISGGRHSFGGGEKSQKKRKHK"
FT   CDS_pept        join(529890..530237,530315..530482,530536..530664)
FT                   /codon_start=1
FT                   /gene_family="HOG000161276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057450"
FT                   /orf_name="AFUA_5G02080"
FT                   /product="NADH-ubiquinone oxidoreductase "
FT                   /protein_id="EAL86096.1"
FT                   /db_xref="HOGENOM:HBG055474"
FT                   /db_xref="HOGENOM:HBG330358"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniParc:UPI000052033A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE81"
FT                   /transl_table=1
FT                   /translation="MLSCARSRVAAFSTAWTPRFVARASYSTTMPRLTENRMQANDPTS
FT                   RTPEPNVSATNATPTDSQGVWDAPLREEPEAGERNRQLQAPNRATTWAASQQPREKAMT
FT                   GPRFEQTIMELQPQPMAAIELIHKQPVRWTNKRIVSCDGGGGPLGHPRIFINTDKPEIA
FT                   TCGYCGLPFAHEQHRAYLKSLPATSYPLEPTGDATEANETQRVTDGAFEQR"
FT   CDS_pept        join(complement(531245..531520),complement(531007..531165))
FT                   /codon_start=1
FT                   /gene_family="HOG000123401" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057451"
FT                   /orf_name="AFUA_5G02090"
FT                   /product="UPF0047 domain protein"
FT                   /protein_id="EAL86095.1"
FT                   /db_xref="HOGENOM:HBG398986"
FT                   /db_xref="HOGENOM:HBG409904"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="UniParc:UPI0000520330"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE82"
FT                   /transl_table=1
FT                   /translation="MSWFQKTFTLPPRSRGSYLITDEVLSQLPEIRNYKVGMLNLFVQH
FT                   TSCALSLNENWDEDVRADMSDALDRIVPTDRKGNLYRHSAEGEDDMPAHIKSALVGASV
FT                   NIPITNGRLATGTWQGIWYLEFRTSRHTRKVVATIQGEKA"
FT   CDS_pept        join(complement(532558..532916),complement(532177..532504),
FT                   complement(532013..532123))
FT                   /codon_start=1
FT                   /gene_family="HOG000161247" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209022"
FT                   /orf_name="AFUA_5G02100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86094.1"
FT                   /db_xref="HOGENOM:HBG055473"
FT                   /db_xref="HOGENOM:HBG330357"
FT                   /db_xref="InterPro:IPR008701"
FT                   /db_xref="UniParc:UPI000051F7CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE83"
FT                   /transl_table=1
FT                   /translation="MSKLLSQGGVELADRYAPLWFFGQAQKQPPCYPTWAFGGSPTSSD
FT                   IYDDAHKTPPAPQCEYPNVGCRCRNPGVGIGNRGPPFPIYFTYKRCSDTEVRVVYNLFY
FT                   EKDGADVIGIETGHDYDWERVIIIHSRDANNMWAPTRALLSAHSGYHDLAWGDIQNTLT
FT                   TDEINAGDAKNPNGVQNNDHPKVYVAWSKHAHFDDRNTGWNDPISQSTDNAFRSDDWWY
FT                   YVDKSYYILSDDTTAAGKALGSANWGDATSNPPSVHASVCSAP"
FT   CDS_pept        join(complement(534147..534384),complement(533781..534079))
FT                   /codon_start=1
FT                   /gene_family="HOG000161236" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269471"
FT                   /orf_name="AFUA_5G02110"
FT                   /product="Putative uncharacterized protein "
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="EAL86093.1"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="HOGENOM:HBG055472"
FT                   /db_xref="HOGENOM:HBG330356"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI000051EB9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE84"
FT                   /transl_table=1
FT                   /translation="MPAKGLSIPKPNVSSASSERPMESEEWKRRPPYLIQSPEEFGPVK
FT                   WQAKCQCGQVTYKISREKPLKAKYCHCRGCQVMHGAPFQWAAIFHKSDLTFDRGAHGLS
FT                   FYSSAHSTREYEVPTKVSCSFCRTPIMDEGRNVCLIFPEAIVAGDSDKERQGWREAFAP
FT                   EYVITSQQLLSEIPG"
FT   CDS_pept        join(536006..536325,536403..537729)
FT                   /codon_start=1
FT                   /gene_family="HOG000161225" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209023"
FT                   /orf_name="AFUA_5G02120"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL86092.1"
FT                   /db_xref="HOGENOM:HBG055471"
FT                   /db_xref="HOGENOM:HBG330355"
FT                   /db_xref="UniParc:UPI000051FEC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE85"
FT                   /transl_table=1
FT                   /translation="MGLFTRLRRRSKSHSRAGNAASYEHLRISPDHSVPPVPTLRRDFA
FT                   KILPPPVLARIFAFVCPHAADSSYATSEESMTEDGCMLCDMRDLAHCAVVCKRWYPAAR
FT                   SVLYSHVRIDAVHYCELEVRLAARRKRRSFFDRNGDPIDAPQARLELFMRSVRNSDELG
FT                   NMVLSLRMPYMTREANKAGIARTISVCPNLRYVDLPAGLYSDDPTCLALKQELMARCPD
FT                   IRRMAYRHGSEGSFSQLPGSRLWMNLEILELSRLQIEPNILRFGLGAFPYLRELTLEDL
FT                   PWLDDSAFRHSQSLPPFPAVQRLTLRDTPKVTASGLAAFFSLPVNRKSLHSLTLSATGV
FT                   LPSTLYQILASAPCLQGLFFIQEVSRSFPTEQVPPLASTSLSMLHYEITSSNTSYGLPP
FT                   IAASYYTYLVSSLMLNCLPALRDLYVRDASFPEALLLAPPPRIFGGGENGPQIPAGGLS
FT                   QPLNVYSKGLDELEWNFTPYEPPQTRGRRESTTRPVSFHDAQLSRSWGGDARKSVLVGN
FT                   GFGGFLAVPVDEDRPKSSGGWRRQSRQDLWR"
FT   CDS_pept        join(complement(540892..541048),complement(540701..540841),
FT                   complement(540558..540647),complement(540199..540495),
FT                   complement(539954..540138),complement(539481..539891))
FT                   /codon_start=1
FT                   /gene_family="HOG000161224" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269472"
FT                   /gene_name="aglB"
FT                   /gene_synonym="agl5"
FT                   /orf_name="AFUA_5G02130"
FT                   /product="Probable alpha-galactosidase B "
FT                   /EC_number="3.2.1.22"
FT                   /function="alpha-galactosidase activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL86091.1"
FT                   /db_xref="GO:0004557"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG424315"
FT                   /db_xref="HOGENOM:HBG492478"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051F2D2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WE86"
FT                   /transl_table=1
FT                   /translation="MSRSKTRQGKLPALGWNTWNAFGCDIDATKIMTAANEVVNLGLKD
FT                   LGYEYINIDDCWSVKSGRDASTQRIIPDPDKFPDGISGVADQIHDLGLKIGIYSSAGLT
FT                   TCAGYPASLGYEDIDAQTFAEWGIDYLKYDNCGVPSNWTDTYTYCVPDPGSKATNGTCP
FT                   DNKNPAPAGYDWRTSLTAERYRRMRDALVSVDRTILYSLCEWGQANVNDWGNETGNSWR
FT                   TTGDITPSWPRIAAIANENSFLMNHVDFWGYPDPDMLEVGNGNLTLAENRAHFALWAAM
FT                   KSPLIIGTALDSISQDHLAILSNKILLKFHQDPVIGRPAQPYKWGYNPDWTFDPAHPAE
FT                   YWSGASSVLGGTLVLMLNSEDTTQRRTAVWKEVPELKDVLGRQGKRRIGFRVTDVWTGK
FT                   DLGCVRDHYSVELESHDVAALVVGRAC"
FT   CDS_pept        join(complement(545860..545907),complement(543467..545795),
FT                   complement(543202..543411),complement(542889..543148),
FT                   complement(542170..542837),complement(542042..542120))
FT                   /codon_start=1
FT                   /gene_family="HOG000161203" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752307"
FT                   /orf_name="AFUA_5G02140"
FT                   /product="Inositol polyphosphate phosphatase, putative "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="EAL86090.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG055470"
FT                   /db_xref="HOGENOM:HBG330331"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000051FC74"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE87"
FT                   /transl_table=1
FT                   /translation="MEGSGKDKDGTDNAPIRPVSSLLSHFENLSHRRSPSAFTATSPHD
FT                   STPFLRTPEPVDEVRSARASLDLPRAQSPWNATAKPQNAQRYDRTNGGFSRRSGSPGRS
FT                   PGRRQSRPMSMNFHSSPQLAPTLTVDSPRSPPRGFGSQNHTERTINSRMSRSPPDPSRG
FT                   SLPPPTNRPTTPSSSTFQHLPGHLSPAHSHSGSFIGESPPDRKQKSSSLPPPIDRAEKP
FT                   KVPAKPAALASLEGATLALKPEKTTSEDRISPFSTPPGSPEKPSVKPSSCGRPQMPRSP
FT                   SRPVTEPPSRQSFDDRGPVSSAHALRDARELGFSRRRPIPEPTRDMKPLMVQVPPHSMK
FT                   QTEPLSAAPLSARRLQATDAPTEPPSLPPRHSSLARRSGASPSRPSPHLEGSSHPEPSP
FT                   RPQSFQPPPRENQTPLQIHRQPSFSRDAKPGQASSVPERQLARADTFGQDPVDEPAISR
FT                   TDYPDASTTNRRPPLLKNGPREIHTRYDTRLMDVCGRHVCTTGYLTRVWDLTNGEQIMS
FT                   LSHGETVKSLSIAFKPGTGLEDEGQRLWLGMSTGEIHEVDISTRSIVATRFYPSRREVI
FT                   KILRHKKEMWTLDDEGRLLVWPPDESGTPNLQYSYHNPYDRVARGHTFSLVVGDTLWLA
FT                   TGKEVHVYRPNARDDVSFKVLKKPLGSQHTGDVTSGIYTTRDGGRVYMGHADGKVTVYS
FT                   STDYACLAVVNVSVYKINCLGVVGDYLWAAYKTGMIYVYDTRTNPWIVKKDWRAHDGPV
FT                   SSFLLDFSSVWTMNRLQVTSLGDDNCIRLWDGMLEDDWLETRMQSRDVEFCKFREISAA
FT                   IVTWNAGASTPGSVRSSNFIQEAIHPENPPEILVFGFQELVDLENKKITAKSLLLGSKK
FT                   KDGGEKEHMSRQYRVWMEHLTRCINDCMPLEESYVLLHSANLIGLFTCVFVKHKERQRI
FT                   KNIGAAEVKRGMGGLHGNKGALILRFILDDSSLCFVNCHLAAGQSQTAHRNNDIAAILE
FT                   SEVLPVENSLTTRANHFVSGGDGTMIMDHEICILNGDLNYRIDSIPRNVIIEDIRNNNL
FT                   AKLLERDQLLASRRKNPGFRLRSFTEAPITFAPTYKYDVGTDEYDSSEKKRSPAWCDRV
FT                   LYRGLGRIKQLDYRRHEVRASDHRPVSASFKLRVKTVLPQERAAVWESCQQEFQKEKRR
FT                   LASEASIEYLISVLGTDPQQARALILGTGSP"
FT   CDS_pept        join(complement(548527..548545),complement(548061..548448),
FT                   complement(547635..547983))
FT                   /codon_start=1
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057675"
FT                   /orf_name="AFUA_5G02150"
FT                   /product="Proteasome component Pre6, putative "
FT                   /EC_number="3.4.25.1"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="EAL86089.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000051E4A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE88"
FT                   /transl_table=1
FT                   /translation="MEAVKRGTCAVGVKGKDVVVLGCEKRSALKLQDTRITPSKIAQLD
FT                   NHAVLAFAGLNADARILIDKARLEAQSHRLTVEDPVTIEYITKYIASVQQRYTQSGGVR
FT                   PFGISTLVVGFDPNDKVPRLYMTEPSGIYSAWKANAIGRSSKTVREFLERNHQDDMDRE
FT                   QTIQLTIKSLLEVVQTGAKNIEVAIMAPGKTIEMLPDDQIEAYVKSIETEKQEEAAKKK
FT                   TGRTGTTTAAILTRPGGGETGESTRESAD"
FT   CDS_pept        join(complement(552053..552208),complement(551845..551902),
FT                   complement(550975..551681),complement(549993..550913))
FT                   /codon_start=1
FT                   /gene_family="HOG000161181" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269473"
FT                   /orf_name="AFUA_5G02160"
FT                   /product="RNA binding protein (Arp), putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL86088.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG330329"
FT                   /db_xref="HOGENOM:HBG435079"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniParc:UPI000051F7B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE89"
FT                   /transl_table=1
FT                   /translation="MATVSAPTPKLDRYIVIHVATTCDEHGVYVTKDSAEVIELGWILL
FT                   DTKTCEELHRESVLVKPVNTPITPLCTSLTTLTWEHVRSAGTFRDAINRFDAFAQEHLI
FT                   SKNLEFAFVTLDSWDLRVQLPREARDKAVVLPPYLQHSRTFDLRTEYQRWQTHHPESLP
FT                   FGPSSLSNICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAITLARVLRGLIR
FT                   KSQPPHEHPEILTRPMDARADVRAFLTERSKVLHLSGLPHDTTQSELESWFTQFGGRPI
FT                   AFWTLRTPDQHKPTGTGFAVFSSHEEAAESLCMNGRALNEKAIEVSPSSSRVLDRAAEI
FT                   LTPFPPSKNRPRPGDWTCPSCGFSNFQRRTACFRCSFPAMAAAPDPMGYGAYGYGPPSM
FT                   MPSHMAHGHGMGHPRGMGGNGGVVPFRAGDWKCGSEGCGYHNFAKNINCLRCGAPRSGA
FT                   AVVADSAFPSPMDPPAGFGMGPNSMTSTPAPGPFTSAAGGFGGFNQQFAAPPNNYALPS
FT                   GLGSAPGAYPPMGQMNAAYGSTSASHTTSSFSNPATQAAFSGADHTTSTSTSNGGFYAT
FT                   DGSNDPFAFLSTGLGGLTVSDDAHSRRNGTGASKSPA"
FT   CDS_pept        join(complement(556405..558486),complement(555058..556338))
FT                   /codon_start=1
FT                   /gene_family="HOG000161170" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269474"
FT                   /orf_name="AFUA_5G02170"
FT                   /product="Nuclear condensin complex subunit 3, putative "
FT                   /function="binding"
FT                   /protein_id="EAL86087.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG055468"
FT                   /db_xref="HOGENOM:HBG330327"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051FEE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE90"
FT                   /transl_table=1
FT                   /translation="MPGRVSARSTSAPTRRSSAQPSASGGRAASVTPSFVIPEEPAPPE
FT                   ASPNLRRDICVIFADAQRSTTGHRKLVVRLRKLQEICCGISRKTKKDGKGPEVQEELLL
FT                   PSEETIPEKEFNVEVGRCLLRILPIKKTEPVGDRILRFVGTFLSHATEKDTEIFASGND
FT                   EDEMQNIIETPTARLATHLISVIVPLLSAKDKIVRFRATQIVTHIINSLDTIDDDLYHT
FT                   IRQGLLKRIRDKEPSVRVQAVLGLGRLAGNEEEDDDDNDDSSKALLEKLIDIMQNDTSA
FT                   EVRKTLLLNLPLVPATLPYLLERARDLEATTRRALYSRLLPTLGDFRHLSLSMREKLLR
FT                   WGLRDRDESVRKATGKLFYDRWIEDCAGTNNDSENGPSTQRSPPNIPALLELLERIDVV
FT                   SSGMDSGIAHEAMGSFWEGRPDYREAVVFDEPFWESLTAESAFLLRSFNDFCRVENEGK
FT                   FDRLADEKIPEVTAFAHFLKKYMTELLQRKKMAKDTSEANDDDTVENEFIVEQLLHIAI
FT                   TLDYSDEVGRRKMFSLLRESLAVPELPEECTKLTVETLRCVCGPAAAAESEFCSVVLEA
FT                   IAEVHDTIATEDSFVSAKSEISDATSSRQRSVTPADSEAEVPFNKEEAKAKVLREIVVN
FT                   MKCLHIAQCMLQNVEGNLQQNMNLVTMLNNLVVPAVRSHEAPIRERGLVCLGLCCLLDK
FT                   TLAEENMTLFIHCYSKGHEALQVTALHILCDIITTHPSLLAPVPQSDGETVSPPAFQKP
FT                   LIKVFARALKANSPNSVQAAAATGLSKLLLTNTFTPSGANIPQAIQEYNESAVETLLQS
FT                   LIVSFFHPRTRENPAFRQALAYFFPVYCHSRLENTQHMRKVTVPVIRAVLNAAEEYYSL
FT                   EAEEDSDGEIDETVGQRELKALMAGVVGMLAEWTDERRVVGLGGEKILAGVPTSSSPCG
FT                   FVHLALVKDILERVLGISTGPNRCSKEEKKLLFSLLSKLYISPPVVPSRSGSRMPEGDD
FT                   QFRSSIQSASGGEISPENVALAQEVKELLDETIQEGVAAEAAGRNALVKVKNAVLKLLA
FT                   AAQGIRSDSVRPREGTEEPESDAMSIRSGSVQPSIEHPGKRRRMFSVEPSIMEEDENDD
FT                   SRGTIIKSEAHDD"
FT   CDS_pept        join(559098..559215,559289..560286)
FT                   /codon_start=1
FT                   /gene_family="HOG000217393" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269475"
FT                   /orf_name="AFUA_5G02180"
FT                   /product="Cysteine synthase (O-acetylserine "
FT                   /EC_number="2.5.1.47"
FT                   /function="cysteine synthase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity"
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /protein_id="EAL86086.1"
FT                   /db_xref="GO:0004124"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG370933"
FT                   /db_xref="HOGENOM:HBG748215"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI000051E706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE91"
FT                   /transl_table=1
FT                   /translation="MFRQSVRRFGTTALRAVEASTAYHERVSRAQGVVNGLTEAIGNTP
FT                   LIRLKRLSEETGRNIFGKAEFQNPGGSVKDRAALFVVKDAEEKGLLKPGGTVVEGTAGN
FT                   TGIGLAHVCRSKGYKLVIYMPNTQSQGKIDLLRLLGAEVYPVPAVAFDNPQNYNHQARR
FT                   HAESLENAVWTNQFDNTANRQAHIETTGPEIWAQTDGKVDAFTCATGTGGTLAGITRYL
FT                   KTASDGRVKCFLADPPGSVLHSYIQSGGNLIERSGSSITEGIGQGRVTDNLKPDIDLLD
FT                   GSLTISDEKSIEMVYRCLDEEGLYLGASSALNVVAAKEVAEQLPKGSNVVTILCDGAYR
FT                   YADRLFSNTWLQSKGLRSSIPKHLEKYVVLP"
FT   CDS_pept        join(complement(561683..561745),complement(561579..561619),
FT                   complement(561048..561489),complement(560398..560991))
FT                   /codon_start=1
FT                   /gene_family="HOG000252609" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209024"
FT                   /orf_name="AFUA_5G02190"
FT                   /product="Sulfite oxidase, putative "
FT                   /EC_number="1.8.3.1"
FT                   /function="electron carrier activity"
FT                   /function="molybdenum ion binding"
FT                   /function="sulfite oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86085.2"
FT                   /db_xref="GO:0008482"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG299145"
FT                   /db_xref="HOGENOM:HBG326850"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI0000F51C97"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE92"
FT                   /transl_table=1
FT                   /translation="MTMSTTPANSLEDDLYGKSPTPLNREPPVKQLVASFLTPADISYD
FT                   RNHGPIPHLSADSHKVHVDGLVSTPLSLSIQQLASEFPQHEVICTLECAGNRRHTMRTM
FT                   LKEVQGIDWGDAAVMNCKWRGPRLRDVLLRAGVKASQEGLHVEFSCYQVKCQEDGWFGA
FT                   SVPLERCLGEDGDAVLALQMNDAPLPVNHGYPVRTILPGIVGARWVKWLDRITVSDHES
FT                   PNFYQQHDYKVLPPAAVDQESAQPFWAQTPPMSDMPINSVVAVPEDNETVALSSSGVME
FT                   VKGYAVPHGADGPVTRVQVSVDGGRTWIDAKIEESGDGNRRWCWVLWSAAVCPEVGTGR
FT                   EVLSRAFDAAGNVQVEHSQWNLRGVGYNGYGRAQNLTII"
FT   CDS_pept        join(complement(562902..562997),complement(562754..562849),
FT                   complement(562351..562686))
FT                   /codon_start=1
FT                   /gene_family="HOG000161169" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269476"
FT                   /orf_name="AFUA_5G02200"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit (TIM22), putative"
FT                   /function="protein transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL86084.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG113205"
FT                   /db_xref="HOGENOM:HBG594005"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="UniParc:UPI000051FA1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE93"
FT                   /transl_table=1
FT                   /translation="MSFPGMTPPIGGMGGANNMQGMSDQEQAMVKAMHAAMESCPVKTA
FT                   ISGTMGFALGGAFGLFMASMSYDSAFTPQGAALSDLPWREQLRRGFKDMGARSWSSAKN
FT                   FGIVGALYAGTECCIEGLRAKNDLTNSVAAGCITGGILGAKAGPQAAAAGCVGFAAFSA
FT                   AIDAYMRMPSEE"
FT   CDS_pept        join(complement(563916..565378),complement(563628..563844))
FT                   /codon_start=1
FT                   /gene_family="HOG000161148" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057676"
FT                   /orf_name="AFUA_5G02210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86083.1"
FT                   /db_xref="HOGENOM:HBG055467"
FT                   /db_xref="HOGENOM:HBG330326"
FT                   /db_xref="UniParc:UPI000051FA0E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE94"
FT                   /transl_table=1
FT                   /translation="MGSSPGTGDAEPAPEASQTMSPSFQSQRELPPEASAVVQRRPELQ
FT                   QKRSSIPPRPNGAARHTKRLTLNFPINVVPGLESDPSVTSPESMTPATFSAARPSPLPA
FT                   AGAPVVFDDQDDGSSLLTAIASQERKVLELREELQRAEAELDTLKKQWASSEKTKKRTE
FT                   INHRAEPLLPLRSPDRAIHDESSQHSRERSAGTADGSSAVQARRSRDLERRQSLRASVN
FT                   GGTAISANGRRVFQGSHTRALSLLSPVNGPGANQQFGTDAAGNRTTRTPRSATLPSVER
FT                   TATTQMSERPTEDMISQWRRTMPPPSREALVRTGKQMASDLREGLWTFLEDIRQATVGE
FT                   EGINATQSRGVPPARKRDSSSASRSRDRLSVHGGKSSRSPSSARGKAAGTQLSGKDTKS
FT                   VDIDVSFWSEFGIDTAGQKSTKARGASNTPRGATEQETSNNIDVEENWDDWDTPQPKKT
FT                   HTPSSSRSTLESKHDQSPITQNSSPRTSGSFGDWRATQDDFVPDPSVSDGIPWPAITKF
FT                   APSKLTRTASNLMAEWERSLSPSPERKNQLNSPPLDKDDKKD"
FT   CDS_pept        join(complement(568768..568816),complement(568632..568699),
FT                   complement(568400..568567),complement(567739..568340),
FT                   complement(567013..567682))
FT                   /codon_start=1
FT                   /gene_family="HOG000234203" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057677"
FT                   /orf_name="AFUA_5G02220"
FT                   /product="Mst3-like protein kinase, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL86082.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051F2D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE95"
FT                   /transl_table=1
FT                   /translation="MEGDMASRYQMMEELGSGSFGTVYKAIEKSTGEIVAIKHIDLESS
FT                   EDDIQEIQQEISVLATCASPYVTQYKASFLRGHKLWIVMEYLGGGSCLDLLKPGVFSEA
FT                   HVAIICQQLLQGMDYLHSEGKIHRDIKAANVLLSHTGKVKLADFGVAAQLTNIKSQRNT
FT                   FVGTPFWMAPEVIQQAGYDYKADIWSLGITAIEMINGEPPHASTHPMKVLFLIPKEPAP
FT                   RLEGNEYSSAFKDFIAQCLTKDPERRPSAKELLRHKFIRNAGKTEALQELIQRKQDWDA
FT                   GKGVRQNVKYYAESLNTITRLEDDDGWVFDTVKAPPTSIPEDPHDLVSERDTRDRLYDE
FT                   ASELMDNLHMSSPPVPPKHSSNSTVRRNPAADRSPSVRRPKRRSSGVKQPLGVDLTFGN
FT                   SPSTVRQFRRVSDKTGPDSSYNNQYQIAVDENASPKTVYSDSNSKEAQLGRRAYSKAVG
FT                   LACQEVLGTTADQEKREAISRLAEAWSDLEMVDPEGLYHILKTINEKLQRSVITDSRVR
FT                   H"
FT   CDS_pept        complement(569388..571103)
FT                   /codon_start=1
FT                   /gene_family="HOG000230997" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209025"
FT                   /orf_name="AFUA_5G02230"
FT                   /product="Actin interacting protein 2 "
FT                   /EC_number="1.1.1.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86081.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG257711"
FT                   /db_xref="HOGENOM:HBG553036"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI000051EB9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE96"
FT                   /transl_table=1
FT                   /translation="MSSARNFSVALRRARIPRPQCWLRPIIANRAAVPAARSFSVSSVV
FT                   GGNTTREIKYTTNAYPELKRNPNFAEITEQDVKYFKDLLGAQSAVIDGVTADATDDIEP
FT                   FNADWMRKYRGHTKLVLKPQNKEEVSQVLKYCNEKKLAVVPQGGNTGLVGGSVPVFDEI
FT                   VINTSRMNKIRSFDEASGVLVVDAGVILEVADQYLAERDHLFPLDLGAKGSCHVGGNVA
FT                   TNAGGLRLLRYGSLHGNVLGLEAVLADGTIVDSLSTLRKNNTGYDLKQLFIGSEGTIGI
FT                   ITGVAILCPPRPKAVNVAYFGLESYDQVRQAYKEAKGHLSEILSAFELMDGRSQKLVHE
FT                   STGSKYPLEGEYPFYCLVETSGSNAEHDMEKLEGFLEHIMGEGIVADGVLAQDETQFQS
FT                   IWRWREGITEALSHLGGTYKYDVSIPLPELYQLVEDCRERLTTMGFVGDDDSFPVRAVV
FT                   GYGHMGDSNLHLNISVRQYNKEVEKAIEPWVYEWIQKRNGSISAEHGLGLAKKEFIGYS
FT                   QNDTMLKLMKQLKTLYDPVSLAHFSTSFEGTNNVLAWDHEPLQVHLGIKRLHGV"
FT   CDS_pept        join(571955..572153,572320..573035)
FT                   /codon_start=1
FT                   /gene_family="HOG000227713" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057678"
FT                   /orf_name="AFUA_5G02240"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /EC_number="1.1.1.133"
FT                   /function="binding"
FT                   /function="dTDP-4-dehydrorhamnose reductase activity "
FT                   /biological_process="extracellular polysaccharide
FT                   biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86080.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0008831"
FT                   /db_xref="GO:0045226"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG535943"
FT                   /db_xref="HOGENOM:HBG541114"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00005200EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE97"
FT                   /transl_table=1
FT                   /translation="MSTTVLITGATGLLGRQVFNTFKHSGCFVVGQGYSRATPPTILKA
FT                   DLEKPEDIKNLLDEAKLVPLHCAANRSPDLCDKNPEQARRVNVDATRTLAEETSARKAL
FT                   LVYISTDYVFSGKEGEAPYEVDAEPSPTNYYGQLKRDGEIAVLEATKDTGLGIVLRVPL
FT                   LYGTAQNNSESAVNILIDAIWKAQDENAGVKMDDWAQRYPTNTEDVARVCRDIVIKYLK
FT                   ERPRIHELPKVLHFSSEDRMTKYEMCEKLAEVLGLSLAGMIRNKQGNDPNASVQRPYDT
FT                   HLSTKVLKDLGVDVQTTDFVAWW"
FT   CDS_pept        join(573309..573450,574478..576963)
FT                   /codon_start=1
FT                   /gene_family="HOG000161136" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904442"
FT                   /orf_name="AFUA_5G02250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86079.1"
FT                   /db_xref="HOGENOM:HBG055466"
FT                   /db_xref="HOGENOM:HBG330315"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000051FC98"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE98"
FT                   /transl_table=1
FT                   /translation="MTDAGTQPGCTTRSQMNIHDEIQFNITLERAEVAGCVISHYVNHP
FT                   TVAMAMETQTTSMEAGPDQGSLKFSRYRSVRRAATQKQPKQLNTSIPPAPSLPSAPATG
FT                   LHYGTTPTADSINRSMSRYRRQRAPTAPAMAAQPAAPALPTHKTQLNGHDPLRIPEQQA
FT                   VAATAAHVPAMARSVTEPTKTTTNPFSDNAAATEDSEAERERHRQEAMARLTGETIKPA
FT                   PAVSDHRRVTPRTAEGRRRHDDVQEGSRRHHRSDEASEPKRRSLKDKMKLVKPKDRSNT
FT                   ESSAVKSPEPPTGNHFTGVDAPISAVNSGKRSVLVQYGRMSTKMPVMPSTRVHDLLVAA
FT                   SACLTSEIDPPRFIMMESFSQLGLERPLRRYEYVRDILNSWAYDGENALIIVPAASIES
FT                   LRPLEAQNVPIAPPADVTVHIYYSQRPRKWDKRFVTLRSDGQVTVSKKEHGKDQMNACH
FT                   LSDFDVYSPTPDFLKKNVDPPKKICQAIKSQQKSSMFLSTENFVHFFSTNDRAVAEQWH
FT                   QAVQTWRSWYLVHKKGAAQSEDDEEAKSLHQQRVGSSRSKSSHPPQFKPLVDLESVAEQ
FT                   ERASSQHSSPDDQQKSSKTKDIFLRPRRSRERGPPPSSFPKSLAESDTATQPTDGSPFA
FT                   SSGLLGRTYTQRQQAMKEREEREKRANEEPFIAHGLVGSMCTRRGPVSQPASRSNTMTS
FT                   SQAPDMGTGAVKRSLSVNRSKPLVDLTPVYQEPPQHARKGRGVAVEPGVPLIDAATGPE
FT                   PVGGAIPIPPSTTWRRPPVPPEPLSTTETQTRKRSNTIRSTSNQRHQHTAPASPASPVD
FT                   NAQPSEGPFLANSLLARSAQLAVAQSSVPVGHGVATGDRNASKPMLDLTPPNPFAEGSL
FT                   LRNL"
FT   CDS_pept        join(complement(581751..582354),complement(581630..581688),
FT                   complement(581340..581565),complement(579163..581272),
FT                   complement(578457..579099),complement(577630..578397))
FT                   /codon_start=1
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269477"
FT                   /orf_name="AFUA_5G02260"
FT                   /product="ABC multidrug transporter, putative "
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86078.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000051FA29"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WE99"
FT                   /transl_table=1
FT                   /translation="MSVNSQGKYLSEDPGSQDEETIYESTVRSPIDLIWPDETENLRQI
FT                   ATQQSEKSRRRSEAGAPDVTTRTIAEDDPALDPQSAEFNLEKWLRIIVADAQGRGLSPP
FT                   QAGIVFKQLNVSGSGAALQLQDTLGSTLALPFRLPELLRQRHSPSRLILKSFNGLMKSG
FT                   ELLLVLGRPGAGCSTFLKTLCGETHGLDVDPKSVLHYNGVSQTRMMKEFKGEIVYNQEV
FT                   DKHFPHLTVGQTLEFAAAARTPSHRFHDMSRDEYAKYAAQVIMAVFGLSHTYNTILGND
FT                   FVRGVSGGERKRVSIAEMALAATPLAAWDNSTRGLDSATALKFIESLRLLADLAGTAHA
FT                   VAIYQASQSIYDLFDNVTLLYEGRQIFFGPTSTAKGFFERQGWECPPRQTTGDFLTSIT
FT                   NPQERRPRAGMEKIVPHTPEDFEKYWLQSPEYRRLQEQIERFETLHPPGDDEKAAAHFR
FT                   KRKQGVQSKSSRKGSPYLISVPMQIKLNTRRAYQRLWNDISSTLSTVIGNVVMALIIGS
FT                   VFYGTANTTAGLSSRGATLFFAVLLNALTAMSEINSLYSQRPIVEKQVSYAFYHPSTEA
FT                   IAGVISDIPVKFVLAVVFNIILYFLANLRREASQFFIYFLITFIIMFVMSAVFRTMAAV
FT                   TKTASQAMGLAGVLILALIVYTGFVLPVPSMHPWFEWIHYINPIYYAFEILVANEFHGR
FT                   DFPCASFVPAYADLSGDSFSCSTSGSVAGQTTVNGDRFIYYNFKYSYNHVWRNFGILMA
FT                   FLIGFMAIYFLASELNSSTTSTAEALVFRRNHQPQHMRAENGKSTSDEESGIEMGSVKP
FT                   AHETTTGELTLPPQQDIFTWRDVCYDIEIKGEPRRLLDHVSGWVKPGTLTALMGVSGAG
FT                   KTTLLDVLAHRTSMGVITGDMFVNGKALDTSFQRKTGYVQQQDLHLETATVRESLRFSA
FT                   LLRQPPTVSIQEKYDYVEEVIRMLRMEEFAEAIVGVPGEGLNVEQRKLLTIGVELAAKP
FT                   KLLLFLDEPTSGLDSQSSWAICSFLRRLADSGQAILCTIHQPSAILFQEFDQLLFLAKG
FT                   GKTVYFGPVGDNSRTLLDYFESNGARKCGELENPAEYMIEVVNAKTNDKGQYWYDVWNQ
FT                   SPESRAVQEEIDRIHEERKATHQEDDDQAHTEFAMPFWFQLYVVSRRVFQQYWRMPAHI
FT                   ASKWGLAIMAGLFIGFSFFDAKASLAGMQTVLYSLFMVCSVFASLVQQIMPLFVTQRSL
FT                   YEVRERPSKAYSWKAFLIANIVVELPYQIVMGILTFACYYFPIVGASQSTERQGLVLLY
FT                   CIQFYVYASTFAHMVIAAIPDTQTASPIVILLFSMMLTFCGVMQSPSALPGFWIFMYRL
FT                   SPFTYWVGGMGATQLHDRNVICSATELSIFDPPANQTCYEYMAEYMKLAGGQLQNPNAT
FT                   SECKFCSLTVADQYLAGSEIEWSQRWRNFGIIWAYVVFNIFMATVLYYLFRVRKWDIAS
FT                   IKARFGRK"
FT   CDS_pept        join(583441..583554,583614..583732,583825..583856,
FT                   583983..584557,584655..585340,585399..585645)
FT                   /codon_start=1
FT                   /gene_family="HOG000215077" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269478"
FT                   /orf_name="AFUA_5G02270"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86077.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055465"
FT                   /db_xref="HOGENOM:HBG332773"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051FC73"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEA0"
FT                   /transl_table=1
FT                   /translation="MNHPARAMPSQRLSGHDGANRPRRTRRTYACDSCSIRKIKCDRAT
FT                   PQCDWCYHHNIPCTFTRNRDSSRSCLRQTRSDTSSSNSPSPPAIPFPQGGPQAVTPQGF
FT                   GTDICLAGQTLGNICAFNGLPFFSPSGLEWIRARTGEDRSLDRYCSLRPITWPRLAKKR
FT                   TEGDRRLSLPDKSLLYEQIEAFQKSICGQFLPLINRTCFECTIRAAYEKKLSDISPGLS
FT                   SARICILAFMALSSFFAAQPHVDKIVTADEYAREAQDLLPEMLNESVTLDGLQALTMLA
FT                   ISGDMLSIELLLSMATRFVFHLKGNVYPEDVEGVTLDAKLHVRNLFWICFTLDKMFSLR
FT                   TGLQPFIDVTNCDLRLPRMQTVTGPLEGLQPFYRQYNHTMFLALIRLSLVQSKVYHGLY
FT                   SFSAQRQSDADLLATIRSLDIALEEWRSSVPTSWGLPTPHENRMAGFLFEMQYHYTMAA
FT                   IHQTSSRCTAWVRNQDTRAAGSSLALSVAASRSLLRKFLETDPQIEGQFLLFCLPELST
FT                   SAIHLFSNILMSPQEDRSDTDLSLMRLVLQHIGKYMWRQMPTTFTAQVRLVEEFMGDLY
FT                   HLAEMAILKARRGQ"
FT   CDS_pept        join(complement(587828..588210),complement(587318..587771),
FT                   complement(586928..587266))
FT                   /codon_start=1
FT                   /gene_family="HOG000161125" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269479"
FT                   /orf_name="AFUA_5G02280"
FT                   /product="Endo-1,3(4)-beta-glucanase, putative "
FT                   /EC_number="3.2.1.6"
FT                   /function="endo-1,3(4)-beta-glucanase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL86076.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0033903"
FT                   /db_xref="HOGENOM:HBG174371"
FT                   /db_xref="HOGENOM:HBG737844"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI00005207F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEA1"
FT                   /transl_table=1
FT                   /translation="MAEKPYSGAADDHSRYGGVPTQMAYFGMDEHQTSKPSSFGLQENA
FT                   SSEAAKPWWNPHGWSLRAKLIAGALIVVALIAAIVGVVEGTRANRYPDYSRLDYRLLDT
FT                   YSGPTFLDKFNYFSDKDPTNGFVQYVDRITAGKLNLTYATEASVILRVDTSEESPSNGR
FT                   RSVRLESKKSYDTGLFIFDIVHTPYGCGTWPALWLSDTYNWPLNGEIDVVEANNGGTEG
FT                   NAVTLHTTPGCDMKAKRKQTGHALYHQCDNSTHGNAGCGVQAPPASYGPEFNENGGGVY
FT                   ALELRTSGIRAWFFPRGSIPNDILDNIPDPTTWGTALADFPNTNCDIASHFSNQSIIAN
FT                   IDLCGQLGAQPQFYTHLYNCPGTCSSFVARNPANLTEAYWEFKSFKVYQAQ"
FT   CDS_pept        complement(589716..592181)
FT                   /codon_start=1
FT                   /gene_family="HOG000161114" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057679"
FT                   /orf_name="AFUA_5G02290"
FT                   /product="Potassium ion transporter (Trk1), putative "
FT                   /function="potassium ion transmembrane transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86075.1"
FT                   /db_xref="GO:0015079"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG253167"
FT                   /db_xref="HOGENOM:HBG398167"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004773"
FT                   /db_xref="InterPro:IPR015958"
FT                   /db_xref="UniParc:UPI000051FA37"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEA2"
FT                   /transl_table=1
FT                   /translation="MFTPVLRRLASMKSRIPLISGLHLNFISVHYIYIIAMTLITSIIL
FT                   YPGGDLAYIDILFFCSGAATQSGFNTVDFNKLKTYQQVILYFSSMLTTPIFIHSVLVFI
FT                   RLYWFEKRFQHIVQDTRAMRSTRTRMRTLSRDKDATSLGREEAGIGSRPIVVLRNNTQE
FT                   SNERGREASAGNPEYGSSPGSSSRFDRADSSEVQTGGPNGTLGLGLGSLRVPTQLDPEH
FT                   YIAFLEKQRKNKGALRIPSPREYDRGGVPEVLEEADDEGEGSKRTRSSESDDENSRNSE
FT                   ESDQVGPLEGPHITINEPDIQQTRTRNSTFPRLDTRPTYRDTKDLNDTSALERSRSRRP
FT                   TLSNLVRSLTQERERTTLHYLSWNATVARNSNFVDLTEEQRDELGGIEYRALKTLAIVL
FT                   TSYYLFFHILGMVCLVGWIMTTHWGQVVEQIGQGRPWWGIFTAGSAFNDVGFTLTPDSM
FT                   TSFQTAVFPLLLMTFLIIIGNTGFPCMLRLIIWVLSKIVPRESAVWEELKFLLDHPRRC
FT                   FTLLFPRNATWWLFAILVALNGIDLIFFIILDLNDPTVTSLSPGIRVLVGLFQAASTRT
FT                   AGFGVVSVADLHPAIQVSYMIMMYISVFPIAISMRRTNVYEERSLGIYAGGEDEDEPQT
FT                   PPSYIGFHLRRQLSFDLWYVFLGLFIIAIVEGNRLQSEDEYAFQMWAVLFEIVSAYGTV
FT                   GLSFGYPGVNTSFSGQFKVLSKLIIIAMQIRGRHRGLPYALDRAILLPSESLKDKDLQD
FT                   AERRMRRRVSNLSTMSGMDRTYSQARTENGVATGAEDKDRGATAWTNGDNVIRRHSTMR
FT                   SQQSQKSQR"
FT   CDS_pept        complement(594103..594930)
FT                   /codon_start=1
FT                   /gene_family="HOG000161103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209026"
FT                   /orf_name="AFUA_5G02300"
FT                   /product="Peroxidase, putative"
FT                   /EC_number="1.11.1.-"
FT                   /function="peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86074.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG055464"
FT                   /db_xref="HOGENOM:HBG328677"
FT                   /db_xref="InterPro:IPR000028"
FT                   /db_xref="UniParc:UPI000051FED5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEA3"
FT                   /transl_table=1
FT                   /translation="MHKYCALSNTRLCLRPLQTTMSKMAELEIIDSKGLPLIKGDYCPA
FT                   GPGHLRAPCPVLNSLANHGIIARSGRNITAAELKAALRYLGMGIDVITILVNGAFKVHS
FT                   DDPKKGALLGLRDKDQTNEDGVPVLNLDQVGRPHAVEHDVSVTRQDRALGDCMRVNADL
FT                   LERFLAAPKTERGFSASAFGKYRKTRYNEQKRDNPALEFDRFNHFSGCAELRAVQCIFG
FT                   RGFPYRVPEEYIRVLFGEERLPIEEGWKPRRLPLLLPELAPVILRISHFASPF"
FT   CDS_pept        join(complement(596262..596429),complement(595344..596207))
FT                   /codon_start=1
FT                   /gene_family="HOG000161092" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269480"
FT                   /orf_name="AFUA_5G02310"
FT                   /product="Alpha/beta hydrolase, putative "
FT                   /EC_number="3.-.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL86073.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG055463"
FT                   /db_xref="HOGENOM:HBG330306"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000051E6FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEA4"
FT                   /transl_table=1
FT                   /translation="MAPLTAQEIIAHPAYDTVDWKLPPTTSGRALVAQNRRGGPINLNY
FT                   EIHGTGPVKLVGKYDANANQWIMGLNATLKDWKRQTKYFGHLNGSKYSCLVFDNRGVGR
FT                   SDKPTCFYSTSEMARDVVDLVSSLGWIDMKAPATRAIHVIGASMGGMIAQEVAMLIPDR
FT                   LASLTLCCTAPRLVRTTPFFENLQQRASMFIPRHVDVEIDRIAATLFASEFLAQPDTEN
FT                   EDPALNFPTKRDRFAAGHLRKKADTESYTPKGFLLQVTACYFHHKSAEQLMALGDAVGR
FT                   ERILIVHGTEDRMLTFRHGELLREEIGEGITWKVFEGAGHMLGWETEHEMNESIQDLVD
FT                   RFS"
FT   CDS_pept        join(complement(597222..597630),complement(596777..597165))
FT                   /codon_start=1
FT                   /gene_family="HOG000161081" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269481"
FT                   /orf_name="AFUA_5G02320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86072.1"
FT                   /db_xref="HOGENOM:HBG055462"
FT                   /db_xref="InterPro:IPR022085"
FT                   /db_xref="UniParc:UPI000051E937"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEA5"
FT                   /transl_table=1
FT                   /translation="MSSLHLELKDDDPWFIEVKIFKILRDYLQDPAASPAVAAQALDRL
FT                   FPANRSDEDQPTDEPREDPGSFLWHFWGVVHNVAQQIPYTAPEQDRLAELIKALKGLSS
FT                   QTKTVYLASWDHTFDLWGDLPLLGPTFREMYDCMVSLNDKQEREHWQSLNAYAARLTRD
FT                   ESANLILFAKYSIEGMVEEVLELRLVDDGPRSILESRMVVAAEWVIQCGERLVAKEDEG
FT                   LSIESWQRCKERFSSLLDNASMSPQTRERVQKAKQVMEALRLR"
FT   CDS_pept        join(598437..598520,598573..599019)
FT                   /codon_start=1
FT                   /gene_family="HOG000216956" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16269482"
FT                   /gene_name="mitF"
FT                   /gene_synonym="aspF1"
FT                   /orf_name="AFUA_5G02330"
FT                   /product="Ribonuclease mitogillin "
FT                   /EC_number="3.1.27.-"
FT                   /function="RNA binding"
FT                   /function="endoribonuclease activity"
FT                   /biological_process="negative regulation of translation "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL86071.1"
FT                   /db_xref="EMBL:AAB07779.1"
FT                   /db_xref="EMBL:AAB22442.1"
FT                   /db_xref="EMBL:CAA41217.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004521"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0017148"
FT                   /db_xref="HOGENOM:HBG055461"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR004025"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniParc:UPI0000134411"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67875"
FT                   /transl_table=1
FT                   /translation="MVAIKNLFLLAATAVSVLAAPSPLDARATWTCINQQLNPKTNKWE
FT                   DKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDR
FT                   PPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAH
FT                   QRGNQGDLRLCSH"
FT   sig_peptide     598437..598517
FT                   /db_xref="UniProtKB/Swiss-Prot:P67875 "
FT   mat_peptide     join(598518..598520,598573..599016)
FT                   /product="Ribonuclease mitogillin "
FT                   /db_xref="UniProtKB/Swiss-Prot:P67875 "
FT   CDS_pept        join(600906..601433,601495..602775)
FT                   /codon_start=1
FT                   /gene_family="HOG000216955" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904443"
FT                   /orf_name="AFUA_5G02340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86070.1"
FT                   /db_xref="HOGENOM:HBG055460"
FT                   /db_xref="HOGENOM:HBG333966"
FT                   /db_xref="UniParc:UPI000051F52D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEA7"
FT                   /transl_table=1
FT                   /translation="MVFQWTSRCLPGFSIIALIVLLWLTSNGAVAFRKWKGPLPSSPKD
FT                   APGSQPHHLNPAQQLFVIYTVLVHVSMFAFTIRLAWALFSVTRKTKETLQRRNLAQPRI
FT                   SVDKDKWLSDTSTLTDAEPDVSDPLMSGLAHHYDGLEVIHAIIVPNYCEDLHTLRTTLD
FT                   VLASHPRARKQYEIYLAMEQKEAGVAEKAAKLALAFEPSFRHIHATFHPANLPGEIAGK
FT                   SSNVAFAARHIMEVHRAELESGHCDVIVTVMDGRCCPIVWPIYSANRVIADTHFWQDYF
FT                   TEIRRLHYAHISEADRTLYCCPIIFDRNSQETPVLVRCADLLWGFAGLSTIYPGTCISI
FT                   PTSVYSLPLSLAEKIGGWDSDSTAIGEDMHMMLKCYFETAGNVITRPVYVPASQCNVAS
FT                   DTGRGWRRSLDTCRARYRQALRHMWGALDSGFAARRTISYIRSHCRCLFFRPRHLALIH
FT                   LLWEAHFLPCHLIILMVFSTIYTLLTPPASLHPTMAWAFDLTNLLRASSFIGMNMCIFL
FT                   YEPWHALCVRTRKTDMQQANVADAGFSERIWWSPAQLVERICFPIAGTVFGGIPTVHAV
FT                   FSHFWTDRLVYRVTKKPTFSVAGAMA"
FT   CDS_pept        join(603109..603178,603355..603496,603567..603979,
FT                   604028..604368)
FT                   /codon_start=1
FT                   /gene_family="HOG000161070" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904444"
FT                   /orf_name="AFUA_5G02350"
FT                   /product="Hydrolase, carbon-nitrogen family, putative "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="EAL86069.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG054337"
FT                   /db_xref="HOGENOM:HBG330305"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI000051EB86"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEA8"
FT                   /transl_table=1
FT                   /translation="MLNPTTYPNGRSLQLPLKDKPIKYFIRSWPPQAGSNAWIHQDLAI
FT                   EENHTRACNYIREAASQGAELAVLPEYHLNGWAPDDPLWAEQAGEYKKYLSAYQALAKE
FT                   LHICLVPGSIVERHETEADGKEGFNLYNTAYFISNDGSILGSYQKKNIWHPERPHLTSS
FT                   GEAPHEVFDTPIGKVGLLICWDLAFPEAFRELIASGAEVVIIPTFYHQGTCHDASPEAL
FT                   SYNPDSEALFLESTLTSRCFENTCAIVFVNAAGADEKFLGMSRVTLPIVGPVGKMGREE
FT                   GVLVVDMDMGLLKIAEENYRVREDMAKEGWHYVYRHSTTR"
FT   CDS_pept        join(complement(608629..608651),complement(608488..608557),
FT                   complement(608305..608399),complement(607482..608232),
FT                   complement(606780..607421),complement(606465..606726),
FT                   complement(606327..606411),complement(606106..606274))
FT                   /codon_start=1
FT                   /gene_family="HOG000161068" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269483"
FT                   /orf_name="AFUA_5G02360"
FT                   /product="Vacuolar dynamin-like GTPase VpsA, putative "
FT                   /EC_number="3.6.5.5"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="EAL86068.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG326669"
FT                   /db_xref="HOGENOM:HBG434086"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI000051F550"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEA9"
FT                   /transl_table=1
FT                   /translation="MASPTTTSINVNDPGLISLVNKLQDVFSTVGVHNPIDLPQIVVVG
FT                   SQSSGKSSVLENIVGRDFLPRGSGIVTRRPLILQLINRPSRNSVTNGVKEEKLETTDSE
FT                   ANVDEYGEFLHIPGQKFYDFNKIREEIVRETEQKVGRNAGISPAPINLRIYSPNVLTLT
FT                   LVDLPGLTKVPVGDQPKDIERQIRDMVLKYISKPNAIILAVTSANQDLANSDGLKLARE
FT                   VDPEGQRTIGVLTKVDLMDEGTDVVDILAGRIIPLRLGYVPVVNRGQRDIENKRPISYA
FT                   LEHEKNFFESHKAYRNKASYCGTPYLARKLNLILMMHIKQTLPDIKARISSSLQKYTAE
FT                   LSQLGDSMLGNSANIILNIITEFSNEYRTVLEGNNQELSSVELSGGARISFVFHELYSN
FT                   GIKAVDPFDQVKDIDIRTILYNSSGSSPALFVGTTAFELIVKQQIKRLEDPSLKCISLV
FT                   YDELVRILGQLLNKQLFRRYPMLKEKFHAVVINFFKKCMEPTNKLVHDLISMEACYINT
FT                   GHPDFLNGHRAMAIVNERQQASKPTQVDPKTGKPLPPRANSPSVDAVAATENSGSGFFG
FT                   SFWASKNKKKMAAMEPPPPTLKASATLSEREATEVEVIKLLITSYFNIVKRTMIDMVPK
FT                   AIMYTLVQFTKDEMQRELLEQMYRNNELDELLKESDYTIRRRKECQQMVESLSRASEIV
FT                   SQVQ"
FT   CDS_pept        join(complement(611399..611752),complement(611237..611321),
FT                   complement(610492..611159),complement(609537..610433),
FT                   complement(609421..609477))
FT                   /codon_start=1
FT                   /gene_family="HOG000161057" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904445"
FT                   /orf_name="AFUA_5G02370"
FT                   /product="Vacuolar ATP synthase catalytic subunit A,
FT                   putative"
FT                   /EC_number="3.6.3.14"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V1
FT                   domain"
FT                   /protein_id="EAL86067.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0033180"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG007984"
FT                   /db_xref="HOGENOM:HBG288114"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005725"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="UniParc:UPI000051F7AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEB0"
FT                   /transl_table=1
FT                   /translation="MLGLGRPRLKARPSLLDLIASRGVVDLSESKPSSPPATDELPPLP
FT                   VSPTSTTSSSSSSNSNIELASSPPSSSIHTPVVRIMAPSGKDKTGEDQHGIIFSISGPV
FT                   VVAEHMIGCAMYELCRVGHDQLVGEVIRLDGDKATIQVYEETAGLTVGDPVMRTGKPLS
FT                   VELGPGLLETIYDGIQRPLKEIAAHSKGIYIPRGIAVNALDRKKKWDFKPGKFKVGDHI
FT                   TGGDIWGTVFENSLFNDHKILLPPRARGTITRIAPAGQYTVEEKLLEIEFNGQKSEHGM
FT                   MHSWPVRVPRPVNEKLPSDAPFIVGQRVLDSLFPSVQGGTVCIPGAFGCGKTVISQSVS
FT                   KFSNSDIIVYVGCGERGNEMAEVLMDFPELSIDVEGRKEPIMKRTCLIANTSNMPVAAR
FT                   EASIYTGITIAEYFRDQGKNVAMMADSSSRWAEALRELSGRLGEMPADQGFPAYLGAKL
FT                   ASFYERAGKCIALGSPERNGSVSIVGAVSPPGGDFSDPVTSSTLGIVQVFWGLDKKLAQ
FT                   RKHFPSINTSISYSKYTAILDKFYEKHHPEFPRLRDQIRELLSKSEDLDQVVQLVGKAA
FT                   LGDSDKITLDVAAMVKDDFLQQNGYSDYDQFCPLWKTEYMMKAFMGFHDEAQKAIAQGQ
FT                   SWSKVRDATADIQTSLRSMKFEIPDNEAAVTEKYEKILQTMSERFASVSDE"
FT   CDS_pept        join(612705..613099,613221..613947,614010..614258)
FT                   /codon_start=1
FT                   /gene_family="HOG000161036" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269484"
FT                   /orf_name="AFUA_5G02380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86066.1"
FT                   /db_xref="HOGENOM:HBG055458"
FT                   /db_xref="HOGENOM:HBG331477"
FT                   /db_xref="UniParc:UPI000051F056"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEB1"
FT                   /transl_table=1
FT                   /translation="MISPSQETQNVREYWGYKFEWSDLHRSAEQLHSLLLTYDSLADDC
FT                   LQRLNGISQIPHRDTTETEGSTSKPAKRDLYVLLEEHHDDDLKIKEFWNEINTIPDWAE
FT                   WEQIRRGQEVFYRYGMAVINVVSLDHFLGSGRVVETLARTGGFAADVARHRMLETLQHV
FT                   LQVTGSVDAMRPGGAGHASSVRVRLLHAAVRSRILDLVKNKPEYYDVDKYGIPINDLDC
FT                   IATINTFSTSVVWIGLPRQGILLREREIDDYLALWRLMAYYMGAPHEFLETRAKAKAMM
FT                   ESLLASEIHPTETSKILAQNIILSLENTPPTYASKEFMEAMARHLNGKQLSDKLGLPRP
FT                   TLYYQALVYGYCIVLMWFAYTFRLLPSIDQAMIKFRRKKYYKIINDKDEGLGGETFFEF
FT                   KYVPFYTRNTRLGKRKPPKRAKRGVEFLALMGLLFAVAAAGALLGSILRLLNKLQRA"
FT   CDS_pept        join(614670..614901,614979..615789,615847..616072)
FT                   /codon_start=1
FT                   /gene_family="HOG000161024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269485"
FT                   /orf_name="AFUA_5G02390"
FT                   /product="Auxin Efflux Carrier superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86065.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG055457"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniParc:UPI000052058F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEB2"
FT                   /transl_table=1
FT                   /translation="MREGPIVTPFLGALQACVSVLLTMSYGAMAERFRLVKESSISDMA
FT                   GLGVKLFLPALIVVHLGEQLEADIVLNYVPVLIWAALYTSASIGLAHAVSRGLGLPVWV
FT                   TPACAFNNTTSLPLLLLQSLESVGSLKLIIPEGDSMSGAITRAQSYFLLCAVVSKTIGY
FT                   AVGPKMLQNGNNQDEGRDAQDTDAEAGQSNNGDYADNDEEASEETSLLPERVQKARRKV
FT                   TGKFRRVGRWVSSFLPERVKQELMAPFESPFADVAILCTIIGAALGLVPQLHRAFFRPY
FT                   EEGGIFNAWLTSSVKNIGKLFTTLQIFVVGGKLGASFQRMKASGNSGEIPKKAIVTIFL
FT                   VRLVIWPAISISLIYMLAKRTGLVRYDPTLWFSLMMMPAGPPALVISGFAELAKISEAE
FT                   KMAVAKTLTVRNFCISKETENAK"
FT   CDS_pept        join(619634..620017,620081..620561,620613..620760,
FT                   620813..620924)
FT                   /codon_start=1
FT                   /gene_family="HOG000160946" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269486"
FT                   /orf_name="AFUA_5G02400"
FT                   /product="Catabolite degradation protein, putative "
FT                   /protein_id="EAL86064.1"
FT                   /db_xref="HOGENOM:HBG324004"
FT                   /db_xref="HOGENOM:HBG443712"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00005205AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEB3"
FT                   /transl_table=1
FT                   /translation="MIPNNRLAILLNHVKQNQINRCLYHNTATPPSLYSDHMCDRNDFP
FT                   LRTGVELRQHSDEVWYCQFSHDGSKLVTAGRDRHVYIYDTSNFSVYRQLEKHEEGVAHV
FT                   SWSPDDSKLITCSQDKKARVWSVETGRCLLTINHHRQPVTAAVWAADGESFVTASLDLS
FT                   SQLCHWSMRGDPLYTWHGGFRVQDCAITPDGRRLIAADVEEKIHVYDFATHEEEYCLPL
FT                   KSKPTSVTVSRDSRYMLVNLSEGQIQLIDLDTTEVIRRFQGQKQGHFVIRSAFGGAAEN
FT                   FVVSGSEDSRVYIWHKENGTLVETLEGHTSGCVNAISWNPTNPCMFASAGDDYFVRIWT
FT                   RERDMQRYAPANKGEAVSVNGSARTSALRSTSNF"
FT   CDS_pept        join(complement(623226..623486),complement(622917..623196),
FT                   complement(621886..622862))
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269487"
FT                   /gene_name="fal1"
FT                   /orf_name="AFUA_5G02410"
FT                   /product="ATP-dependent RNA helicase fal1 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="EAL86063.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051FED4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WEB4"
FT                   /transl_table=1
FT                   /translation="METPAKRSLPLYKCATFDALDIMRQIDAALSFAEYYHVIPAVALA
FT                   PQTQVALTNYHISRPKSVKLIAFSTSFLEQTKWLTVLIDERMIWANGANSDRLEFSTSK
FT                   EVTVAPTFEDMHLKESLLRGIYAYGYESPSAVQSRAIVQICKGRDTIAQAQSGTGKTAT
FT                   FSIGILQVIDTVVRETQALVLSPTRELATQIQSVIMALGDYMNVQCHACIGGTNIGEDI
FT                   RKLDYGQHVVSGTPGRVADMIRRRHLRTRHIKMLVLDEADELLNRGFREQIYDVYRYLP
FT                   PATQVVVVSATLPYDVLDMTTKFMTDPVRVLVKRDELTLEGIKQYFIAVEKEEWKFDTL
FT                   CDLYDTLTITQAVIFCNTRRKVDWLTDKMREANFTVSSMHGEMPQKERDSIMQDFRQGN
FT                   SRVLISTDVWARGIDVQQVSLVINYDLPTNRENYIHRIGRSGRFGRKGVAINFVTSDDV
FT                   RILRDIELYYSTQIDEMPMNGKSSDFTRFPLMAQRYTYSCLVADLLS"
FT   CDS_pept        join(623488..623577,623636..625174)
FT                   /codon_start=1
FT                   /gene_family="HOG000160935" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269488"
FT                   /orf_name="AFUA_5G02420"
FT                   /product="Splicing factor 3a subunit 3, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL86062.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058991"
FT                   /db_xref="HOGENOM:HBG397299"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR021966"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI000051EB9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEB5"
FT                   /transl_table=1
FT                   /translation="MVLEEQRFIHEDLERLEQAIADRIAEEPRNIRERLARDHEIAHFL
FT                   SRIEEQSKRLLEIYQDADKAREKEIQTISTGEQFDEFYRQLDEIKDFHKRYPNEPVENL
FT                   ERAYKRRQPGEGEPTGVEIDTMFSGEEAYGQFLDLTTLHEDYLNLPGVKRLTYIQYLDV
FT                   FDSFVPPHLLIKRANKISDKYFKYVGELAGYLESFIKRTKPLQDLDKLFASFDEDFEKQ
FT                   WAANQVPGWTEENVENRTQAPKTQGSGEGIWCTDCEREFKNENVYKNHLTGKKHIRAAE
FT                   ARKAVGDSGAGAPPSVGGVTSVAHRLKERAVAEREHRVRSLAKVLDSERQATRINVERR
FT                   QGMTERERQMELEALMAEFENAGGPGRNDQSDDEGDEKIYNPLKLPLAWDGKPIPYWLY
FT                   KLHGLGVEYPCEICGNFVYMGRRAFDKHFSEALHIFGLKCLGITSNTNLFREITRIEDA
FT                   IKLWEKLEQDRKKERESRENVVQMEDAEGNVMPERIYLEYVSLFLTKPNDANLLQSSKA
FT                   GYSVILLLSVPFVPCFGPFRVKAWS"
FT   CDS_pept        join(625386..625490,625833..626758,626811..628368,
FT                   628451..628600)
FT                   /codon_start=1
FT                   /gene_family="HOG000160913" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752308"
FT                   /orf_name="AFUA_5G02430"
FT                   /product="ATP dependent DNA ligase domain protein "
FT                   /EC_number="6.5.1.1"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA ligase (ATP) activity"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /protein_id="EAL86061.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003910"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG055456"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="UniParc:UPI000051FEC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEB6"
FT                   /transl_table=1
FT                   /translation="MDAPTVCLASFSFAQETSKILLIERNHPRGMWLPSCTNLSRVIGR
FT                   CLLLGSDRRQELEQWRVAGGADLGQCVENVMRQAEFDINSGQEVTVEEIDLALNKIASR
FT                   CRFSGSRVRRQHSAVDVEDTLRPLYRRMSSRDAKWLTRMILKSYHPVVLPAKLTMKSFH
FT                   FLLPHLLLFQDSFDSALKMLASEPLCHYPPNPIPELAKDLCIQALQHLKPRIGIKIGRP
FT                   EYHKARSIKHCCQMIGRRRMSVERKYDGEYCQIHIDLTKRPNPIQIFSKSGKDSTDDRA
FT                   GIHAVVKDSLSIGKSECKFSRQCILEGELVVWNDNHGRIADFHKLRKFIARSGTYIGID
FT                   NDSPPQPYEHLMIVFFDILLLDDDICLRKPHRERRLLLKNVVKVIDGYADIAEQHIVEF
FT                   SHPSGRSRLETIFSKAVTERWEGLVLKGCEDPYVSIFPGSENGSGGRWIKLKKDYIPGL
FT                   GDTVDLTLIGARYDSRDAAALYSSTKIFWTHFYIGCLVNKDAVLQSAAEPRFLVMDVID
FT                   CNSMSLKNMQILNQFGQFGACGLDSGHGFRIEFGKDSLSDMNTVFKKPFVVEMLGGGFE
FT                   KPSGARYFTLRFPRIQKIFLDRSFEEAASYQELQLSAEEARMVPAEDLHHEEEWRRQLQ
FT                   QGQVSSYYIVTKSQTTSSGTSSCPMTASSPSKGPSSEAIATTVIRTQPQHLSGDSIQQW
FT                   NRVNDERVPADAISIFVDDSMATVSSPESSEPPRKLLRSNDNLSSIQGSSKKRNQESSS
FT                   NPSKGNSASYGEENGTTFPSNDSNASIELEACITLPLQPRKRRRLTENHASNVAPVVPS
FT                   SCSNQPRCVKAPLTMIPLYFRQDLDRGDSTNTLIPPNSSNLAGDLQTFLQNQQYPKTLS
FT                   GDFFSKSANRSQQPSNPTDIKLHEAARFSSLMPNSSLSRQD"
FT   CDS_pept        join(complement(631293..631396),complement(630499..631231),
FT                   complement(630261..630444),complement(629162..630210))
FT                   /codon_start=1
FT                   /gene_family="HOG000115852" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269489"
FT                   /orf_name="AFUA_5G02440"
FT                   /product="20S cyclosome subunit (APC8), putative "
FT                   /function="binding"
FT                   /biological_process="regulation of mitotic
FT                   metaphase/anaphase transition"
FT                   /cellular_component="anaphase-promoting complex "
FT                   /protein_id="EAL86060.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005680"
FT                   /db_xref="GO:0030071"
FT                   /db_xref="HOGENOM:HBG176189"
FT                   /db_xref="HOGENOM:HBG323794"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR007192"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000520812"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEB7"
FT                   /transl_table=1
FT                   /translation="MAVNITEDNIKDLQYRFEDATIKCSERCLYQSAKWAAEMLDSLLP
FT                   VDQYDTDPDSPMEIADAPPTPQNPYLRSQDPLELALEAQEAHKYLLAKSYFDTREYDRC
FT                   AAVFLPPTIPPVPLSNTSLPTTSPKPKTRHSLTPQKGKAKAISYSSVKENSTARNPYPK
FT                   LSQKSLFLALYAKYLAGEKRKDEETEMVLGPADGGMTVNRELPGLAWGLEGWFAERRER
FT                   GLEERNQGWLEYLYGVVLLKGRNEEEAKKWLIRSVHLNPFHWGAWQELNDLLSSTEDLK
FT                   QIVDLLPQNIMTLIFHVYCSQELYQATEDTYQALSELEAIFPTSAFLKTQKALLYYHSK
FT                   DFEEASHIFTDILITSPHRLDSLDHYSNILYVMGARPQLAFVAQVATATDKFRPETCCV
FT                   VGNYYSLKSEHEKAVMYFRRALTLDRNFLSAWTLMGHEYIEMKNTHAAIESYRRAVDVN
FT                   RKDYRAWYGLGQAYEVLDMSFYALFYYQRAAALRPYDPKMWQAVGSCYAKMGRVEQSIK
FT                   ALKRALVAGSYYADDASQGGGMGGPGRKILDPETLHQIATLYERLGDEEEAAAYMELTL
FT                   QQETGQGPEDESFASDNDNDDDQSGGEGQQGSRRARQSSSFGNQNDSEDGTYHGTGVTA
FT                   TTSKARLWLARWALRHGDLERADQLAGELCQDGVEVEEAKALMRDVRARREGGG"
FT   CDS_pept        join(631975..632094,632170..633093)
FT                   /codon_start=1
FT                   /gene_family="HOG000160912" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904446"
FT                   /orf_name="AFUA_5G02450"
FT                   /product="Farnesyl-pyrophosphate synthetase "
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="EAL86059.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG015647"
FT                   /db_xref="HOGENOM:HBG328346"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI000051F062"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEB8"
FT                   /transl_table=1
FT                   /translation="MATTTSRAAFEAVFPTLAEDLLAHAKKYNLPENAVKWFEQVLNVN
FT                   VPGGKLNRGLSVPDTGIALLQKPLTDEQFKHLSILGWLTELLQAFFLVSDDMMDSSITR
FT                   RGQPCWYRHPGVGLIAINDAFMLESGIYVILKKHFRSHPAYVDFLELFHETTWQTELGQ
FT                   LCDLITAPEDKVDLDNFSMEKYMFIVTYKTAYYSFYLPVALALLYLELATPENLQQTHD
FT                   ILIPLGQYFQVQDDYLDAYGDPAVIGKIGTDIQDNKCSWLINQALQRCNTEQRKLLDTA
FT                   YGRKDSELEAKVKALYKELDLEKVYKEYEEKTVGEIRRKIAAIDESQGLKKEVFEAFLG
FT                   KIYKRTK"
FT   CDS_pept        join(634677..635072,635133..636602)
FT                   /codon_start=1
FT                   /gene_family="HOG000179032" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057680"
FT                   /orf_name="AFUA_5G02460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86058.1"
FT                   /db_xref="HOGENOM:HBG053334"
FT                   /db_xref="HOGENOM:HBG554130"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="UniParc:UPI000051E480"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEB9"
FT                   /transl_table=1
FT                   /translation="MLRDLWFAVATAFTLVQADRGPYFQSSRFEDGDLGQWPTETYRSS
FT                   APMGPILNYVESNPQCKDGQYTLIAPRGMAVRNPGPMIIDQDGHLVWTKHYGQTYNVNV
FT                   YRYKGQDYLTFWVGNDGIVGHGDGTYYMLDSAYEEAYTIRGANGLPADLHEFQITGHET
FT                   ALFTVYDVVPADLRSAGGPEKGWIWDGTFQEVDIETGQLLFQWRASEHFNLTDSYRGRE
FT                   GAGDSEDHPWDFFHINSVDKDAKGNFLVSSRYMSCLTYIDGRTGNIIWRLGGKHNDFHD
FT                   LSAGAATNFTWQHHARFHDNGSAITLFDNASRGDGSPRLTSRGLYLDVDTRQMTVSLRH
FT                   EYWNPHPISSQSQGSVQLLNTGNVLLGYGANAAWTEYTTAGDVLCHVHFGPASAFGAGK
FT                   ILSYRVFKHRWTGLPRTNPALALYRHEAAVSWNGATEVATWVLQGSDMREPNKEDESIT
FT                   FLTAVPKSGFETIISIPAQTSQNYLRVLGLNATGQILGATAWLHWDPESEEVALGPGNR
FT                   DSGNGSSSSSSSSSIDVRAFLFFAFGFSSAVFLAVCAWFVWRRFWTQEDDREWERERER
FT                   GGWKPVDEFNGDEHDLSEVEFEGMELSLLQGRRLSRSDSGGEFDG"
FT   CDS_pept        join(complement(638120..638154),complement(637849..638020),
FT                   complement(637651..637800),complement(636920..637591))
FT                   /codon_start=1
FT                   /gene_family="HOG000160891" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269490"
FT                   /gene_name="THT S2"
FT                   /orf_name="AFUA_5G02470"
FT                   /product="Thiamine biosynthesis protein "
FT                   /protein_id="EAL86057.1"
FT                   /db_xref="EMBL:AAV64845.1"
FT                   /db_xref="HOGENOM:HBG055454"
FT                   /db_xref="HOGENOM:HBG330298"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniParc:UPI000046F835"
FT                   /db_xref="UniProtKB/TrEMBL:Q5RZZ5"
FT                   /transl_table=1
FT                   /translation="MSTDKITFLTNWHATPYHAPLYLAHSKGFFKEEGLKVAILEPNDP
FT                   SDVTEIIGSGKVDMGFKAMIHTLAAKARNFPVTSIGSLLDEPFTGVVYLKDSGITEDFR
FT                   SLKGKRIGYVGEFGKIQIDELTKYYGMTADDYTAVRCGMNVTKAIIRGDIDAGIGLENV
FT                   QMVELAEWLASQNRPRDDVQMLRIDQLAELGCCCFCSILYIANDAFLAANPDKVQKFMR
FT                   AVKRATDYVLAEPAKAYEEYIDVKPIMGTPVNRKIFERSFAYFSRDLKNVQRDWAKVTN
FT                   YGKRLGILDANFEPNYTNKYLSWDLDADSTDPLGDQKRMAELQKQVAAEGGFKRLHVSA
FT                   SA"
FT   misc_structure  complement(638259..638376)
FT                   /gene_name="TPP"
FT                   /db_xref="Rfam:RF00059"
FT   CDS_pept        join(complement(641410..641874),complement(639969..641331),
FT                   complement(639718..639913),complement(639550..639667))
FT                   /codon_start=1
FT                   /gene_family="HOG000160890" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057681"
FT                   /orf_name="AFUA_5G02480"
FT                   /product="Glycogen synthase Gsy1, putative "
FT                   /EC_number="2.4.1.11"
FT                   /function="glycogen (starch) synthase activity "
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="EAL86056.1"
FT                   /db_xref="GO:0004373"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="HOGENOM:HBG083100"
FT                   /db_xref="HOGENOM:HBG330297"
FT                   /db_xref="InterPro:IPR008631"
FT                   /db_xref="UniParc:UPI000051F2C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEC1"
FT                   /transl_table=1
FT                   /translation="MDSEDTGPDPPKRDVRNHILFEIATEVANRVGGIYSVLKSKAPVT
FT                   TAEYGDRYTLIGPLNRASAAVEVEELTPSNPRMVETMNSMKERGIGMVYGRWLIEGAPR
FT                   VLLIDTGTGYKYLDEWKGDLWNIAGIPSPASDTETNEAIVFGYLVAWFLGEFIAHERRR
FT                   AVVAHFHEWLAGVALPLTKKRHMDLTTIFTTHATLLGRYLCAGSVDFYNNLQHFDVDAE
FT                   AGKRGIYHRYCIERAAAHSADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFAAVH
FT                   EFQNLHSQSKEKINDFVRGHFYGHNDFDLDNTLYVFTAGRYEFRNKGVDMFIEGLARLN
FT                   HRLKASGSKTTVVAFIIMPAQTSSLTVEALKGQAVVKSLRDTIEMIEKSIGKRMYERCL
FT                   AWKEGDNMPDEKDLITSQDRVLLRRRLFAMKRHGLPPIVTHNMINDHEDPILNQIRRVE
FT                   LFNYPTDRVKVIFHPEFLNSSNPVLPLDYDDFVRGTHLGVFPSYYEPWGYTPAECTVMG
FT                   VPSITTNLSGFGCYMEELIENSSDYGIYIVDRRMKGVDESVNQLTDFMFNFTQKSRRQR
FT                   INQRNRTERLSDLLDWKRMGLEYVKARQLALRRAYPSSFDGPEDYFDVIGGTEQKLSRP
FT                   LSVPGSPRDRSGVMTPGDFATIQEVKEGLDTEDYIAWRLPNSEEEEPDDHYFPLTLRTK
FT                   KSSDRPSSPLDSIPVNGGR"
FT   CDS_pept        complement(643973..644968)
FT                   /codon_start=1
FT                   /gene_family="HOG000294666" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269491"
FT                   /orf_name="AFUA_5G02490"
FT                   /product="Zinc-binding oxidoreductase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86055.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FEBC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEC2"
FT                   /transl_table=1
FT                   /translation="MSLMKAIILHTPGPPDTLKLTHHPIPIPEPGELRLRIKAFGLNRS
FT                   DLLARQGRANHPIAYPRIPGIEAVGIIDTAPGLEDTFPPGSTVATAMGGMGTVFDGGYA
FT                   EYVCVPARQTQLLQPKTTLPWEILGAIPVMVPTAWGALIRSLGLRARDRLLIRGGTTSV
FT                   GLAAAAIAKAHGAYVASTTRKKEREAMLLENGADRVWTDDGAVAEQIRDADSGCYYDKV
FT                   LELVGTATLADSLRCVKKGGVVSLVGRLCENGDLEKVDLMELIPSGVKLTVYQGTSEDF
FT                   MNTPLDAVLRLIEQGSLKFKIGRVLRMEQIVEAHRCMEENEAEGKIVILS"
FT   CDS_pept        join(645754..645885,645921..646082)
FT                   /codon_start=1
FT                   /gene_family="HOG000160858" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904447"
FT                   /orf_name="AFUA_5G02500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86054.1"
FT                   /db_xref="HOGENOM:HBG055453"
FT                   /db_xref="HOGENOM:HBG330293"
FT                   /db_xref="UniParc:UPI000052032F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEC3"
FT                   /transl_table=1
FT                   /translation="MPRGAEYDNGIPQSDNAIEAGETKVHGTNSAVCPANHLQHPKHDN
FT                   DHLDRVNRTADLPDVPAGGMHSGGGAPGHSSGKGGHEPRTLGENKGLGAHKA"
FT   CDS_pept        join(complement(649599..649827),complement(646689..649539),
FT                   complement(646444..646639))
FT                   /codon_start=1
FT                   /gene_family="HOG000160847" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904448"
FT                   /orf_name="AFUA_5G02510"
FT                   /product="GARP complex component (Vps54), putative "
FT                   /biological_process="retrograde transport, endosome to
FT                   Golgi"
FT                   /protein_id="EAL86053.1"
FT                   /db_xref="GO:0042147"
FT                   /db_xref="HOGENOM:HBG055452"
FT                   /db_xref="HOGENOM:HBG330292"
FT                   /db_xref="InterPro:IPR012501"
FT                   /db_xref="InterPro:IPR019515"
FT                   /db_xref="UniParc:UPI00005205AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEC4"
FT                   /transl_table=1
FT                   /translation="MSSMSPRKSIDSLASGTSTPSLSQFSLSQIESPRAPPQKYPLRRG
FT                   STASSIASIASIGGVLDSSQHHGSIAESGQNAISTLLQPPIVRTGLVPHTAVASTGYKP
FT                   PSTRDIPPVTLTNIPHVDSKAFQPYLSQVGSLYEVFQQAKESTTDQDAQAARDGKTASR
FT                   SDELGSLMPLPAERRASVLSASSRATSPFDPRGRRRSSARGRGQGITPLSVIPPVYFED
FT                   DFHLENPRTFDVVSEKSEVVRPQKLPGKDGQGTNESAAETAITGRKALATNAILQEKLS
FT                   WYMDTVEVHLISSISSASKSFFTALGSLRELHSEAADSVKRIQILRKDLQKIDREMALG
FT                   GLKIVNLRRRRENVRMLADAVSQLRDAVQSVARCEELVENGQIEEAADSLEEVERLMAG
FT                   EQSTNSDEDGASRDRSRKPVDLRRLKALEGASDDLAQLRYRIGMGYENRFLNDLLGDLR
FT                   KHIENVPSDVTLQRWGSSFQRQRGAQRSGASASPAYMKFDEDMRSRLHTNLIGLARAQY
FT                   TTPAATSFKTAVLREMKGLIRKHMPSSSDDDNESVVSVSTHRSQQRSQQEKSSILARNL
FT                   RALDAEDAYNMLTRVYTGISESLRRLSVQVKVLLDIASGLENPAAAGLCSPPRSPEPQN
FT                   MTNPTGSRQPATIQAQDEILQVLDMSSLLGQAVDIAQSQITKVLKVRSEQTSQLPKEEF
FT                   LRYFTLNRLFADECEAISGRSGTALKTVVSNQIRDYINRFGENQRHRLVDVMDSDRWDA
FT                   RDFGETETAILSKILEASTKDVEAWLAASRIWSPQEEQTEKARRDSAATNGTGKDRVRS
FT                   AVIDEQKYILPECAVAMMKSIEEFQFLMANIPSMIQDIAPGLLESLKFFNSRSSQLILG
FT                   AGATRSAGLKNITTKHLALSSQALSFIIALVPYIREFVRRHAPSSPLMGEFDKVKRLYQ
FT                   EHQSGIHEKLVDIMSGRSSVHVNAMKKIDWDAAAGNNVNPYMETLTKETGTLHRVLSKH
FT                   LPETTVMMIMDPVFRNYRDQWTRAFEEATVHTEAGKQRMQRDAEHFQNKLSKIDGFGDL
FT                   GQRLLELIQGKSTSSPDEKPAPSTESPKESPREASEESSRNSS"
FT   CDS_pept        join(650369..650505,650558..650684,650742..652141,
FT                   652202..652694)
FT                   /codon_start=1
FT                   /gene_family="HOG000224128" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752309"
FT                   /orf_name="AFUA_5G02520"
FT                   /product="DNA replication licensing factor Mcm5, putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86052.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="HOGENOM:HBG409874"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008048"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI000051F7C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEC5"
FT                   /transl_table=1
FT                   /translation="MDRRTPYTLSVLAPSTDGAEESRTQIQARLREFVLEFQLDNAFIY
FT                   RDQLRQNVLVKQYFCDIDIAHLISYNEELAHKLTTEPADIIPLFEAALQQCTQRIVYPS
FT                   QRDIVLPSHQLLLHSSASHISIRDLNATNISHLVRIPGIVIGASTISSKATVVHIRCKG
FT                   CDHSENIRVEGGFSGLTLPRRCGRQKLPGEEPGEQCPLDPYVIAHEKCQFVDQQVLKLQ
FT                   EAPDQVPVGELPRHVLISADRYLANRVVPGSRCTVMGIFSIYSKGGKKDGAVAIRNPYL
FT                   RAVGISTDLDHTAKGNAIFTEEEEQEFLELSRREDLYEALARSIAPSIWGNLDIKKAIV
FT                   CLLMGGSKKILPDGMKLRGDINVLLLGDPGTAKSQLLKFTEKVSPIAIYTSGKGSSAAG
FT                   LTASVQRDPQTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKA
FT                   GITTILNSRTSVLAAANPIFGRYDDLKTPGENIDFQTTILSRFDMIFIVRDDHDRNRDE
FT                   NIARHVMGVHMGGRGIEEQVEAEIPLEKMKRYISYCRSRCAPRLSPEAAEKLSSHFVSI
FT                   RKQVHRAEMDANTRSSIPITVRQLEAIVRITESLAKLSLSPIATEAHVDEAIRLFLAST
FT                   MDAITQGEGQGSKELMEEVSKIEDELKRRLPIGWSTSLATLRREFVDGRGYTEQALNRA
FT                   LVILQRRDTIQIRSGGSQVYRHGV"
FT   CDS_pept        653362..654489
FT                   /codon_start=1
FT                   /gene_family="HOG000235950" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057682"
FT                   /orf_name="AFUA_5G02530"
FT                   /product="Ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /function="ribokinase activity"
FT                   /protein_id="EAL86051.1"
FT                   /db_xref="GO:0004747"
FT                   /db_xref="HOGENOM:HBG460325"
FT                   /db_xref="HOGENOM:HBG697973"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI000051FEE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEC6"
FT                   /transl_table=1
FT                   /translation="MVSVTPRFPEAGETITSSSYFTSAGGKGANQAVACGRLSRRKPTA
FT                   PSASNTPESQRHTEHNVKVEMVGAVGALDGHFQALLKPTLEKSGVDTSRVQVVEDAYTG
FT                   VAVIIVDSSAGGENRILFSPGANYTGMRATEDVLGMGLAAPLPDVIVMQGEIPVDTVVG
FT                   ILRDIRVWKANDRAQGKKGIEAGPDVIYNPAPAPPGGLPEDVYTAVDHLIMNETEAELM
FT                   SPSEEHLLQVVPGVEKESRNEKVARYFHQLGVTYVLITLGSKGVWYSATDAGTSGPADG
FT                   VNRFTKQIPAAKVSKVLDTTAAGDTFVGAYAVEVARWRESRQADGKAGQDVAAEEKAYR
FT                   YQEVMDKAMGLATRAAARCVERQGAMDSIPWADEI"
FT   CDS_pept        join(656761..656875,656939..657939)
FT                   /codon_start=1
FT                   /gene_family="HOG000160836" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752310"
FT                   /orf_name="AFUA_5G02540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86050.1"
FT                   /db_xref="HOGENOM:HBG055451"
FT                   /db_xref="HOGENOM:HBG330289"
FT                   /db_xref="UniParc:UPI000051FC72"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEC7"
FT                   /transl_table=1
FT                   /translation="MAALTMTPTTMRQPFASLDAPRMRSLLETKMNIKNQQNGASPAKR
FT                   RPLVEVDAENIDPAALNMSTKRKRGCDEEDHDPSKCSPQPLKTSRMAVTVVTSNMASPM
FT                   PSSTFKAPLQKPKSTPALKPAGRSPRGKSCKAFARRSAISKSRPEPTGRKSISRPFSIA
FT                   TVLGNAQPKNQTAPKTPASWSFEIHVDSEQEEMTNMMQHSTCVLDISDDEGKAEFSSRG
FT                   KENIPPSELEIDLSQTRERETSVLRKTEMADEPRSPLGELNAADYYGEDCHAFSYAVIY
FT                   DEDETASEIKTPLPPLPRNPTHPSRTKLSSVSSISSILAATQPVKATASTKSEAEIEIW
FT                   ESESTADESEKATESNPSDELSSSTAKSINV"
FT   CDS_pept        join(complement(660251..660427),complement(659921..660201),
FT                   complement(659762..659859),complement(659604..659712),
FT                   complement(658329..659547))
FT                   /codon_start=1
FT                   /gene_family="HOG000160825" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752311"
FT                   /orf_name="AFUA_5G02550"
FT                   /product="RNA polymerase III transcription factor subunit,
FT                   putative"
FT                   /protein_id="EAL86049.1"
FT                   /db_xref="HOGENOM:HBG055450"
FT                   /db_xref="HOGENOM:HBG330288"
FT                   /db_xref="InterPro:IPR019136"
FT                   /db_xref="UniParc:UPI000051F055"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEC8"
FT                   /transl_table=1
FT                   /translation="MEGQKTPTSPGNMMDHQGTRTAPYYSIPPRHIVSVEHPAIIKDVD
FT                   KAIETLQGNAGISKILNPPKADARAKLFLRPEDAMSRPLQSTSSASNNILLKVTVPKRT
FT                   GRKRKKGSDEPFSGVPVTTVHEQPQRRSAKQLLRSLSDNVGKYKVEPVGGLIRSPGMPD
FT                   FVYSTTGSAFTNRFREQILSFDYDKMKQFDIDMSKGATSNVDIIPPPSLSHGDVPFTYI
FT                   YRQNPTVRQSVDTSGNLTTVNTSQAAKVHTYLLPFDAPVPTKPRENLAPIHTLEPTLRE
FT                   TIALVEDLFKERPAWTRRGLRNNLKTPEQRYALRHAVPYVGYIFRSGPWRDAIIKFGHD
FT                   PRTSPAYRIYQTVMFRILSGTSELARDAGSGRRHTIPRPNEVPTGTDAFTPLPTDTHLF
FT                   TGTPPLPPDGRMWMFCDITDPLLRSILFPDPQPPGFLRDTCEIAVDGWFGSGTIGKART
FT                   VMRAKVQSMLDGRVADEREFARVLRFPDHVAPDGSLAEFTLDPEGTSSREMQLATDIRA
FT                   SIKASWKGQLDAAGASVRSNAAPSAGGVAADVARGKRVQWSEDVGEEEESEGEGEEEAL
FT                   EQAERLEAQVAAAAEAVEAAAMAADEDEANDLDQEESDVGDDMDVDEPAKP"
FT   CDS_pept        join(661831..662256,662361..662960,663031..663384,
FT                   663477..663775,663846..664194)
FT                   /codon_start=1
FT                   /gene_family="HOG000067326" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269492"
FT                   /orf_name="AFUA_5G02560"
FT                   /product="Protein phosphatase regulatory subunit (Ssc1),
FT                   putative"
FT                   /function="binding"
FT                   /function="protein phosphatase type 2A regulator activity "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="protein phosphatase type 2A complex "
FT                   /protein_id="EAL86048.1"
FT                   /db_xref="GO:0000159"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008601"
FT                   /db_xref="HOGENOM:HBG067378"
FT                   /db_xref="HOGENOM:HBG602178"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051F2B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEC9"
FT                   /transl_table=1
FT                   /translation="MIAASAPPPPRLGRLATTTALRYDKSLANITIQHEQLSRAKEANK
FT                   SSKKKDSQNQAALASHQAQQSASPNHGTPTSSTTSVNDIRGKSPDNATQAGVYPAGQHY
FT                   IPHGAGVAGQPVNNGPGTPTKQGQPIAPSVIISPSAPPHVPPPGAAETMPGDLAPPRKS
FT                   HVFDRLQTTPKDMSEGIRTPKRQHSSRFDISDQRQRELEKLPGFHEVPPNRRQELFMQK
FT                   IDQCNIIFDFNDPTADMKSKEIKRLALHELLDYVANNRSVITEPMYPRVVEMFAKNLFR
FT                   PIPPPVTPQGEAFDPEEDEPVLEVAWPHIQVVYEFFLRFIESQDFNTNIAKAYIDHHFV
FT                   LQLLELFDSEDPRERDFLKTTLHRIYGKFLNLRSYIRRSINNVFFQFTYETERFNGIAE
FT                   LLEILGSIINGFALPLKEEHKLFLTRVLLPLHKVKSLSMYHPQLAYCIVQFLEKDSTLT
FT                   KEVVMGLLRYWPKTNSTKEVMYLNEVEDIFEVMDPAEFAKVQVPLFQQLAKSVASPHFQ
FT                   VAERALYFWNNEYFCNLVSDNVETILPIMFAPLYENSKGHWNRTIHSMVYNAMKMFMEI
FT                   NPQLFDECSHEYNERQNSAEQREKSRQERWEKVLERAKQRKNGLLPPPAPPAEVPAQVD
FT                   EVDALAQDNQKRLNALKLEDSASNKERKEGATATVSSILP"
FT   CDS_pept        join(665470..665521,665640..665797,665884..677364)
FT                   /codon_start=1
FT                   /gene_family="HOG000160814" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269493"
FT                   /orf_name="AFUA_5G02570"
FT                   /product="Histone acetylase complex subunit Paf400,
FT                   putative"
FT                   /function="binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="EAL86047.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG023370"
FT                   /db_xref="HOGENOM:HBG330287"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051F7C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WED0"
FT                   /transl_table=1
FT                   /translation="MERSIDIYASKLGDDKLDIKIRANVAVELRDNIEPLCSGASYPLF
FT                   LSKLWPVFKNILKGEPVFTNLSFEQKLRNCVLETLHRLPMASPDVEPYAADMVDLLMDL
FT                   VRIENEENAVLCMKTIMDLERNQATATAARVQPFLELIQEMFQTMEQVVRDTFDTPSQA
FT                   TPSGMPSTPSATVQNFQSPRPSSPATSVSDLGPDQQSSNVLLKGMQSFKVLAECPIIVV
FT                   SIFQTHRNSVSANVKLFVPLIKSILLLQAKPQERAHAEAAAQGTIFTGVCREIKNRAAF
FT                   GEFITAQVKTMSFLAYLLRMYAHQLQDFLPTLPSVVVRLLQDCPREKSSARKELLVAIR
FT                   HIINFNYRKIFLEKIDELLDERTLIGDGLTVYETMRPLAYSMLADLIHHVRDHLTRDQI
FT                   RRTVEVYTKNLHDDFPGTSFQTMSAKLLLNMAERIAKLDDKREARYFLIMILDAIGDKF
FT                   AWINYQFDNAVKVSKAYKAGKKDIEPSSERYLADKENPPDWDEIDIFSASPIKTSNPRD
FT                   RGGDPVSDNIFLFKNLINGLKNIFHQLKNCNPEHIQIDPNNVPINWPEVSYGYNAEEVR
FT                   VIKKLFHEGARVFKYYGVDQPAPEVTYSSPFDFLASQYTAPMSREEKELLESFGTVFHC
FT                   IDTATFHEVFHSEIPYLHELMFEHGALLHLPQFFLASEATSPAFSGMVLQYLMDRIHEV
FT                   GTADMTKAKILLRMFKLSFMAVTLFSVQNEQVLHPHVTKIVTKCIELSVTAEEPMNYFL
FT                   LLRSLFRSIGGGRFELLYKEILPLLEMLLETFNNLLLAARRPQERDLYVELTLTVPARL
FT                   SHLLPHLSYLMRPIVVALRADSDLVGQGLRTLELCVDNLTADYLDPIMAPIMDELMTAL
FT                   WDHLRPHPYNHFHAHTTMRILGKLGGRNRKFLNHPPELTFEQFSDDSPSFDIKLIGPSE
FT                   KRPFPSSIGVDLAIRKLMEVPKTAAAKASDGYYKQQAFRMLSSQLKLYIGHENVPEDLA
FT                   ALLRLHANDLFEGKTTAMTDILDKSERSSSIAKKLAQEGTLKQLLKACIFATTLPDIEQ
FT                   SATAFVADVCKHFAVVEVGRALALARHNRKPFDVHSGEGPVYLDSRILAEAIVESLSSD
FT                   NLRVRDGAEAAMQVMKDAAGIIFGAPERVANLPFFQHLGRVFCHSCHSEEWFTKAGGSL
FT                   GIRLFATKLDLGDSWLFDKQFEFARALMYVIKDTPADLPASTRVSAGDTLDLILRRCCK
FT                   NVSKDDMKNEKSRLWSLCGFFVYELSHMNKHVREASRRSFSTIAEVLGCQVHELIFPVK
FT                   DRLLQSIFNKPLRALPFPTQIGFIDAITFCLSLHNNIVTFNEPLNRLMLESLALADADD
FT                   ESLASKPNEFKNAEMIVNLRVACLRLLSMAMSFPEFANTPQNTSRARIISVFFKSLYSR
FT                   SHDVIEAANAGLRDVLTQTNKLPKDLLQNGLRPILMNLQDPKRLSVAGLDGLARLLTLL
FT                   TNYFKVEIGARLLDHMKVIADDAVLQKVSFSLVEQNQTIKIVTAIFNIFHLLPPAATSF
FT                   MEHLVNKVLELEEKLRRTSNSPFRKPLVKYLNRYPKESLAFFQARFKEERFGRFFGQIL
FT                   ADPESEALRAAVVADTEGFKSAVFGQDSSDGRNTAAINGIYVVHSVCSYEATKRWLVSH
FT                   GDLKTMLLNAGRDLEKKLRSDRLPANERLRVEQAEDQLMDIFTIYLSESVQDLDFLFDL
FT                   IDGLSSEELKRTLAFPKFIYRHIITNESIDYRRSVIMRCLDLYGQRTCSQKMKTYAFHN
FT                   LVNPIFAMDVQTTWNSPSNSPKLMDKSMTESIQSRLWRPQLADLSEESTQAGVDHSRME
FT                   LLQLSALLIKYHHQTVQDSRKDIIKFAWNYIRLEDIINKYGAYVLISYFIAHYETPFKI
FT                   VVQVYVALLRAHQNEGKALVTQALDVLAPVLPSRIMSATSNAQAPDTRYPLWAKWPRRI
FT                   LAEETANLQQVMSIFQFLVRHPNLFYESREHFVPLIVPSLIKIAAPPNSNNESKKLALN
FT                   LIGLIWQWEQRRVTSSRTAMTNGILESPNARKRKLDDTQGTSSPSAALGPPSSHERTEY
FT                   IIPSDLRAAMTKYLITFITTVPERFPVPAARFRELPSSKPQPQQPPILTGDMIKKAVFL
FT                   LRNLLSPEYWGDLDIELYQKITEPILAGEKADKPDEKHITSMINALQVVRVLLAVKPDE
FT                   WITARLPLVQKLFEKPLRSDNPEIQDSLHGVEDSMDISPKLPPPVRRVLDALPEDQLEE
FT                   EDAMDVENSPSEFVTYLSAIATETLSANNYISSLNTLWTLSKNKPAEMDTHILPVMKAF
FT                   SQKLAKEHVAASTNNQQAQYPPGAAKPAENLPDQQEYEIGVDLILKTIELISVRMSHLG
FT                   EQRRPFLSVLAQLVERSQNEALCTKILNMVETWIFHSTESWPTLKEKTAVLHKMLLFET
FT                   RADQKMLKKFLDLVIRIYEDSKITRTELTVRLEHAFLIGTRAQDVEMRNRFMNIFDRSL
FT                   TRLASSRLSYVLTCQNWDTLADSFWLAQASHLILGCVDMTAPARLHPDDFTVYPLSFLL
FT                   SNAEKDARKADIMVDIQLEAFISDRKRFIADIGDVRIRDLMEPLCQLQHTDPRVAYSLW
FT                   TTLFPIFWSTLSREDRIDLEKGMVTLITREYHQRQLDKRPNVVQALLEGAVRSKPRFKV
FT                   PPHVMKYLSRTYDAWYTAASYLEESAISPIIDTPTVRESNLDALVEVYAGLQEDDFFYG
FT                   TWRRRCKFVETNAALSYEQQGMWDKAQQLYENAQIKARSGAMPFSQGEYYLWEDHWLIC
FT                   AQKLQQWEILSDFAKHENLNDLLLEAAWRNIENWQSEGNREQIESLIKSVSDAPTPRRT
FT                   FFQAFMSLLQFHLKKENLQDFNGVCDESIQLSIRKWLQLPKNITNAHIPILQHFQLLVE
FT                   LHDASHICASLSQTNERNLDTKSAELKLLLGTWRDRLPNLWDDINAWQDLVTWRQHIFQ
FT                   LINATYLSLLPPQTNNVASNSYAYRGYHETAWIINRFAHVARKHQMPEVCINQLSRIYT
FT                   LPNIEIQEAFLKLREQAKCHYQNPKELNSGLDVINNTNLNYFGAQQKAEFYTLKGMFLA
FT                   KLNHVNEANEAFGVALYYDLRLAKAWSEWGQYSDQRFKADPSDYELASNAVSCYLEAAG
FT                   LYKNAKSRKLLSRILWLLSLDNEEGRIAGAFENFKGDTPVWYWITFIPQLLTSLSHREA
FT                   RLCKAVLVKIAKLYPQALFFLLRTNREDMLNIKKQHDQKQEKLNRARQQQASPHTKPSP
FT                   ATADSSPAQGSQPANSNTPAQGQASQPPQGQAQAQSQGLPQGQSPSQGQIKAQQPPAQS
FT                   QAQPQGQAQPSGSAPGQPQGSGQGQMQQPQNQQQAHLQVPGQNGAPQQAQTGATEPEKE
FT                   PLKKPWEYSDEIMSGLKTAFPLLALSMETMVDQIHKNFKCPPDEDAYRLIVALLNDGLA
FT                   YVGRMPGSYAQDFKLPAATEANITRFAETILPAHIRKSFEADFVVKKPTMYEYIHKLRR
FT                   WRDKFEEKLDRRGQYQFLETYSPHLSEFRFLKFDEVEVPGQYLLHKDKNQDFVRIDRFL
FT                   PDIDLVRGIGVCHRRLKIRGHDGSVHPFAVQHPAARHCRREERILQLFRIFNGLLGKRK
FT                   ESRRRNLYFHLPLMVPLAPHIRLVRDDPSYISMQGIFEDYCRRVGTSKDEPVLFTMEKM
FT                   RSLAETKQNVRQTDNLMVKRANVSQRTPDQQQVLRTEILTAIQEKWVPSTIVKDYFQKT
FT                   YPNFASFWLFRRQFSYQYAAIAFMTYVMHMGNRYPNKIMISRSTGDIWGTELIPAINPA
FT                   KAFFYNPEHVPFRFTPNIQTLMGPIATEGLFACALMAIARCLTEPRHELEQQLSIFVRD
FT                   EMMFWATAQHRGVLPVQQLRDLVYNNSDIIVNRAVSLASPPEGNLPANQTTIDLISKAV
FT                   NPQHLASCDALWMPYL"
FT   CDS_pept        join(complement(678567..678957),complement(677833..678512))
FT                   /codon_start=1
FT                   /gene_family="HOG000160812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752312"
FT                   /orf_name="AFUA_5G02580"
FT                   /product="MRNA splicing protein Yju2 "
FT                   /protein_id="EAL86046.1"
FT                   /db_xref="HOGENOM:HBG516146"
FT                   /db_xref="HOGENOM:HBG735623"
FT                   /db_xref="InterPro:IPR007590"
FT                   /db_xref="UniParc:UPI00005200EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WED1"
FT                   /transl_table=1
FT                   /translation="MPYRRLVASSIYRYITHPSNSNIKSASADQPAASCLGLFDSLAFK
FT                   NSLQRSRDNQTSTTARPCPNERYSGKSTQQLENGPRNQLTSHSKYYPPDFDPSAIGRTP
FT                   KHLRQTGPKVITVRLMAPFSMKCTHCGEYIYKGRKFNARKETTDQKYLNIPIYRFYIRC
FT                   TRCSGEITFLTDPKAMDYKAEKGAKRNFEPWRDAKNDIEETEQETLDRLEREENEEQER
FT                   LERDKMAELEEKMLDSKREMAIADALDEIRTRNARIERNEALSGDVALAHVRNEVDEAR
FT                   LREEKEIEEAARRAFTTETGEKVKRLVEDDTIAGTTPGSSQTETPPPPSFARVKKPKKP
FT                   LINGLGIKKKPKPSLV"
FT   CDS_pept        join(679520..679620,679675..679889,679935..680456,
FT                   680478..681172,681323..681446,681585..681793)
FT                   /codon_start=1
FT                   /gene_family="HOG000160791" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269494"
FT                   /orf_name="AFUA_5G02590"
FT                   /product="20S cyclosome subunit (Cut9/Cdc16), putative "
FT                   /function="binding"
FT                   /protein_id="EAL86045.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG190343"
FT                   /db_xref="HOGENOM:HBG330285"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000051EDD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WED2"
FT                   /transl_table=1
FT                   /translation="MEKFLRSWRQDALNRGQHDAAIYIGDKVLALTSDDSDAFWLAQVH
FT                   FSNNNYTRALALLSRKDLISRSTACRYLAGHCYIKQNQFDQALSVLGDHNPTHLIRSSN
FT                   SPSRIDRNEEREREDANNIRFEAAICYLRGLCFAKQNAFDRARDCYKDAVRIDVQCFEA
FT                   FDQLMKNSLMSPAEELEFLESLDFDAVSSPDPSVAQEAAHFTKMLYTTRLSKYSSPAIL
FT                   SDATETLSTHYNLAENPDILLSRAEALYTQCRFAEALELTSSILATEASTTPNVPALTV
FT                   YPLHLACLYETGATNALFLLAHTLADHAPEEPYTYLAIGVYYLSVSKIAEARRFFSKAS
FT                   LLDPHSAPAWIGFAHTFAAEGEHDQAIAAYSTAARLFQGSHLPQLFLGIQHLALNNMSL
FT                   AHEYLSAAYAMSTGAAAGTVPSIPANPSGDAHGGDPLVLNELGVVLYHQNHLEGAVELF
FT                   NQSLALATALHCEPGAWVATRANLGHALRRIGRLVEALAEFDECLRIGAGGAGAVTALH
FT                   EAVRVLGASGGGDAAGGAGIAGTLLSRALEIWALEFPTTGPATETLEQKVEMELDDEAD
FT                   GLLRHAMSRVRGGRGRRRLDFSPDAEATETPGPAGARSRGSRARS"
FT   CDS_pept        join(683315..684284,684342..684766)
FT                   /codon_start=1
FT                   /gene_family="HOG000160780" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752313"
FT                   /orf_name="AFUA_5G02600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86044.1"
FT                   /db_xref="HOGENOM:HBG052207"
FT                   /db_xref="HOGENOM:HBG328588"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniParc:UPI000052058E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WED3"
FT                   /transl_table=1
FT                   /translation="MVLPSCSLLRPRQGVLLCLFYVIGALSVGFILAMWYGMNTDRDYI
FT                   HPLLTQLIPAGHCACETSTTFQCASCLSCSKSGLSTQLTPSAKWVFEYERDGNNEGLNR
FT                   QQCDAAFPGLYEDVFRAVTYWRSHGALAAEDLDRIRLEPGMARAAILRGELYVVAARSK
FT                   GEDHRRKILAVLSAIHRALVADSLRSTRRDIEFVFSVEDKVEDVTSAEHPVWVLARAAN
FT                   EEAVWLMPDFGYWAWDNPDNAIGPFDQVVARIQRADIPWEAKKQQLVWRGKPSFAPKLR
FT                   RALIEATRDQPWGDVKQVSWPDRTNVLSMEDHCQYMFIAHVEGRSYSASLKYRQACKSV
FT                   IVAHKLQYIQHHHYLLAAEGPNQNYVEVERDFSDLAAKLEPLMRDTSVAHHIANNSVKA
FT                   FRERYLTKAAEACYWRHLFDGYESVWNSTITKGSDPHQAERGLRYESFVLLESQRMFDF
FT                   AAANAF"
FT   CDS_pept        join(685654..685771,685846..687128)
FT                   /codon_start=1
FT                   /gene_family="HOG000160769" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269495"
FT                   /orf_name="AFUA_5G02610"
FT                   /product="Cytochrome P450, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86043.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG055449"
FT                   /db_xref="HOGENOM:HBG331225"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000051EB80"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WED4"
FT                   /transl_table=1
FT                   /translation="MPTPIPLPSGLPILGNLLSISPGNTWGSFNKLAVNNKNFYPIFKI
FT                   TILGHDIVFITSAKLLEEICDEKRFRKCVTGPIVEIREAVHDSLFTAYHDEESWGIAHR
FT                   IMAPLMTPEAVIDAFAGMRETATDLVKKWTAGPRQRINVSNDMDRLNHAANMLCFFDQR
FT                   IHCLEGPEPSVLQAMEAATFEALRRPTRPKVLKWLIYQRRFDRYIKTMRDYAAEIVAKR
FT                   RAAPTEKKDMLHAIMHGTDPQTGKALTESQYLDEIINLFIGSATAANLVSFALYYLMKN
FT                   PHEIARAREEIDAVVGGPAAQLEHEHLARLPYCEAILRESLRLSATAPGFNIEPIPDLE
FT                   QPVLLAGGEYQVPNKQPLIALLAAVNRDPEVFEDPDAFKPERMVGEKYDRLPSGVKKGF
FT                   GNGKRECFGKRYAWEWSFMILVTIMKDVDFVLADKNYKTEVGGVNYNGAFSTKPLGLFA
FT                   LTGPRQSV"
FT   CDS_pept        join(complement(687922..689013),complement(687330..687854))
FT                   /codon_start=1
FT                   /gene_family="HOG000160758" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269496"
FT                   /orf_name="AFUA_5G02620"
FT                   /product="P450 family sporulation-specific N-formyltyrosine
FT                   oxidase Dit2, putative"
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86042.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG055448"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="UniParc:UPI000051FA1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WED5"
FT                   /transl_table=1
FT                   /translation="MTWMRVMPRCQNRTYKRPRGPPLSIHPLEFFQAKKVEKTAKAKMI
FT                   LYYLASIPLAIICYLAWYLHVPWDLPSLPRIPFYVSILGLWSSMGQDEIYERWLRKPLE
FT                   AHGAVLIWFAGRWSILVTRPDLLTDMFRNEDLYAKAGSQKKIPWSVIATLVGDNIINSH
FT                   GDTWKLYTGIMKPGLQKKNFDTAPLLLKSRRFVDEILAEQNSAGRGTGILVNTFVQQWA
FT                   VDVMGMSFLDLDLQSLEKPHGTVRLEAIQSVIKLMLFRPLFFNFPDLDQFAWLIKSRQR
FT                   AYEIMHEFGDTLMATVLGRIDSDREKGIKPAEEMVVHMLVDAYRDGRLTEKQFKDNLKI
FT                   VFLTAHENAQQLVNSMFWEIGKNNEVQTRLRAEILSTNTTTPTSEVVNALPYLTAVVYE
FT                   LLRLYPPVSQLINRVTVRPAMLGNEIPIPAGTFVGWNAYGVHVNPAIWGPDANEFKPER
FT                   WGRTVGEMHARFRRETVRGTYIPFNAHSRKCLGQGFVLLQMKILLFEVLRRIEWTVDPG
FT                   YRLKMTPVSYFLESGRKSTDA"
FT   CDS_pept        join(689239..689311,689371..689978)
FT                   /codon_start=1
FT                   /gene_family="HOG000160747" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269497"
FT                   /orf_name="AFUA_5G02630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86041.1"
FT                   /db_xref="HOGENOM:HBG055447"
FT                   /db_xref="UniParc:UPI000051F054"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WED6"
FT                   /transl_table=1
FT                   /translation="MATEALHMHKDRLSAEDLDLKDPHVSSSLALFAIHNLIRRNLKAC
FT                   AEHAITVQPANIDAFVTYAKYTLHVLRDQLTSVDEIWFPVFAEHDPRFLAQKDAHDALY
FT                   QRITAVDAQLATPPAELGQNELLSAEIAAAFAELHELTDKQYDLEEDLINQLGRKVPMD
FT                   TIRGLEKKQEERRRADVKVYGHLWTAVYLLRGLDPKERAIFPPGIPKLIAGGMLTAGAM
FT                   QFRR"
FT   CDS_pept        join(690545..690932,690984..691107,691156..691265,
FT                   691314..691695,691742..692033)
FT                   /codon_start=1
FT                   /gene_family="HOG000160736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209027"
FT                   /orf_name="AFUA_5G02640"
FT                   /product="O-methyltransferase, putative "
FT                   /EC_number="2.1.1.-"
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="EAL86040.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="HOGENOM:HBG055446"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000051E49C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WED7"
FT                   /transl_table=1
FT                   /translation="MSTQHGPKSTRTNDLYELAVNISSTVEAFVGRLDAIGAERPNLDN
FT                   PFPEIIQDEGAQLARLKILRLCERLMALVQGPVQWLMFQNMAFLDAACVGAILDMGIHD
FT                   IIAPGPEPTSLDQIVEATGASKDILKRIMRVCTQRLVFDEIAPEQFIHNGVSLQFLAPP
FT                   VQALISHACDDGLRMAAHFTDSLKKTDWKGSDDPENTAFSLAFNTNKGLFDYFYTEDLA
FT                   RGQRFALGMAGSEIMKTLTEDMFPFESLPQGAKVVDVGGGRGHVSVRIAEKVPGLNFVV
FT                   QDDESMLEAGQAEGVPKAVKDRIEFMPHDFFNEQPVKGADVYLLRFILHDHSDSRCAKI
FT                   LSNIVDAMEPGKSRILIDDAIVPSFLGPESSRFFNLLDLYMLAGLNGKERTLEQWNYLI
FT                   QMVSPKLVLEKVWKTPNGGPESGTILELRLQE"
FT   CDS_pept        join(complement(692864..692950),complement(692582..692796),
FT                   complement(692297..692465))
FT                   /codon_start=1
FT                   /gene_family="HOG000160735" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209028"
FT                   /orf_name="AFUA_5G02650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27256.1"
FT                   /db_xref="HOGENOM:HBG395510"
FT                   /db_xref="UniParc:UPI0000F51CBA"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA06"
FT                   /transl_table=1
FT                   /translation="MQAILETVSNLLPYHLLSYGALLGTELFQSFVNTKICYQALPMKE
FT                   FLALQKRVFPAYFRCQVGLVVLTAVTRPPYSILSFSQHIWDSVPLIAVGVTGALNCAMN
FT                   EDNSSTTDPAKIQQANKTFSRNHAMSIHLNAIALVATVWYGFTLSSSLLNGL"
FT   CDS_pept        join(695110..695221,695285..695800,695859..696187)
FT                   /codon_start=1
FT                   /gene_family="HOG000253036" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057683"
FT                   /orf_name="AFUA_5G02655"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="EBA27255.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniParc:UPI0000F51C51"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA05"
FT                   /transl_table=1
FT                   /translation="MHSQTTKDEQSKDDSSNEKQDAIERRRLQNRLSQRNHRRKIRDRI
FT                   AKLQERVIASELRAVATLNGWDQASPPAASMMESKPQGDFDSNPLASVSEDPAISNPPQ
FT                   RNVSSNLCRSCCSLLNQMPSSSSLPSPTSPLPFDLGLTNGVDSTNSSPSTLLNSSPSSS
FT                   QLSPFSLDTSLSMTGLQSQNEFSFPPYPDPPGSQQYPHCPQYYVATEASLPHIMQRLGS
FT                   ATSHPKAIILIPHGHGYAPAPFTGANAADSTGLRSALNGNLNLQNPGRHCLRPDRSAKS
FT                   SDLGTSGDWMTAPSSTPFCPLHPSQSSSLDNYQSMML"
FT   CDS_pept        join(complement(698287..699049),complement(696714..698236))
FT                   /codon_start=1
FT                   /gene_family="HOG000160714" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752314"
FT                   /orf_name="AFUA_5G02660"
FT                   /product="Pyoverdine/dityrosine biosynthesis protein,
FT                   putative"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86038.2"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG055444"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniParc:UPI0000F51CA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WED9"
FT                   /transl_table=1
FT                   /translation="MIAVLQNPQNAAISYSGEPQEHNLLGSYETKAPNVETSEIAASSS
FT                   SSEAPEDLAEEHHRNEASLQQPLSEVDRHEQPAASDNTRSGLDIPPVTVSTPQSSDNPL
FT                   VESKEAVPVTFKDEGKGTKADPSHLLTEALETTNGEENSPISEDEATAIAVLKVIERYG
FT                   VNFEKTGESWQGLTSFIPTVVEQVKKREAVRMILPAFPFKSPNARDKVLGVMPDLGEEL
FT                   ALYHLNGLCENIGRVYEPGADVYISSDGLVYNDILGVPDETVWEYGEALRRMAVEKELH
FT                   HVKFIRLFELLEHPWIPLTSAEQAKSYYLAHAQCLRRELMYRFEDRSFDADAAIRSDND
FT                   TCLTYRGYIKFLTKDLAPQMDTQYTSKKARAAHIAQIARSMIVRGKMFAAAIKANRADY
FT                   VRLSIHESNGARKLSISLVPQVRGVLGYTPWHSSIAVDADGTLRAVHAEDVRETHELVY
FT                   KNGQPYYFREKSKLFDWVEDGLRVKFEPLYPCGLIIRPSDIDDSRPPPSISHLPMHKVR
FT                   QLSTGLSPVVLRGFRETLKEELYVQKASELGTILPWSFGIIQKVRDAGRTDKLGNNVTS
FT                   NEAMPMHYDGMFKFEEETDPVTGEVKRVQKPPGYQFFTCPATAPKGSGYTLFASSRLFF
FT                   RYLPLPWTTERLQKVTWGMDNDGFWDAKLKNLPLVVPHPVTGLPCMRWHQPWDSTKTKF
FT                   STCAVTIENDEQELASVVDDLTYDYRVCLRFSWEQGDLLVSDNTAMLHTRTGYKTNCER
FT                   ELWRIHFD"
FT   CDS_pept        complement(700135..700845)
FT                   /codon_start=1
FT                   /gene_family="HOG000160703" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269498"
FT                   /orf_name="AFUA_5G02670"
FT                   /product="ThiJ/PfpI family protein "
FT                   /protein_id="EAL86037.1"
FT                   /db_xref="HOGENOM:HBG405228"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI000051FEE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEE0"
FT                   /transl_table=1
FT                   /translation="MSSTPPKKYYKVAVLLFEGVDILDFTAPMEVFTHTSHNRNPDNPD
FT                   RVFQINTIARSRTVNAKKALTVQTDLLLEDAMQGLADFDIMVVPGGPPSLLNALVASNP
FT                   REVELIRSFATLPPKTPDEPRVLFSICTGAFLVGAAGLLTGVSVTTHHRAIEKLREFCI
FT                   RVNGEGASPPEVSHKRYIDAGVLKVGSARLLTAAGVSSCLDASLYLVSQLTSLDMSAFI
FT                   SRVMEYDWKGQLSE"
FT   CDS_pept        join(complement(704544..705415),complement(704223..704482),
FT                   complement(704031..704165),complement(703890..703980),
FT                   complement(702770..703835))
FT                   /codon_start=1
FT                   /gene_family="HOG000160690" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269499"
FT                   /orf_name="AFUA_5G02690"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27254.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG326774"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000F51C81"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA08"
FT                   /transl_table=1
FT                   /translation="MASPYQASMSFSPSAAGSDMTSATSRSVSDLPQSQVDAIIRTKRK
FT                   AREPKACYPCHARKVKCDRNLPCDGCVKRDHPDICSYERPSKKRIIASSVPPSYNDSPA
FT                   GASQPDVAEHTVSAAQEEPHLRIKQEAGASRINSLGFRHRISIAREEWDNVRNRLKEME
FT                   KTISNLRAGLERAEEGPGGILETASAHSADEGNRSKAGSPEREGIHAANTLGEGTVHLG
FT                   SRSVLAYILNNKSGSDQLQALLEGGILPKLGLDNESATYPFVDLWSSDMSTFDISAVCS
FT                   ALPNDQQCKEFFFYYRDVAGAIYPVIEDIQQFEMNLDLLLRSRASTGGVYQTDTDQAQR
FT                   PFGASIAYLGLLFAVLASGCQSSNLPGKERELTSQVYVCCSYQCLRMTNFLSQPTIEAI
FT                   QTLLVIGNVLSYNMNPGISYVLLGMTLRMGLALGLHVESSRFSLEERYRRRHVWWSMAW
FT                   QDSHFSLSYDRPSTTAVSQPEIAYREDSKPGELSYFETLCRIISLALEVVRSRMLGSHS
FT                   QMSFKTIQMYKERIQQIMIEGKPHLRDRKYCLSSTEHLERVVLKLHSSYFSSELLRPAL
FT                   KSPPDSNDPTTLSMRADCVRNLMTTVEAYIEMHTINSHASRSWITLQRAISSMFLLAVT
FT                   EESKTDPQFWNLLRQLKNIIGERANEEGSVGPGSAAASSTAYNTVPGAANMTGTSPGAL
FT                   DPTSPGSAPVPLEAQTQWTKPLTKTYRALEKLEAAFSSLSDRTAGHNGSPAYRNPSAGS
FT                   VTAANLVPPVTVGAMTPSLGSLPPPTPESSTSGEWTIPTILDRAAEYIHPPLWS"
FT   CDS_pept        join(complement(707527..707944),complement(706873..707473),
FT                   complement(706485..706816),complement(706165..706430))
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904449"
FT                   /orf_name="AFUA_5G02700"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL86034.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F54F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEE3"
FT                   /transl_table=1
FT                   /translation="MSDQQHHQDAMRRFSLGTGQGQVDPLDLPLRQVTNDANMEEYTTE
FT                   TAAGEIIKPVRSSATGKVEDWKLVTFKVDDPENPKNWSKAYKWYCTMVVSFTCFVVAFA
FT                   SSVITADIDGPSEAFNVSHEASLVTVTVFVIGFGVGPMMFAPLSEMVGRRPVYGATLLL
FT                   AFIFVIPCAVSKNLGTLIVCRAIDGIAFSAPMTLVGGTLADLWRNEERGVPMAAFSASP
FT                   FIGPAIGPLVGGYLCHAGWRWLYWIQLILAFVAWVLITFTVPETYAPMILLKRAKKLRK
FT                   SENDPKYVTETELDARPMGERLRLFLLRPFQLLFLEPIVLFISIYMSVLYGLLYMFFVA
FT                   YPIVYQKGKGWGSGPTGLMFIPLAIGVLCSAACAPFVNKHYLTLVKKYGGKPPAEARLI
FT                   PMMLSCWFIPIGLFIFAWTSYPDIHWIGPCIGGLPVGFGFIFLYNSANNYLVDTYQHQA
FT                   ASALAAKTFLRSMWGASTVLFTEQMYDRLNDRWASTLLAFIALACCAIPYVFYFKGASI
FT                   RRYSKFAFADDEEQQGPGEKH"
FT   CDS_pept        708150..708374
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269500"
FT                   /orf_name="AFUA_5G02710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86033.1"
FT                   /db_xref="HOGENOM:HBG055441"
FT                   /db_xref="UniParc:UPI000051FA36"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEE4"
FT                   /transl_table=1
FT                   /translation="MDLSIVNIIEHDTKDGSLSRICLGGPSVARSGSEPTNLFEQYASR
FT                   PPHFSCVNHGCFLHVSYLSIYQVGSQTRA"
FT   CDS_pept        710324..714412
FT                   /codon_start=1
FT                   /gene_family="HOG000261359" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904450"
FT                   /orf_name="AFUA_5G02720"
FT                   /product="Phosphoribosylformylglycinamidine synthase "
FT                   /EC_number="6.3.5.3"
FT                   /function="phosphoribosylformylglycinamidine synthase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="EAL86032.1"
FT                   /db_xref="GO:0004642"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="HOGENOM:HBG021760"
FT                   /db_xref="HOGENOM:HBG335309"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI0000520356"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEE5"
FT                   /transl_table=1
FT                   /translation="MASTSTNSTYLAIPGSVAFSHSRGRAIAASIGALDVRAQWIHYVH
FT                   AERPLDAQQQGVLEQLLRYGDITDVPASFGPEDGSFDVFYVFPRTGTISPWSSQATGIS
FT                   HVCGLRQYVKRIERGIKISCLREKTQEFKPGFEDVLHDRMTQLLSQTEPDLHLMFSEHA
FT                   PQPLETIPLHGSDKSPKEVLQEANKRLGLALEQSEIDYLADAYGPNGPLARDPTDVELF
FT                   MFAQVNSEHCRHKQFNASWVIDGKQMPNSLFSMIRNTHKKHPDHTISAYSDNAAVLEGP
FT                   NAAFWAPDPFTGEWNHTKEVVHFLAKVETHNHPTAVSPFPGAATGSGGEIRDEGAVGRG
FT                   SKPKAGLAGYCVSDLLIPDLKQPWELDVGKPNHIASSLDIMLEAPIGSAHYNNEFGRPC
FT                   TFGYFRTLLTQIDVGNGQTEVRGYHKPIMIAGGVGTVRPQHAIKKPEAVKPGSYLVVLG
FT                   GPAMLIGLGGGAASSVASGEGSADLDFASVQRGNAEVQRRAQEVINACVAMGENNPIKF
FT                   IHDVGAGGLSNALPELIHDSGLGATFELREVDSADKSMSPMQIWCCEAQERYVLAVGEE
FT                   GMNKFTAIAHRERCGFSVVGRGEGGSEEDKRLILLDRDSTEYPKPIDLPLSVLFGKPPR
FT                   MTRTVDSRKLKLPAVDASLTSYLPSLAPNRVELISEAANRVLSLPAVGSKSFLITIGDR
FT                   TVGGLTARDQMVGKWQTPVSDVSVTATALVQGMKTGEAMAMGERPTLALISPAASARMA
FT                   VAESLMNIAAADLVDRLNHVKLSANWMSASNHPGEGAAIYEAVEAIGMDLCPKLGISIP
FT                   VGKDSMSMKMKWTDEATKESKEVTAPMSLVISSFAPVGDFRKTWTPALRSVEDVGDTVL
FT                   MFVDLSFGRKTLGGSALAQVFNQVGDECPDLRDVEIFRDFFDATQQLQEAGIVLAYHDR
FT                   SDGGLFTTLAEMMFAGRCGVEIMLDNICPTNSTQDLVSTLFTEELGAVFQVRKEHEIQF
FT                   RSCFATCGPPAGLIHKIGRVSERPKQNLAIYYKASLVYRNNRASLQQTWATTSYHMQKI
FT                   RDNAACAEQEFSNILDDTDPGLSWNPTFDPKDRAMPLLTSLKSPFSNKPRVAILREQGV
FT                   NSQAEMAFAFNVAGFSAIDVHMTDIISGRVSLSSFVGLAACGGFSYGDVLGAGQGWAKS
FT                   VLLHENTRTEFQSFFQRPDTFALGVCNGCQFLSRLKELIPGASNWPSFERNASEQYEGR
FT                   VCMVRISDPDPANPSVFLHGMNGSSLPIAVAHGEGRASFAAAPGTSAQDFVHQGLAPVQ
FT                   YVDNATLKPTMKYPFNPNGSPEGIAGIRSADGRVLAIMPHPERTVMGGIASWLPPNAEE
FT                   WGDIGPWGRVFFSARRWVG"
FT   CDS_pept        join(complement(717486..717557),complement(714808..717402))
FT                   /codon_start=1
FT                   /gene_family="HOG000160668" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269501"
FT                   /orf_name="AFUA_5G02730"
FT                   /product="Gamma-tubulin complex component GCP5, putative "
FT                   /biological_process="microtubule cytoskeleton organization "
FT                   /cellular_component="microtubule organizing center "
FT                   /cellular_component="spindle pole"
FT                   /protein_id="EAL86031.1"
FT                   /db_xref="GO:0000226"
FT                   /db_xref="GO:0000922"
FT                   /db_xref="GO:0005815"
FT                   /db_xref="HOGENOM:HBG055440"
FT                   /db_xref="HOGENOM:HBG331217"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="UniParc:UPI000051F546"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEE6"
FT                   /transl_table=1
FT                   /translation="MTLPEEISVLTDELILGITKIDPTHHVEDTLKSASHVRTDQFAVS
FT                   KQLEGLQEKFQVLNRDDLADALRNRLTELDEHHKSWFPEILSFLLQLSSHPAVFSRVDR
FT                   LPKPKVDEGAKQLSWTELDASGSAYCDEDIWECVDFGADSSSEEDDDLASSGRSDAPIP
FT                   QTLPSSPIASEEDYEIPDEVFSPGTDMALVDSVREAQFWKPRKHAESNQVGKLSCRVIT
FT                   ELQIVRETLFMLQGLPTSLFWRLDDNIEVDRRYTLAHTSSEALSSLLRSFSMIGARLDV
FT                   VRRFVKITQVVPYMQTFHRCVEDCLSQFDAFLSEVQTQCISQGAPFSVSLLQLAEDVRT
FT                   ASAMLVLLADLISNLEYDSPDDGVRCLDLLYDVVCMKQATGDDVEFTFLAKLFFSCLET
FT                   YIRPIRRWMEEGRLDPREGVSFIIDQRDDKDLRSLWRDWYAVDDSCGLPQFMRPVAQKI
FT                   FTTGKSMVFLQHLNALETMGDSKAITLTLEHTYGDESSSLLCLPFAAICESAIGKLVEA
FT                   NHSFASDLLRKELDQQCGLWRSLQALEHIYLCKDLSVSAIIDNKVFDLMDRGRGTWSDR
FT                   YLLTELAQSAFSSMPFIDHSRIIVRSHQDSQGRSRSVKALKTISFDYILPWPIANIIPK
FT                   DAIHRYRRISTFLMQIRRAKHLIVKQRLKYADETDEFSRDRSSNALSYSLRHHMLWFLN
FT                   TLYSHITDFVISTATESLRKSLSATKDVDAMIAAHCAYMSSLEDQCLLSSNLSPLYQTT
FT                   ISLLDLCVYFADIQATRYGDKLSDQRTPTKHAKFPQGRKSLSRKHQDPYTDDTIPSDDD
FT                   DDDDTQDESDEDVGNTTGISFYETPYAHRLRDIKGRFDQLLAFLTSGLKGVGRVDGQIS
FT                   WEILAEKLEWRKKRLAV"
FT   CDS_pept        join(717912..718065,718161..718424,718483..719101,
FT                   719159..719315)
FT                   /codon_start=1
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904451"
FT                   /orf_name="AFUA_5G02740"
FT                   /product="Alpha-1,2-mannosyltransferase (Ktr4), putative "
FT                   /EC_number="2.4.1.131"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86030.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI000051E705"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEE7"
FT                   /transl_table=1
FT                   /translation="MAVARPIRMIGAACILLCLFLIFQVNQSHGPSFISKGSKEYNGMK
FT                   RDPLLDPTGEPEGHLWRADDNDYAPNSAHSARTNAALISLVRNEELEDLISTMKDLERT
FT                   WNSKFNYPWIFFNDKPFTEEFKKRTQAETKAKCYYEQVPKEHWDPPEWINMELFRESAA
FT                   ILTEQKIQYSDKLSYHQMCRWNSGMFYKHPALKNYKYYWRVEPKVQFFCNVDYDVFRFM
FT                   EDRNLTYGFTINLFDDPKTVPTLWPETKKFLAANPSYLSSNNMMGWLTDDSLRPDHTEA
FT                   ANGYSTCHFWSNFEIGDLDFFRGEQYDAYFNHLDRAGGFFYERWGDAPVHSIGLGLFAD
FT                   AAKVHWFRDIGYNHIPYYNCPNSPKCSKCTPGQFYAGAPFLAKEDCRPSYFKHVGMH"
FT   CDS_pept        join(complement(720664..720857),complement(720442..720487),
FT                   complement(720175..720292),complement(719993..720111))
FT                   /codon_start=1
FT                   /gene_family="HOG000160656" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209029"
FT                   /orf_name="AFUA_5G02750"
FT                   /product="Cytochrome c oxidase subunit Va, putative "
FT                   /function="cytochrome-c oxidase activity"
FT                   /protein_id="EAL86029.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="HOGENOM:HBG118891"
FT                   /db_xref="HOGENOM:HBG381551"
FT                   /db_xref="InterPro:IPR003204"
FT                   /db_xref="UniParc:UPI000051F069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEE8"
FT                   /transl_table=1
FT                   /translation="MASLSLFRVATRAVRPSGFIRAPQFPRSRVQVPAALALNRPSFST
FT                   TTKRLSGAHEDETYEEFSARFEKEFDGVQDVFELQRNLNNCFAYDLVPSVEVLSAALRA
FT                   ARRVNDFPTAVRIFEGIKAKVETQDQYKQYLESLEGLRQELGVALREELYPNEE"
FT   CDS_pept        join(723030..723440,723498..723780,723833..724173)
FT                   /codon_start=1
FT                   /gene_family="HOG000160635" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752315"
FT                   /orf_name="AFUA_5G02760"
FT                   /product="Fatty acid elongase (Gns1), putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86028.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG055438"
FT                   /db_xref="HOGENOM:HBG331215"
FT                   /db_xref="InterPro:IPR002076"
FT                   /db_xref="UniParc:UPI0000520346"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEE9"
FT                   /transl_table=1
FT                   /translation="MALEFLQNLPRPTIDRPFGIHLWPIFDKAFETVVGYPASEFKFVE
FT                   GVTPMSTFKETAIALVAYYIIIFGGRELMKNRPAFKLNTLFMIHNFYLTAISATLLALF
FT                   IEQLLPTLYRHGLFFTICDHQGGWTQPLIVLYYLNYLTKYLELLDTVFLFLKKKPLTFL
FT                   HTYHHGATALLCYTQLIGLTAVQWVVIDINLLVHVVMYWYYFQSARGIRIWWKEWITRL
FT                   QIIQFVIDLGFVYFASYTYFSSTYFPWAPNMGKCAGEEFAAFSGIAIISSYLFLFISFY
FT                   IATYKKTAKTGRPRRNTGKQSLVDMKNFEVPSVTPAANSKATSNGAAVASGRANGPVTR
FT                   SRKA"
FT   CDS_pept        729618..731162
FT                   /codon_start=1
FT                   /gene_family="HOG000160624" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904452"
FT                   /orf_name="AFUA_5G02770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86027.1"
FT                   /db_xref="HOGENOM:HBG055437"
FT                   /db_xref="HOGENOM:HBG331207"
FT                   /db_xref="UniParc:UPI00005200EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEF0"
FT                   /transl_table=1
FT                   /translation="MYRSADALSLDYTNQQLLLRRYESDEEEISESEHGGHDNAFSPVD
FT                   DTTGTFSDMSTEELSRGAEPEAENRQVDQRLAPYPLNGTKSRPVSIDTMKRSSNATFAP
FT                   DSIVYDDDDDDDDVIIELPPPDQMSPLQSPIFLQPTVYVPPGSPRSTAARSMRSPSPTS
FT                   VFSVEETDVLVAEQVTYVEPISKPHLIQISPEQSYFPPVAAADAKQDTFCKHSSRNTSD
FT                   DSCEGIYSLRQAAKSQPLLSTGESNGANAKQLKRNSVSVAGRSSGSVREFKRVEVPKST
FT                   ATTQSLSEVPEIPQPLSPRSRSRTFSGARASPAQKLPSLYTAVRSRLPAESLRRPPSLR
FT                   SLSSASVLLSHARHASTSAGLDTRTPSTFASHTRVSSEQSSPLQTCRTPSPIFQNSTPY
FT                   YSSPTFCRDRSGSVYSNSSAPTPTSYRSPPPVRYSTMHSLKSSYSSSLRSEVESIHSVE
FT                   ASEPVDQAGKSTMSRKKSLKRSKLSKQEGKEQSTAKSIMGFMLRGRRKSTIWNHRS"
FT   CDS_pept        join(732988..733084,733149..733704,733772..733861,
FT                   733981..734032,734083..734343,734395..734512,
FT                   734569..735024,735083..735235,735283..735423,
FT                   735474..735635,735703..735873,735921..736175,
FT                   736223..736356,736405..736554,736602..736710,
FT                   736777..736836,736899..737087,737142..737216,7
FT                   37265..737296)
FT                   /codon_start=1
FT                   /gene_family="HOG000160623" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269502"
FT                   /orf_name="AFUA_5G02780"
FT                   /product="Nicotinamide nucleotide transhydrogenase,
FT                   putative"
FT                   /EC_number="1.6.1.1"
FT                   /function="NAD(P)+ transhydrogenase (AB-specific) activity "
FT                   /function="NAD(P)+ transhydrogenase (B-specific) activity "
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86026.2"
FT                   /db_xref="GO:0003957"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0008750"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG020907"
FT                   /db_xref="HOGENOM:HBG324950"
FT                   /db_xref="InterPro:IPR004003"
FT                   /db_xref="InterPro:IPR004571"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="UniParc:UPI0000F51C6C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEF1"
FT                   /transl_table=1
FT                   /translation="MSVPLTLRSALGPSRVACRSHPGKSWFPLDHLSVQTRQVFYLVRQ
FT                   KNDHKLPFIPPWLQITKRTASSASAPSDVPVVPYSSLTVGVPSETWPNERRVALTPQNV
FT                   TLLLKKGFSRVLVERGAGEQAQIHDQAYEQVGATLVDRAVVWSESNIVLKVRSPRQEGP
FT                   IDEVEALRQGSTLISFLYPAQNKLLVEAIASRGVTAFAMDMIPRISRAQTFDALSSMAN
FT                   IAGYKAVLEASNHFGRFLTGQVTAAGKVLVIGAGVAGLSAIAAARRLGAIVRGFDTRSA
FT                   AREQVQSLGAEFIEVDIQEEGAGQGGYAKEMSKEFYDAEMKLFMEQARDVDIIITTALI
FT                   PGKAAPKLITKEMIAAMKPGSVIVDLAAEAGGNCEATVPGQLVNYNGVTVIGYTDFPSR
FT                   LPTQASTLYSNNIAKFLLSMAPQEKSFGIDLSDEVVRGSIVTLNGAILPPAPRPAPPPP
FT                   KPAAAATPAKEQAELSLTPWQKATRDVATVTAGMGTALALGKATGPIFMSNMMTFGLAG
FT                   LVGYRAVWGVAPALHSPLMSVTNAISGMVGIGGLFIMGGGYTPSTIPEALGAVSVLLAS
FT                   MNVAGGFVITKRMLDMFKRPTDPPEYPWLYAIPAVIFSGGFIAAASTGMAGLVSAGYLV
FT                   STLLCISSISGLASQQTARRGNILGILGVISGILASLAAVGFSPEVLAQFGAMAGGGAL
FT                   VGALIGRRITPTSLPQTVAALHSVVGLAAVLTSIGSVMADIGDISTLHMVTAYLGVLIG
FT                   GVTFTGSIVAFLKLAGRMSSKPTILPGRHVINSTLLGTNMATMGAFVSMGPASPLIAAT
FT                   CLGANTMLSFLKGYTTTAAIGGADMPVVITVLNAYSGFALVAEGFMLNNPLLTSVGSLI
FT                   GVSGSILSYIMCVAMNRSLTNVLFGGIAAPQQGQKKIEGQITQVTVDDTVEILSNAESV
FT                   IIVVGYGMAVAKAQYALAEIVRMLRAKGVKVRFAIHPVAGRMPGQCNVLLAEASVPYDI
FT                   VLEMDEINDDFPDTDVTLVIGANDTVNPIALEPDSPISGMPVLHAWKSKEVIVMKRGMS
FT                   SGYADVPNPMFYMPGTRMLFGDAKASCDAIKAGLEARK"
FT   CDS_pept        join(complement(738273..738299),complement(737779..738210))
FT                   /codon_start=1
FT                   /gene_family="HOG000216954" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752316"
FT                   /orf_name="AFUA_5G02785"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27253.1"
FT                   /db_xref="UniParc:UPI0000F51C99"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA07"
FT                   /transl_table=1
FT                   /translation="MSEVGIKLEVTGLPEFVVPRLRDLLRDYLTNSGDSDINPSEPGSR
FT                   SLKVKLKIAGDRSQNTIRVIEKEKKLIRSHRVTGYINSVCERFQELLALYFPYDEDDFD
FT                   YERRATLTLKVIMKPLHGNTNGLAKSYVVSFPAVLEECTSKQVSGTGN"
FT   CDS_pept        join(739904..740017,740108..740128,740186..740234,
FT                   740295..740370,740420..740645,740705..740825,
FT                   740885..741228,741277..741399,741457..741859,7
FT                   41934..742121)
FT                   /codon_start=1
FT                   /gene_family="HOG000160602" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752317"
FT                   /orf_name="AFUA_5G02790"
FT                   /product="Amino acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86025.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG055436"
FT                   /db_xref="HOGENOM:HBG324948"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000F51CB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEF2"
FT                   /transl_table=1
FT                   /translation="MAPTTQHHSDLLVDQDEVPVIGEQDRSETSSQDDAALLKSMGYKP
FT                   VLHRTYTLLENFSTTFAALYFVGGVRVTFSTGIAAGGNLAYWTSYLVTMVFTFITAAVI
FT                   AEVCSASPSAGSIYLWAAEAGGPRFGRLLGFTVAWWSTTAWTTFCASNTQAAVNYMLSE
FT                   LTVFNVDFPTDSGDVKFRAVQWICTEILLALAALINFLPPKYFRFVFYLSSTMVLLDFV
FT                   LNIIWLPIGAHDTWGFRSAHEAFMSTYNGTGAPPAWNWCLSYLATAGILIGFDASGHVA
FT                   EETKNAAVTAARGIFWSTVASGVGGLATIILFLFCAPDADTLFSFGSPQPFVSLYAVVL
FT                   GKGGHVFMNIICIVALWLNTAIAIVAASRLVFAVARDGVLPFSGWVSRVHNGQPRNAVV
FT                   VVWTVAALVTCTLLPSSVAFTSLVSAAGVPSAAAYGLICLGRLLCTPKRFPKPKWSLGR
FT                   LSKPFQFIGVFWNAWVVAILFSPYAFPVTGENLNYAPIIMAGVTILALISYFVMPEDAW
FT                   LPRNRISHFIDSKGAVSETVEEVGSSRMAQHEGTASQ"
FT   CDS_pept        join(complement(743665..744489),complement(742776..743600),
FT                   complement(742624..742737))
FT                   /codon_start=1
FT                   /gene_family="HOG000160591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057684"
FT                   /orf_name="AFUA_5G02800"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86024.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055435"
FT                   /db_xref="HOGENOM:HBG324947"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51C8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEF3"
FT                   /transl_table=1
FT                   /translation="MEMHTVVFPPGKPAPPPAAQPQAVAAPAPEKKKRVRRWHRRGFTG
FT                   CLTCRRRHVRCDEASPSCKNCTRLGLDCDGTQGRMTFKVYGPSQGAQDLSPSPNNISTA
FT                   NAITVKNQQADIKHVKQEPRDEKDDLVDGIVISPTTVGDSAPVKYRFQDPLSPSGFMPS
FT                   SLDLVEGRYYTHFIEQVSTLLLIYDNSNNVNPFRQYFPELAQSSPSVASAMQALGALHL
FT                   ANTSAGPKRNVHFQQAMGKYGEVVKTFRTRYTHPDHEVQIADFATCLLLSLFEMMDSGH
FT                   DNWVIHLKGAREIYKSLFLSKRSDPAKEAQRLAESNHPLRHFLISLLSYLDVAGACNTS
FT                   EGTVVEGSYWRTHGGGWEYNLGTPSLSSPTPGDDRLNELRQCWSIMMEIQADISAFGKA
FT                   KHEKWLTPAQQDVIYGDLLNRLVQWRANAPQCIQQLGELDDESLQQYQYPEIMEYAGCI
FT                   EAYEKATIIFLHKVIAAERPDRPPQTPFLQVLATRILNLIKKLARDVGQLAVMWPLFIA
FT                   GRETRDEAQQKAVRQTMVDCQRFGFKARRPNPPNVDKALEELEKAWFKQRAFPEGWVDR
FT                   MDDIRTSILLP"
FT   mobile_element  complement(745286..746122)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(746200..746796)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(746203..746793)
FT                   /mobile_element_type="transposon:mariner_ant1 transposon
FT                   family"
FT   CDS_pept        join(complement(750280..750562),complement(749896..750185))
FT                   /codon_start=1
FT                   /gene_family="HOG000160577" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269503"
FT                   /orf_name="AFUA_5G02820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86022.1"
FT                   /db_xref="HOGENOM:HBG055434"
FT                   /db_xref="UniParc:UPI000051EDEF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEF5"
FT                   /transl_table=1
FT                   /translation="MKLSTVLSLAPLLGAATAQGQHEQEPFTLNVRWSNSMGTLEGPLN
FT                   ANAGAFWSGKPTVSSCPENVQDCPAVNTTSFVSQGSKLFLNVAVPGGQQVYISPEGQLT
FT                   YTVPHSGYIPDGSLADLPIMKDGFLNPFLTLWLCSVDKDAKQWKVWAEYTNGTTGAITN
FT                   NGSNGQSACTRFALEAQPYKGDKAWEF"
FT   CDS_pept        join(complement(753289..753360),complement(752949..753223),
FT                   complement(752354..752897),complement(752217..752304),
FT                   complement(751972..752170),complement(751821..751921),
FT                   complement(751672..751770),complement(751446..751621))
FT                   /codon_start=1
FT                   /gene_family="HOG000160544" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269504"
FT                   /orf_name="AFUA_5G02840"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL86021.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG055433"
FT                   /db_xref="HOGENOM:HBG328693"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E6FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEF6"
FT                   /transl_table=1
FT                   /translation="MGTFGSQTSTYNRLVTIFVAVGSLTYGYCASIISSTIGQPGWYSY
FT                   FKLPAEGEPGYASITTPAISTANGVFSAGGAVGTLFIMWSCDYFGRKVNIQFGAFFSLF
FT                   GGALQAGANSLEMFQAGRFVCGLGIGILVTVCPMYLSEMSSAFRRGWLVGHHAIFLVFG
FT                   YMLSGWVGYACYYAKDIGSFGWRFPLALQCLPPLVLLVGSPWLPRSPRWLISKGKHEEA
FT                   KVVLERLRQSPDDPDNLVAKEEYYQTAEQIRLESERLSEYGNVWKAVVKKKSYRKRMVI
FT                   GFLTQWGAEFGGPLIINNYAVLLYSNLGMKGGMPLLLSAVWLTTAGLIYNPLGAWLHDK
FT                   VNSRRGMYITGFVGIIITTSCLAAMTAEYAGTTNKAGNAFGILFIYLYLAFQGTFCDTT
FT                   MYLYVSEIFPTEIRPIGMGFSLFGQFAATLILLETAPMGFNNIGWKYYLVIICWSAFFI
FT                   PVIYFFFPETARLTLEEIAKNFGEEVAVHLTDATDEERAQLERTIVDQKNSVQSEAKAA
FT                   "
FT   CDS_pept        join(754834..755125,755180..755335,755388..755710,
FT                   755775..755844,755918..756051)
FT                   /codon_start=1
FT                   /gene_family="HOG000219459" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269505"
FT                   /orf_name="AFUA_5G02850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86020.2"
FT                   /db_xref="HOGENOM:HBG305047"
FT                   /db_xref="HOGENOM:HBG323811"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="UniParc:UPI0000F51C74"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEF7"
FT                   /transl_table=1
FT                   /translation="MGSQSPWDTPFDELPNPKQVWVGKPGSHEEGLGKLAILTPEVVAK
FT                   AAAAEIKTGRRVTMNWDMTKLDYPNLNRQPCNHQIIPLLGGVAFDDIYTMNPQQSSQWD
FT                   GLRHFSQTVPGQKERVFYGGTTVEEINDRRNDRIGLQHWAKEGIAGRGVLIDYATWAEK
FT                   KGIKYTTFSTHQVRLSDMLEIAKECNITFQKGDILLVRVGVTKEWDTIMTDAQKQQYSD
FT                   NPSPEHAGVEATTDVLRWLWDTGFAAIASDAISWEVYPPQNPDLFLHEYVLAGWGMPIG
FT                   ELFDLEALASTCQELQRWTFFVASVPLNMPGGVSSPPNMMAIF"
FT   CDS_pept        join(758799..758967,759019..759038,759111..759147,
FT                   759196..759263,759323..759795,759866..760220)
FT                   /codon_start=1
FT                   /gene_family="HOG000160555" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269506"
FT                   /orf_name="AFUA_5G02860"
FT                   /product="Integral membrane protein, putative "
FT                   /protein_id="EAL86019.2"
FT                   /db_xref="HOGENOM:HBG055431"
FT                   /db_xref="HOGENOM:HBG324946"
FT                   /db_xref="UniParc:UPI0000F51C5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEF8"
FT                   /transl_table=1
FT                   /translation="MALAVMLGRDAGDSVDRTMHNWNTATQIICIVAMTIFFGLRVYTR
FT                   IFILNGFGKEDWTCMGSWFLGVIYSVIALIMGHYGGGLHQSDVPTSYLIPFQKTVYVTM
FT                   VMYGPTAFLTKISLLWIMTRVFSPYRKAVFFIYIFLVIMLLYYIPAVIVKIRICNPIGK
FT                   FWDDSINGSCLDQSAIILADAVVSVVSDAIILILPLPLTLSLQMSMRKKVRVMGILGAG
FT                   GLACASSVVRLILILKTGQSKDGTYSFMRINMFGNAEIAIGVICACLPSLSALLSRVLH
FT                   EYSSNNKATYPSTHELGGVSKQSRTDRRLSRSKHQMSHLDTASDQEILMHNAQGDPKIE
FT                   TSIRGDTSSRRIVPSESMGIMKTVDVSTSVTTH"
FT   CDS_pept        join(761042..761096,761160..761407,761510..761713,
FT                   761768..762034)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269507"
FT                   /orf_name="AFUA_5G02870"
FT                   /product="Oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /EC_number="1.1.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL86018.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00005207FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEF9"
FT                   /transl_table=1
FT                   /translation="MNKASAGARLQGKVAIVTGGGSGFGAAISRRFGEEGAKVIVADIN
FT                   VENGEKIAAQNPENLVFYKMDVTSASDWDEVMDLAFAKFGRLDVLVNNAGTTYRNKPTL
FT                   EVTEEEWERVFNVNVRSIFLGSKALMGRLIQQGQGGSMINISSTGASRPRPGLVWYNAS
FT                   KGAVSNATKGLAAEYGPHNIRVNTVSPLLSGTGLFSMFTGMEDTPENREKFIGNVPLGR
FT                   LTDPNDVANMCLYLASDEGSFINGAEMIVDGGKCI"
FT   CDS_pept        join(complement(764621..764674),complement(764546..764605),
FT                   complement(764334..764515),complement(763807..764282),
FT                   complement(763453..763751),complement(762956..763393),
FT                   complement(762652..762893),complement(762083..762593))
FT                   /codon_start=1
FT                   /gene_family="HOG000160533" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269508"
FT                   /orf_name="AFUA_5G02880"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86017.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055430"
FT                   /db_xref="HOGENOM:HBG334037"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00005207FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEG0"
FT                   /transl_table=1
FT                   /translation="MEAEGAECDRKELLNNRAYGMDWHCANELQCDQCRLRKRLGPYRI
FT                   AVFLRIDHLYFQQVRCDKRSPCSNCRSAGIVCRSTGAGQKPKEDRRRVLISSQYEKKID
FT                   SIEERLGNIEEVLLELKSSLARNSNTSEPCYHVTPVSKQMSPDSSAFASNTTAALEHES
FT                   GTGFEGNSSLAAHSAYASAFLETVVSRSAPQVSTPKINAALAALRQMVNMQSQPPGTSS
FT                   KDVPLLNQKSCRDSNLRDLVMPPIEVILPILRQIKENLPLTFACYFPFLSVDDFIQKCR
FT                   EVYFATEDYSDATFMVVNCGLYHIFLEYSFLEESPRIRDDYQKYIQLCRKNFETVLANL
FT                   PLLMPARPELIEALTLGAIHAIETSKPSFAWTLTSNAARLCQNLGYHRSSSMSQFSDSE
FT                   KVKALSLFLCVYCLDKSLSLRLGRASSIQDFDIIITIPEDLGGTRVDEPWRTMYHLWVK
FT                   TAEIQGKVYEQLYSPAALSRPERERVFCARQLASEMEVAVMEPFKELERSSRPLSEAED
FT                   FLIKSDEVSRLAILTLIYRAVPASGTSTTTFVPECIETARAALESHQACMTRLRESTEA
FT                   MKCSYLHWSILCSPFVPFIVIFCHVIETSARDDLARLEDFVASLGPNCFLSEAITKLHS
FT                   LCQVLSNIATLYVEARAQAQLQENQDLASVGQEFDTYLSALGLAPASGVGGFRWTTAVS
FT                   DSLTARSMPGLGNGMEGHDLPAGVIPQTQLGSWFSGNQHMMGLLEEDMTLWDPATLPYS
FT                   "
FT   CDS_pept        complement(765471..767420)
FT                   /codon_start=1
FT                   /gene_family="HOG000160522" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752318"
FT                   /orf_name="AFUA_5G02890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86016.1"
FT                   /db_xref="HOGENOM:HBG055429"
FT                   /db_xref="HOGENOM:HBG334038"
FT                   /db_xref="UniParc:UPI000051E936"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEG1"
FT                   /transl_table=1
FT                   /translation="MPRPRPLPLPEEWTDPDAYVDALLSFTTSSELFIHVCGGVHILDF
FT                   LTREPDLYDSLLPLDWRTFFEKHDIQDILDLLLREDIPSLLQQSRRFSESDPSRDAEAS
FT                   WRGQPLPPIDLLEYIHQIRRLSLGRDFTSRQPGKVSLPHHLSVGMNQKKYHEVAHFSRY
FT                   VNDLCDTVAEERGEAISHIVDFGSGQNYLGRTLASPPYNKHIIAIERKHQFISGAKGMD
FT                   IHAKLAKKQKRIVYKTSGRRSRKGLENDQDTTPSTPEVELVENIPIDASTKPGAGDGED
FT                   STVFNVLLDIDIQPDEWGTSPYKNGPPKKSVGKNEDELPLKGTMDYIEHEIKDGYLEPI
FT                   IKDVIRSRCLETKGSQGPAVDRDSRPEGKAEDPNVMVISLHSCGNLLHHGIRSLVLNPS
FT                   VKAIAMIGCCYNLVTERLGPATYKVPILRTQHPRLTQDACAYDPHGFPMSKRLESYEHI
FT                   SGTGVKLNITARSMSLQAPYNWGREDSEAFFTRHFYRALLQRIFVDRGVVEKPVNPTDL
FT                   YGLETGGPDAVGNPLIVGSLRKAAFTSFSAYVHAAVAKLSKDPHNGEKVKARMAGITEE
FT                   EVKRYEVEYWPRKKHLSVTWALMAFSSALVEALIVVDRWQFLREHDTVRDCWVEPVFEY
FT                   SESPRNLAVVGIKK"
FT   CDS_pept        join(769916..769950,770020..770663,770753..770829)
FT                   /codon_start=1
FT                   /gene_family="HOG000160500" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269509"
FT                   /orf_name="AFUA_5G02900"
FT                   /product="SNARE domain protein"
FT                   /biological_process="Golgi vesicle transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86015.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0048193"
FT                   /db_xref="HOGENOM:HBG334040"
FT                   /db_xref="HOGENOM:HBG374117"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR015260"
FT                   /db_xref="UniParc:UPI000051E489"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEG2"
FT                   /transl_table=1
FT                   /translation="MDSTDPFLQVQADVLSTLQSSRPLFSSYLRIRSLAKSPSNPELQQ
FT                   ARAELEATLTDLTADLDDLVGSVRAIEQDPYRYGLEIDEVARRRKLVDEVGDEVEKMRE
FT                   ELQRVVTTADTAGGTKAHTGSTSGLPNPSDFDNVLSPSDDRGDDYYTALEQQRQMELMH
FT                   EQDEQLDGVFRTVGNLRQQADDMGRELEEQAVMIDEVDTLADRVGGKLSNGMSRIKHIV
FT                   RKNEDTMSSFCIAALIFVLVLLLILVIAL"
FT   CDS_pept        join(complement(771977..772100),complement(771076..771900),
FT                   complement(770907..771022))
FT                   /codon_start=1
FT                   /gene_family="HOG000160489" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752319"
FT                   /orf_name="AFUA_5G02910"
FT                   /product="NAP family protein"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86014.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG055428"
FT                   /db_xref="HOGENOM:HBG334041"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI0000520339"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEG3"
FT                   /transl_table=1
FT                   /translation="MGAENGQKSLSERIEMPGIPMEVAREFALLEQRFIRAETDRLRRS
FT                   TVENRPLWEKRSEIISKVQDDFWIRVLSNAPAEIDEYIQHSDAAVLGSALKDLTVERFE
FT                   VDEKGNGEPRSLRFTFVFRTGEENPFFENEKLVKEFYWRKKITKTPKGKRRTWEGLVSE
FT                   PVRINWKKDMDLTKGLLDAACDLAEAEKKGGDRKKLPEFEKLAKKMEELEAAAMEDNDE
FT                   DEEDFPTPAGTSFFGFFGYRGNVVSAEESKEAQKEDDERFERALKGEKFDDEEDDDDED
FT                   DDDEDSFDEIEIFPDGEDLAIALAEDLWPNAHKYYGQSFEIGDDYSEIDEDELEDEDEE
FT                   DEEDNSRPRKKAKV"
FT   CDS_pept        join(complement(774354..774997),complement(773874..774288))
FT                   /codon_start=1
FT                   /gene_family="HOG000160478" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269510"
FT                   /orf_name="AFUA_5G02920"
FT                   /product="Nitrogen metabolite repression regulator NmrA "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL86013.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG055427"
FT                   /db_xref="HOGENOM:HBG334042"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E717"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEG4"
FT                   /transl_table=1
FT                   /translation="MTQQRKTIAVVNATGRQAASLIRVASAVGHNVRAQIHSLKGIIAE
FT                   ELQGLPNVTLFQGSLLNNTALMDTLFQGANLAFINTTSQMGDEVAIGKALADAAKRAGS
FT                   IQHYVYSSMPDHSVHGPWPPVPLWAPKFTVENYIRQLGLPATFVYAGIYNNNFTSLPYP
FT                   LFQMELMPDGSFEWHAPFDPDTPLPWLDAEHDVGPALLQIFKDGPKKWHGHRIALTFET
FT                   LSPNQVCAAFSRALNRPCRYVRVPKIEIKVNIPAGYREQLEAIEVVFGQYNAPYFPQPE
FT                   FSRPAAGSPKGLGPANGKGAGAGMMQGPGGVVSLRVTDEARQLWEGWRDMEEYAREVFP
FT                   VEEEANGLDWML"
FT   CDS_pept        join(complement(779431..780409),complement(779015..779379),
FT                   complement(778620..778958))
FT                   /codon_start=1
FT                   /gene_family="HOG000227974" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269511"
FT                   /orf_name="AFUA_5G02930"
FT                   /product="Lysophospholipase, putative "
FT                   /EC_number="3.5.1.1"
FT                   /function="asparaginase activity"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="EAL86012.1"
FT                   /db_xref="GO:0004067"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="HOGENOM:HBG348837"
FT                   /db_xref="HOGENOM:HBG497495"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000052059B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEG5"
FT                   /transl_table=1
FT                   /translation="MTAAEATIPELLEEQADSVPESRVLIIMTGGTICMKQSPSGFVPA
FT                   RGFQEQCLARVPTFNDGSSSTMMDVVVNAAREIRPHPSLRTPQTLYGRRVRYTVFEFEE
FT                   LLDSSSIDAKGWTEIARTIERNYTLFDAFVVLHGTDSLAYTCSALSFMLQNLGKTVVLT
FT                   GAQAPMLELQNDATDNLLGSLVVAGHFVIPEVCLYFNNKLFRGNRSCKVAASDFAAFDS
FT                   PNFPPLAVTTSMRTNVNWELVNRPKNIEHFSIQTNLDTTHVACLRIFPGIKPEMVDAVL
FT                   KLEGLRGLVLETFGAGNAPHGQDNAMTNVLADAIKRGIVIVNVTQCLTGSVSPVYAPGM
FT                   SLSRAGVVAGLDMTTEAALTKMSYLLALPDSTPESVAKAMSVSLRGELTEVSQPMFRHP
FT                   DGALPERVQTLTMLGYAIAQGDFERVQEIFKIEHHWILNDADYSGNTPIHLAATSPSVE
FT                   ILRFLLLQGGSVHIRNRNGRTPLFLAANAGLSEHVLLLRKSGAHLHSDERQAAELLARR
FT                   RPAVWGLAGIGPREVSDREMEEENESLLGRREIPSRMVSGSAP"
FT   CDS_pept        join(complement(783168..783300),complement(782810..783071),
FT                   complement(781798..782735),complement(781599..781741))
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269512"
FT                   /orf_name="AFUA_5G02940"
FT                   /product="Choline transport protein Ctr, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL86011.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051F2DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEG6"
FT                   /transl_table=1
FT                   /translation="MSSLDLEKKPSVKPGSSDTSSGSDDADAIRLAEMGYSQDLQRNFV
FT                   LIVYGLLWITFISICVASSLSELASAMPNAGGQYFWANELAPQKYARFASYVTGWFGYA
FT                   GAIFACASVALSLGSAGVGMWQLGHPEFTVKPWHVVVAYEIINFFCYLFNCFGKSLPLV
FT                   AKATLYISLISFLVILVTVPACAKTHPSASYVFGHFVNSTGWKQDGIAFIVGLINPNWI
FT                   FACLDSATHLAEEVPQPEKNIPIAIMATVVIGFVTSWTYCIAMFFGLNDLNKLLSTATG
FT                   VPILELYYQALQNKAGAIVLETLLLVTGMGCLIACHTWQSRLAWAFARDRGLPGHKLLA
FT                   QVNKTLDVPLMAHTVSCFIVAALGLLYLGSSTAFNSMVTACITLLYLSYSCPILCLWYR
FT                   GRNNIKRGPFWLGKWGLAANIVTIAWTVFCLVMYSFPATMPVTTGNMNYVSAVYGVVVV
FT                   IVLIDWFVRGRRSFRGSQSCLEDAVASETETEH"
FT   CDS_pept        join(789023..789200,789259..789415,789473..790619)
FT                   /codon_start=1
FT                   /gene_family="HOG000160464" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269513"
FT                   /orf_name="AFUA_5G02950"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86010.1"
FT                   /db_xref="HOGENOM:HBG055426"
FT                   /db_xref="InterPro:IPR018535"
FT                   /db_xref="UniParc:UPI000051EDD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEG7"
FT                   /transl_table=1
FT                   /translation="MARMMRLHVGLVTGLLALSGLTDAFWRLPCRGRTGLARIDPLMDP
FT                   GKPSSHVHAIHGSGGFSMSASGADLKASSCTSCAVTQDKSAYWIPALYFIHENGDAEIV
FT                   NQVGGLLAYYLLYGENVTAFPDNFRMIAGDTYLRDFPWPIPDPPKSEWTGKQGSQEALR
FT                   QKAIGFNCLNYALDPEPSLGRHFLPNKTYLDEHCTDGVRFELMFPSCWNGKDVDSDDHK
FT                   SHVAYPSLVMDGTCPEGFETRLVSLFYESIWDTYAFKDKEGYFVIANGDPTGFGYHGDF
FT                   MQGWESGVLQQAVEQCTNPSGQVEDCAVFNIQSEDEQQQCTVDMPPALKHEKVTLTSGG
FT                   LPNNLAIQWGPAYASDVSASVSSVVSSALSAATEAVASATAQLSLHVSAFGNNLQISKP
FT                   TSTWTPTPTTSYVESAVTEAVVYVEQEIIVWVDGEKNILGTGTGSLETLSTTTRTTTRV
FT                   VSTVVTLPTETAVKREEHVHHAHKRHGHGHLHQRS"
FT   CDS_pept        join(complement(791053..791184),complement(790739..790891))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269514"
FT                   /orf_name="AFUA_5G02960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL86009.1"
FT                   /db_xref="HOGENOM:HBG055424"
FT                   /db_xref="UniParc:UPI000051F545"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEG8"
FT                   /transl_table=1
FT                   /translation="MQCQGCDGSSSRLSKPHTFDAVIGPVGCAGLIDGRNCPTQGCGWL
FT                   IERMHMTLSSLLPQGQSGRLQKCTERVKKIDNRKNDEKGDILKIKMRDT"
FT   CDS_pept        join(complement(794121..794590),complement(792478..794068))
FT                   /codon_start=1
FT                   /gene_family="HOG000160442" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057685"
FT                   /orf_name="AFUA_5G02970"
FT                   /product="LCCL domain protein"
FT                   /protein_id="EAL86008.1"
FT                   /db_xref="HOGENOM:HBG055209"
FT                   /db_xref="HOGENOM:HBG333881"
FT                   /db_xref="InterPro:IPR004043"
FT                   /db_xref="UniParc:UPI000051FC81"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEG9"
FT                   /transl_table=1
FT                   /translation="MIGEGPEDGSRVYISPVLDSENRTADPDTSDDCLLPRDEEGGATY
FT                   VPVWLRESSKSFRWGWVPLPIRKVGRATTDWVKGPTPLHSLLLKPLFPHIQELPVRYLN
FT                   RLFPKRKHKISLLLLLYIAWFTPWAIVLLHSRSAGYIEGYGRPQTLSCSTTFWEHGNGC
FT                   GLNGNDCRPFSASTVAFRCPANCHDVKLLQPHTVGNQTYSYRGLVVGGPQPGSSEPGVY
FT                   RADSFVCQAAIHSGVITNTVGGCGVMKLEGAAHSFPGSKQNGIQSVSFPSTFPKAFSFI
FT                   DLASSQATCPPDPRWTLLGITIAALAILWLFSTSPSVLFFTTFFMLFCQVGLVSDPPSI
FT                   PQFADLVSTLIARLLPASFVVYVLYKYCARPLLTPLSLPKFQLTKMFLYLPPAFIGALN
FT                   NYTFARLIPLERLTPHDIQRQPGAKLALALVIPTVVTVILSQAWQIRQGGLMPHYLKVY
FT                   CTMGLILLILLPLPGLRLRIHHYILAILLMPGTGIPTRPSLIYQGLLLGLFINGVARWG
FT                   FASIIETPAALGELPGFDGAKGWWGATYPNITDASVVISLPDAGSHGYRGNGNITFELW
FT                   ERERMAQLDVDGISVLVNDVERWRGYLDEDKRGEFTWHRHGHNGLELFHGPTIESDPDS
FT                   RVGVTDVKDDDKPEDLFFRFAFLRGAEAGEYGPAGVWLEDGSWLPPATPKA"
FT   mobile_element  795460..796056
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  795463..796053
FT                   /mobile_element_type="transposon:mariner_ant1 transposon
FT                   family"
FT   mobile_element  796134..796970
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(797778..797922,797987..798569,798662..799721)
FT                   /codon_start=1
FT                   /gene_family="HOG000160431" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904453"
FT                   /orf_name="AFUA_5G02990"
FT                   /product="Aromatic amino acid aminotransferase, putative "
FT                   /EC_number="2.6.1.-"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL86006.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG055423"
FT                   /db_xref="HOGENOM:HBG752297"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051EB7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEH1"
FT                   /transl_table=1
FT                   /translation="MARLKQMELSAPFDLSHHFSSTTVRRESSNLKRLYKYYVIPGMGN
FT                   LSGGMPHASCFPYDTLEAAVAHPQRFDPSPDNGKSAPEKDTDSPARVVVPKESKTIDLE
FT                   KKIDITTALQYGTAEGLPPMASFVRDFTRKHLHPNVPYAGGPETLLSCGATDGFNKVIE
FT                   TFTNAWNPDEDPIRQREGILCEEFVYMNAIQTARPRGLNIAAVTMDAQGILAYGKGGLA
FT                   EVLGNWDCTKGRRPHLLYTITIGQNPTGGTMSIHRRKEIYALCQRYDVIIVEDDPYWNL
FT                   QYPSAQRLAARYRNTPIDESLTTQNGNAHGNSSGYPFLDSLVPSFMSLDTDGRVIRLDT
FT                   FSKTIAPGCRLGWITAQPAVIERITRLTETSTQFPSGFVQAMVAGMILGQQADEDVRGP
FT                   KSKGKSGWKMDGWVRWLEGLRGSYERRMQAMCITLEEGKYVIKGDGSEPSESSEESGWE
FT                   VIDKVQMYDFTWPMGGMFAWIKVIFNTHPLYDKYSLETLSKALWVHMTQEPFLCLMVPG
FT                   DLFAPSQKAMDQAWQYFRLCFAPMPEKDVAVITNRLVEGFRAFWQRKDLDGLDDTEELL
FT                   QKFRNLQVEGMGNMMGIGC"
FT   CDS_pept        800185..801195
FT                   /codon_start=1
FT                   /gene_family="HOG000160430" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269515"
FT                   /orf_name="AFUA_5G03000"
FT                   /product="Impact family protein"
FT                   /protein_id="EAL86005.1"
FT                   /db_xref="HOGENOM:HBG144558"
FT                   /db_xref="HOGENOM:HBG407584"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="UniParc:UPI000051E4A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEH2"
FT                   /transl_table=1
FT                   /translation="MTSVINSLSNTDLAEEIEAINAIYEPDTVTVHFSATSASAATANS
FT                   TLNLGSSGPGDSLNTTVKLQIPDHPNLSFLLGFHASYPDTPPKILGTASTGARGEGKIA
FT                   VDVLEDIVGRTYQPGAVCLFDVINEAVEAFRELSLGGHNSSSNTNQDSEKRGAEAETRA
FT                   TPARVAADIATLSLQDAFGLDSPPEWVLSDVVTEKKSVFVGRAAHVTSLEQAQGYLDHL
FT                   LATDKKVAAATHNISAWRIRQQKQANGKGESAEMIVQDCDDDGETAAGGRLLHLMQLMD
FT                   VWDVVVVVSRWYGGILLGPDRFRIINAVGRDALIKGGFVKESTGAAEKGRKKGKR"
FT   CDS_pept        804595..805851
FT                   /codon_start=1
FT                   /gene_family="HOG000160409" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269516"
FT                   /orf_name="AFUA_5G03010"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="viral capsid"
FT                   /protein_id="EAL86004.1"
FT                   /db_xref="GO:0019028"
FT                   /db_xref="HOGENOM:HBG053527"
FT                   /db_xref="HOGENOM:HBG334055"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="UniParc:UPI000052059A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEH3"
FT                   /transl_table=1
FT                   /translation="MMFSKSGLVAVAMLGASAVEAHMKMRQPTPYSDSSLNNSPLAADG
FT                   SDFPCKLRDNAFVPPSQETIAQIGEVMPLTFTGSATHGGGSCQVSLTTDLKPSKDSKWM
FT                   VIKSIEGGCPANVDGNMSGGADVPDPFEFNYTIPAGIEPGKYTLAWTWFNRIGNREMYM
FT                   NCAPITVTAGSSKRDAAPVAEKVEVEKRSANFPAMFVANINGCTTKEGVDIRFPDPGDV
FT                   VEYDGNPSNLQPAGEAACSGTPAWTVSGGSGSPSTPSTSSSTPAGTSAGVSVSVGATVG
FT                   ATPTAEPESSSSEPAESEGAPGVFAPTSATVFPSTPTASAAPTSSSSGAGSESDSSSSS
FT                   NGALTGPCSTEGLWNCIDGSSFQRCANGQWTTAQQMAAGTECTVGQNAQFTISATAVKP
FT                   RMINAMRHRKRAHGGHRHA"
FT   CDS_pept        join(806662..806771,806868..806962,807043..807193,
FT                   807286..808051)
FT                   /codon_start=1
FT                   /gene_family="HOG000107331" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904454"
FT                   /orf_name="AFUA_5G03020"
FT                   /product="60S ribosomal protein L4, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL86003.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG055795"
FT                   /db_xref="HOGENOM:HBG316531"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="UniParc:UPI00005200F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEH4"
FT                   /transl_table=1
FT                   /translation="MASRPTVTIATADGKPSGATLPLPAVFTAPIRPDIVQQVHTGMAK
FT                   NKRQPYAVSEKAGEQTSAESWGTGRAVARIPRVSGGGTHRAGQAAFGNQCRSGRMFAPT
FT                   KVWRKWHQKVNLGQKRFATASALAASSVPSLLFARGHRIANVPEVPLVVESKTFENAAI
FT                   TKTKAAIALLKALGAGADLVKVQKSKKMRAGKGKLRNRRFRQRRGPLVVYNPEVDGKEL
FT                   VRAFRNIPGVETSSVFSLNLLQLAPGGHLGRFIVWTSAAFEALDQVYGSTTTPAALKKD
FT                   YVLPQNLVANADLARLINSSEIQSVLRAPKGEARTKRAVVQKKNPLRNKQVMLRLNPYA
FT                   AAFSKEKLGQKPVESKEKPARPAQEFINTLREE"
FT   CDS_pept        join(816316..817280,817351..818278,818367..819389)
FT                   /codon_start=1
FT                   /gene_family="HOG000160398" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752320"
FT                   /orf_name="AFUA_5G03030"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL86002.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055422"
FT                   /db_xref="HOGENOM:HBG334056"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051F2C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEH5"
FT                   /transl_table=1
FT                   /translation="MSAYYVGPFGRMLPVTDRNSPEREPERSANEPVSGNHPYQLPPPR
FT                   TMESLQFGTDPFLSRRNLEGNGDSRLGSSAHGHQPVINEQLPSVSELLTPSSRSSQSVS
FT                   PNRSRLFGFYHPTGESPKPSQPSQRPHTTSRHDDTGVPRTPQGRPEARAERFSRPTAGN
FT                   LPSLSQMSIYTAGNEASIHGGIRTDVPQQQAHLSPFTPQGRVSHDKEIREENSLPGTHE
FT                   IGSAAADQSKMAQVRPHVVDERYIEGEGWCYIYADGSHCPKTIDGVPVNANWGVTKAGK
FT                   PRKRLAQACLTCREKKIKCQPNLPKCDQCQKSGRECRFESAPRGHRAAAKANTHGNRYD
FT                   TRDSSSSFVGHRPSSSANSVYSAVRASESSASLPGTNSQSPMSDASMLTPPAINSAHEP
FT                   SLDSDSHYRSRRQSLGRPSSGAEDPNRRSVEGISARATPDYTEILMEMRDLDPHDPLAH
FT                   EWNTDPFEHDAELTTHYVENYFTYVNDSLYYIFPRRRFLLWLRSCHAKSLEDKMLLYSM
FT                   MTLGAIFSDRPDRLAAMKRASRTARYAVEHSRHNLSLQLAQSRIIMSLWYYAIGALEKS
FT                   WDALGAAVRTVCGLRYNVELGGVIVDRDRVCEYGLHPQALIECRRRTFWVAFLMDRLSC
FT                   FYSSTSAFIPSQTAYLRMPCREEVFEAQQYTTVPYFQSFLNQPPTSTDHELSELSAMAL
FT                   LIEMVSLWGEVTDHVFRLSLVPMESNTTPFEEFYTTICQRADAWVARLPEHLRFSTLNM
FT                   ERSFRARRPDPFFSIHLLYHATMMKLNRHARGHDYRAAFVSRQVRTARTHAAETLRIAL
FT                   ALAHYTGEYDASRMAIDSTPSQATILNPFLGYVILSAVDIISAAGLVADMPECVKLIRG
FT                   GLEAVKELGRFWESSLPLVSLIETRLESLMEILHDPTKLDQKMVFAAKGHSLDSRTQKQ
FT                   QSPITDDLFYGALPHDRLFNALGSEVAPLTESNILWIREKD"
FT   CDS_pept        join(820454..820993,821071..821415,821478..822842,
FT                   822893..823039)
FT                   /codon_start=1
FT                   /gene_family="HOG000160387" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269517"
FT                   /orf_name="AFUA_5G03040"
FT                   /product="DnaJ domain protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="EAL86001.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG023724"
FT                   /db_xref="HOGENOM:HBG055421"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000051FA35"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEH6"
FT                   /transl_table=1
FT                   /translation="MSSGSEDWLGAGGGAATDDDIHTQRPRYASGNNENLNEDADYSMI
FT                   MSYPAEEEDYYALLGLRRTPTPSDAEIRSAYRNLTLSFHPDKQPAELREAAERHFARIQ
FT                   EAYETLLDPKKRVVYDLLGAEGVRREWGAGGAMGRGGEAESQIGVRAQTPEEFRGWFLE
FT                   TMKKRERKVLNSLVQSRGSLTLGVDASNMIEVDENAGEVYIHIPSPSLSSYAIRYSFKA
FT                   PLPTPKVLFGKEADEEDDEDEAPDGRSTQQKVNSYQEAQGPEITFNAGISGNLRRSFRK
FT                   MQFQFEDGETMTRAVPLPLFIAGRDISLGAGISQRFGDVASMKGILAKRPFAFLRDSAF
FT                   ALNAALLPTPLLQGTIATAVQPIPGTKPFQINTSAIIANSILKTPPILAIQVTKEIGER
FT                   KHAFCSWSSGTISWPSVLQVLFSPIANLGLDTESAISMTAFAQPSQFQLGFLSVPKQNR
FT                   NTVVLGDDEDQAAEEDDDDEEEAELRQIRRKARSEANAAESWQAVVTASPQEAGLSFTY
FT                   ARNIFNGKSASELARSEWSSEGHYSLPPASEPRSVRVEVRSSVNMDLSLAWNISGTRQV
FT                   GRFTRVGFGVGVQGGRGLVMTASWSRLGQKISLPVAVCPMDVVNADAAALAVILPWAAY
FT                   CALEFGYIRPRERRQRRRAIARRHKQLKRLIPKKRAESQQAIELMAEHVHRRQAREEKE
FT                   GGLVITKAEYGHYPSPKRWTTDSGDAAKALEVADVTVPVAALVDHGQLVISKDTVKFQI
FT                   LGFYDPAPLLPKKLKIWYTYRGNEHFVEANDSEGIACPMRTHLVG"
FT   CDS_pept        join(823582..823728,823808..825235,825361..825525)
FT                   /codon_start=1
FT                   /gene_family="HOG000160386" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269518"
FT                   /gene_name="prp45"
FT                   /orf_name="AFUA_5G03050"
FT                   /product="Pre-mRNA-processing protein 45 "
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="EAL86000.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="HOGENOM:HBG373713"
FT                   /db_xref="HOGENOM:HBG627562"
FT                   /db_xref="InterPro:IPR004015"
FT                   /db_xref="InterPro:IPR017862"
FT                   /db_xref="UniParc:UPI000051F053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WEH7"
FT                   /transl_table=1
FT                   /translation="MTSVAEGLFKSLPKPKYTGEDEEVPQHAQPRGPRIVGADQIDQSQ
FT                   IVLRRTGPPPYGNRAGWRPRAAEDFGDGGAFPEILVAQYPLDMGRKGTATTSNALAVQV
FT                   DAEGKVKYDAIARRGHSENRIVHASFKDLIPLRQRVDMGEISLDRPSEEEVQAQMEKTK
FT                   NALASLVEGAVAAQKPKNVKGGRRAEPTFVRYTPANQMGDTTRKNDRIMKIVERQQDPM
FT                   EPPKFKHKKIPRGPPSPPPPIMHSPPRKLTAEDQEAWRIPPPVSNWKNPKGYTVPLDKR
FT                   LAADGRGLQDVTINDKFAQFAEALFTADRHAREEVRLRAQMQQKLAEKEKAQKEEHLRA
FT                   LAQKAREERAASNRRDSRARSHTRSASRSPSAYSRSATPSDDEEAARERERIRRERRQD
FT                   AERQLRQSRMGTERRIQMMAREQNRDISEKVALGLAKPTQTSESMWDSRLFNQTSGLQS
FT                   GFNEDNPYDKPLFAAQDAINSIYRPRAQLDVDDEEGAEGEMSKIQKTNRFEVLGKAKEG
FT                   FRGAAEAEARDGPVQFEKDTTDPFGIDSMIADVTGGAGQKRYGIQEVEREDRGSKRARV
FT                   DDD"
FT   CDS_pept        join(828603..829057,829119..830127)
FT                   /codon_start=1
FT                   /gene_family="HOG000160365" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752321"
FT                   /orf_name="AFUA_5G03060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85999.1"
FT                   /db_xref="HOGENOM:HBG055420"
FT                   /db_xref="HOGENOM:HBG334057"
FT                   /db_xref="UniParc:UPI000051F544"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEH8"
FT                   /transl_table=1
FT                   /translation="MIRTDYYCERLVLLTTTIEAQDDRLALVHIPLDLYPYFLTPILQL
FT                   LFHEVPPVDQNHAEDLKNGSRDGLKHAQPAFLNFSITPVECSIMCPRQLANKYFAPMID
FT                   NFVQNHASPQSRLSISQDDFIAMQVYGEGLEAGQRVLELTSPLAMAGISIFFISTYFSD
FT                   YIIVPLRSKAQVIEALERRGFQFEITTEAFINHNQSQYSGYSSPVSSRSASSLGSPPAT
FT                   PPPSSLDELQGRTFASLRKNHIVPSVDRSLRLVQCAAHHPYSSDASSISILRTALTTAL
FT                   VVDRPRFLSLTLTAADPAASLLLEQRLLPRFLNDGTSSAESTDETSLLLGSKEDVLVPI
FT                   TLDLRKLPLEATGIVCGVASRLADATHGAWDESTEASTVALSHSFNGISSFESSLNRYF
FT                   SSSVDSGGPVRPPAQNPTHRTPNGDLSTPSTHHLQPDLDTSLEAVEISFLSTARAGTIL
FT                   VGEHELHRAMDALEAESHEPDLPAGVLEV"
FT   CDS_pept        join(complement(832639..832696),complement(831419..832584))
FT                   /codon_start=1
FT                   /gene_family="HOG000091642" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904455"
FT                   /orf_name="AFUA_5G03070"
FT                   /product="WD repeat protein"
FT                   /protein_id="EAL85998.1"
FT                   /db_xref="HOGENOM:HBG055419"
FT                   /db_xref="HOGENOM:HBG621401"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000520811"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEH9"
FT                   /transl_table=1
FT                   /translation="MPATKQFPTKLVHTLKTHNGPVNAVTFSSYPGTYVLTGSSDRAIH
FT                   LSRAIPNSSTTGHETTSPIQKYEAHGYSVLDVAVAADNARFTSVGGDRQVFLWDVEQGI
FT                   TTRRWAGHNARVEAVQFAGEGDSVVVSGKSPSSVTPVCSVVEASGILTFLSGSADTTIN
FT                   LWDTRSKSHKPIQTLTEAGDTVSSLHVHMPTYSIASGSYDGRARIYDVRMGRTTVDVLA
FT                   HPVTSVRCSADGNALLVSTLDSRIRMLDRADGKLLKAFGGEEGLEQSTTGARVTYRNSE
FT                   LRIRSVFAKGDAVVLSGSESEKGDPSPQAHVFAWDVLSGEVIATVRAGNGVKVVSCVAW
FT                   NEKGGCWAGGCSDGKSRHVNFCACISSLLTMVLCRHRQNLRLNEKRIQTIAANQGAFCD
FT                   IASSQFVG"
FT   CDS_pept        join(complement(834727..834771),complement(834639..834652),
FT                   complement(834527..834569),complement(834309..834471),
FT                   complement(833936..834246),complement(833364..833872),
FT                   complement(833226..833295))
FT                   /codon_start=1
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904456"
FT                   /orf_name="AFUA_5G03080"
FT                   /product="Septin"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="EAL85997.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="HOGENOM:HBG490088"
FT                   /db_xref="HOGENOM:HBG715249"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI000051F543"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEI0"
FT                   /transl_table=1
FT                   /translation="MATTSETASPIGIANLPNQRHKIVAKRGAAFTIMVAGESGLGKTT
FT                   FINTLFSTTIKNYADHKRRHQKQIDRTVEIEITKAELEEKFFKVRLTVIDTPGFGDYVN
FT                   NRDSWQPIIEFLDDQHESYMLQEQQPRRTDKIDMRVHACLYFIRPTGHTLKPLDIEVMK
FT                   RLSSRVNLIPVIAKADTLSPTDLARFKQRVKAVVEAQGIKIYTPPIEEDDEHAAAHARS
FT                   LMAAMPFAVIGSEKDVKTNDNRVVKGRQYAWGVAEVENEDHCDFKKLRSILIRTHMLDL
FT                   IHTTEEQHYEAYRAQQMETRKFGEARPRKLDNPKFKEEEEALRKRFTEQVKVEEQRFRQ
FT                   WEQKLISERDRLNKDLEATHAAIKALEQEIEALQGSTTRSHGRR"
FT   CDS_pept        join(834890..834979,835287..835399,835472..835967,
FT                   836017..836264,836314..838147)
FT                   /codon_start=1
FT                   /gene_family="HOG000160363" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209030"
FT                   /orf_name="AFUA_5G03090"
FT                   /product="Small nucleolar ribonucleoprotein complex subunit
FT                   (Pwp2), putative"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="EAL85996.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG037471"
FT                   /db_xref="HOGENOM:HBG721153"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000051E47F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEI1"
FT                   /transl_table=1
FT                   /translation="MRKNAVEKGLSLFHCLKSSSRTFSLVWIGLFSNLLGTVYRKGNLL
FT                   FTPDGNCLLSPVGNRVTVFDLVQNTSYTLPFSHRTNIDRLDLSPRGNLLLSVDENGRAI
FT                   LTNFVRRIVIHHFSFKGRVTALKFSSTGRHFAVGVGRRLQIWHTPSTPGTDNNGEIEFA
FT                   PFVLHRDLAAHFDVIQDIEWSRDSRFLLTASKDLTARIWSLDPEEGFEPTTLAGHRQGV
FT                   KAAYFTADQESIYTISSDGALFRWEYVTKKDPDTMEDIAEARWRIVKKDYFMQNDAKVN
FT                   CATFHAPSNLLVVGFSNGLFGLYDLPDFNPIHQLSVSQSNIDFVTVNKSGEWLAFGSSK
FT                   HGQLLVWEWQSESYILKQQGHLDSMNALAYSPDGQKIVTAADDGKVKVWDVKSGFCIVT
FT                   FTEHSSGVTACKFAKKGSVLFTASLDGSVRAWDLIRYRNFRTFTAPSRTSFTSLAVDPS
FT                   GEVICAGSPDSFDIHVWSVQTGQLLDQLSGHEGPVSSLAFAADGNHLASGSWDRTVRVW
FT                   SIFGRTQTSEPLQLMSDILDVAFRPDGKQVAASTLDGQLTFWSVDNAVQEGGIDGRRDV
FT                   SGGRKMGDRVTAANSAATKHFNCITYSADGSCILAGGNSKHICLYDVRSGALLKKYTVS
FT                   VNTSLDGTQEFLNSRDLTEAGPRGLIDETGEASDLEDRIDRSLPGAKRGDAGTRKTRPE
FT                   VRVTAVDFSPTGRAFCAASTEGLLVYSLDTEFVFDPFDLDLDITPTTILATLDAAKKAH
FT                   SMNTADDDNTFLKALVMAFRLNESKLIRAVYEAIPPSEIPLVVRALPTVYLSRFLRFVA
FT                   QSAEETPHLEFNLRWIESLLSIHGRYFKDNSGTLATELRAIQRAVDDIRENLRKLTEKN
FT                   LYDLNYLLSKPVLADKINGVPKAIQDYDAILVDGEDARMSDVDGDDREGEWVGLE"
FT   CDS_pept        join(838653..839012,839069..839194,839252..839468,
FT                   839526..840143,840208..840617)
FT                   /codon_start=1
FT                   /gene_family="HOG000160342" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209031"
FT                   /orf_name="AFUA_5G03100"
FT                   /product="Cytochrome P450 monooxygenase SirB-like, putative"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="EAL85995.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG055409"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="UniParc:UPI000051FC97"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEI2"
FT                   /transl_table=1
FT                   /translation="MHLASFSLLTSITLHHYCAHNTPITLHNIDQLLNGTSLAQRRILR
FT                   LSSAKLSVMADQVLELPCWPFALLLSSSLYFFHYPPGETSAEIPTVRFSRFLPGFINRL
FT                   MFIFVAPYLIKYGYEKYRDQPYRILKADGDLLVLPPKYLPEIRHLPPSKLSGVDAQFEN
FT                   ILGKYTNVLIDSNLPVKTVHKGLTPAIGKYLLCVHLLECLTADESQLQGRVLPRLLDEL
FT                   QFAFQVEVPDCDDRWVPVNLYDMILGLVTRATSRVIVGKNICRNSQWLETVTSYTVNLG
FT                   VTVILLRPFPNFMRPLVAKVLPSVKKLRTQLRFVQNELFIPMILARREAEINGPAYQKP
FT                   DDFLQWMMDLAEDDFDKDPANISQMLLIVMALAVVHTSSMLMTHAIYDLMIRPEYIEPL
FT                   REEIRGTLKDGWDKVTQASFASQRRLDSFMRESQRFNPTGELSTHRMVMETMVLSDGLV
FT                   LEKGTHICFPSKPMGMDDSIIEDALTFRGFRWCEDPEARSTSLVSISPSNMHFGYGRQA
FT                   CPGRFFAANTNKAILGRLIADYEFKFEGDNNKRPRNLTLGEQIMPNMHTKILLKKRAFV
FT                   "
FT   CDS_pept        join(complement(841754..842201),complement(841602..841679),
FT                   complement(840984..841552))
FT                   /codon_start=1
FT                   /gene_family="HOG000219459" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057686"
FT                   /orf_name="AFUA_5G03110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85994.1"
FT                   /db_xref="HOGENOM:HBG305047"
FT                   /db_xref="HOGENOM:HBG323811"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="UniParc:UPI000051FC80"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEI3"
FT                   /transl_table=1
FT                   /translation="MRGDMENGASSIIAVLFLTQLNVYFYNHLRRIPEKYRDMASVTPL
FT                   PTFDNLTIDPSGPPGNAWGLFGKNNELGMLNLLTPETVRRAAAEEIRDGVRFSLDLPLD
FT                   RIKNPSFGRKPFARELVNKAPRIVNDDILVFNTQCSTQWDGFRHYGNHRHKRYFNGHSL
FT                   EDLKISPVIGIDAWVKHGGIVGRGVLIDYASWATKNSIPLSPFNTTKIPLSAIKQIVEE
FT                   NDIRFRPGDILFLRTGFTAAYDKLSPDEELAISQRETPQFAGLEAGEATLRWLWENQFA
FT                   AVASDSPSFEPSPIAGPQGPPEFQLHQWLLAGWGMPIGEYFDLEKVAEYCAKMNRWSFF
FT                   LSSVPLKVSEVVMLCFRMVGEGFY"
FT   CDS_pept        join(complement(845210..846908),complement(842554..845111))
FT                   /codon_start=1
FT                   /gene_family="HOG000160331" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269519"
FT                   /orf_name="AFUA_5G03120"
FT                   /product="Exonuclease Kem1, putative "
FT                   /EC_number="3.1.4.1"
FT                   /function="5'-3' exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /function="phosphodiesterase I activity"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85993.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004528"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008409"
FT                   /db_xref="HOGENOM:HBG036144"
FT                   /db_xref="HOGENOM:HBG611558"
FT                   /db_xref="InterPro:IPR004859"
FT                   /db_xref="InterPro:IPR016494"
FT                   /db_xref="UniParc:UPI000052080A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEI4"
FT                   /transl_table=1
FT                   /translation="MGVPKFFRWLSERYPTISMLIAENRIPEFDALYLDMNGIIHNCTH
FT                   KDSDSPTFRMTEDKMFIAIFNYIEHLYGKIKPRKLFFMAVDGVAPRAKMNQQRARRFRT
FT                   ALDAEVAKEKAIAQGIEMPKEDPFDSNCITPGTEFMAKLTQQLKYFINKKISEDKDWQG
FT                   VDIVLSGHEVPGEGEHKIMEYIRHAKAQPGYDPNIRHCLYGLDADLIMLGLLSHDPHFC
FT                   LLREEVTFGRQVQKKPKELEHQNFYLLHLCMVREYLELEFQELEQEGVLDFPFDMERVI
FT                   DDFILMAFFVGNDFLPNLPNLHINEGALSLMFKIYKDVLPKMGGYVNEGGVINLKRLGM
FT                   LIEALSDVEFRFFEAEYSDARWINAKRNGVANGSEFQEKPKGLTLTPAQKELFKEIKKY
FT                   VLNRPEKASGSKPLDLSPTLPARDRKFVEQLADDLRLPWTTVADEHGDRFIRLQLPVNE
FT                   DDDSEEEEDEEASMAVQRVIRRYDNAKVQEISPEEAQKAAEKKYEEKFQDWKDKYYMSK
FT                   FGWGLDNHEELRKLTENYVQGLQWVLYYYYRGIASWPWFFKYHYAPMISDVIKGLNADM
FT                   NFKLGQPFKPYEQLMGVLPDRSKQIVPAAFRDLMTSPESPIIDFYPREFELDMNGKKME
FT                   WEAVVKIPFIDERRLLEALATREHLLTPEEKARNGFGVSLKFTYSPEVNFTYPSSLPGV
FT                   FPDIPSCHCIENIFDLPTMDGLEPYIGLVEGVQLGAAALAGFPSLKTLPHVGQLGFHGV
FT                   CVFQQESRNESMVITVLDPGSRSNIELAKQKLGKRVFVGYPFLQEALVIRVSDELFDYL
FT                   LPEGENHVVSIPHTEAQIDQWKKKADKIEGIYSRRLGTIIGPVESMVHVQLLKGLIKTD
FT                   EGATIKEFADIPGQETDYALQLVVDEVINPDERFIERDALPIEKEFPEGSRAFFLGDFN
FT                   YGRPVHITGHEDGKVNGLIAAIKGREPEFGRDRAREAERLCPYMPSFAIARSLRLNPLV
FT                   LAKITSSFSVDIEGQRVNLGLNLKFEARKQKVLGYSRRGESGWEFSPKAVDLLQQYMIK
FT                   FPEFIAGIQRNPQKDRYQPTDFYPEDVALVKMKEIRDWLKAMEAKNFERVPLEAEQLDS
FT                   DVVKLIEQDADRLVQSQPPMQPKKIRGVPRSALLRPSDVEQRLQNQTFKLGDRVVYAQD
FT                   SGKVPIATRGTVVGLTRTPRAMLLDVVFDVSFMSGTTLGDRCSPFRGQTVLASSVLNVS
FT                   YRQLLASTRAAASQQAQSQPSPLTVAGYGAPLGPNGLGQLKEAAAPPPLTNSYRGVVSG
FT                   LSNTRGNSASHRGRGGRGAANGGSPQTTLPIRPHPSSGDGAEQRGGRGRGGMYRTRAGY
FT                   VSVDNSNPEAGVVRNNPHFRPKNYSQVPPPKALNRGGGRGGGRGGRGGFHGPDRGSGSR
FT                   GRGSHRGRGAATISTK"
FT   CDS_pept        join(847533..847551,847610..847672,847737..847842,
FT                   847896..848357,848411..848896,848956..849130)
FT                   /codon_start=1
FT                   /gene_family="HOG000160330" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269520"
FT                   /gene_name="hat2"
FT                   /orf_name="AFUA_5G03130"
FT                   /product="Histone acetyltransferase type B subunit 2 "
FT                   /EC_number="2.3.1.48"
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85992.1"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG021032"
FT                   /db_xref="HOGENOM:HBG435352"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI000051FA34"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WEI5"
FT                   /transl_table=1
FT                   /translation="MEPYDDAVVEEHEEQEEERTEEKIINEEYKTWKKNAPFLYDMILS
FT                   TALEWPTLTTQWLPDKQEVPDKPYSTHRLLIGTHTSSDAQNYLQIAHVQLPNPSAPNPD
FT                   DYDEERGEIGGYGGSSKKAPMEIKFNIVQKIDHKGEVNKARYQPQNPNIIATMCTDGRV
FT                   MVWDRSKHPSLPTGQVNPQMELIGHTKEGFGLSWSPHTAGQLATGSEDKTVRIWDLTTY
FT                   SKGNKLLKPSRTYTHHSSIVNDVQYHPLHSSLIGTVSDDITLQILDIRESETTRAAAST
FT                   EGQHRDAINAIAFNPAAETVLATGSADKTIGLWDLRNLKTKLHSLESHTDSVTSISWHP
FT                   FEEAVLASASYDRKIAFWDLSRAGEEQTPEDAQDGPPELLFQHGGHTNRISDFSWNLND
FT                   PWVLCSAAEDNLLQVWKVADAIVGKDLEDVPTEELEP"
FT   CDS_pept        join(850226..850488,850542..850675,850749..851053,
FT                   851112..851414)
FT                   /codon_start=1
FT                   /gene_family="HOG000221222" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16269521"
FT                   /orf_name="AFUA_5G03140"
FT                   /product="GTP cyclohydrolase I, putative "
FT                   /EC_number="3.5.4.16"
FT                   /function="GTP cyclohydrolase I activity"
FT                   /biological_process="one-carbon metabolic process "
FT                   /biological_process="tetrahydrofolate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85991.1"
FT                   /db_xref="GO:0003934"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0046654"
FT                   /db_xref="HOGENOM:HBG219138"
FT                   /db_xref="HOGENOM:HBG370191"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniParc:UPI000051F052"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEI6"
FT                   /transl_table=1
FT                   /translation="MSSGSPPPGPKPKSAIPPHLLNGSSPLHPSNSTGGRDARERESLN
FT                   SSIRSSFAPRIPAEFHLPEIETHHVSDAADTYNGPVRKSGVIRPTLSDPPRDPRDEGGA
FT                   LTPPASSSRPSSPYTANPPIDFDGLSWPCPGTRARLESTPEQTEERIQKLAGAVRTIFE
FT                   CIGEDPEREGLRETPERYAKAMLYFTKGYEENVRDLVNGAVFHEDHDELVIVKDIEVFS
FT                   LCEHHMVPFTGKMHIGYIPDRRVLGLSKLARLAEMFSRRLQVQERLTKQVALAISEVLK
FT                   PRGVGVVMESSHLCMVMRGVQKTSSTTTTSCMLGCMRSSAKTREEFLTLLNRK"
FT   CDS_pept        852077..854656
FT                   /codon_start=1
FT                   /gene_family="HOG000160309" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269522"
FT                   /orf_name="AFUA_5G03150"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85990.1"
FT                   /db_xref="HOGENOM:HBG055378"
FT                   /db_xref="UniParc:UPI000051FED3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEI7"
FT                   /transl_table=1
FT                   /translation="MHCFGLLVLVSGWWFRYSHSTRMSNSLHDELESFVFLCLHLLIIA
FT                   LLLTRLHPSFVSLNKHFLQVSCSAFPVDSAPLLTTGLSFPSHPSVFEQTTMARTIQSEL
FT                   TPSAHEIGKGLPLTTRYTLADRKQSKAPTRPERTPDELEAGEALILLSRGYGDPPAGPR
FT                   QNMQTQNDLGSYQMRNNRGVPSNAYPRARQNTVLAQADGRMQIPQNVPQQPASAAMPAM
FT                   QTGPYWNGNPAAAQRVALTGQEALQAYLIRQQILAGVAPQDIIMMRGPPQHGRPAVPPL
FT                   VRITNQGVYAPVIPPATFNGVFHPFPMLPVQQNKPNVPAPTATPGVPYPAVAPGISPQT
FT                   AREPQCHCPPNGRMMPQEAGKFQAQRPLNRDHSNAAAMAGLDTNLGAQNRVVLPAVMQP
FT                   NGQQPQGPYFLPARTIAERNVNMPANNMIARHNGIFEKNAGSQRPSCKTPRIKTESPEP
FT                   EEVLANQVDHTSIRKTVLEATGHRRLLSQPHTAPQPPNGGHRSATNGTDTRQSSAIPTA
FT                   AAHSSKNAALHTRNESKTSRRDNYNMLKALICHPSMAFLVFDHLEIEDVVNLHLSCKPV
FT                   HQFVRSVLAIIVMRKAAQKAPESLCTFPFLCYNRLCDRWSAPPGLKLNDITYIIPSVRW
FT                   LKMILYREAIVKDIMKRMADKGWKLPDRCATVVKKLWFLMDIPDNRRRTWTIRKKTLWT
FT                   DNDLFLAAYFIVQLDMLFTDSRARKKQGSMRRLLMAQPSLTLLWDVLRDSALTTHYETL
FT                   KAYVRWQYIPRAHEAGLFVFGVPPNEVGSLQWEGYGRMARNAKIQRPDELVLREIKDRN
FT                   LDMQRMYVDIILSDKLEPKEDVSPYRWHEEIMKEFENLPWMQVVNVK"
FT   CDS_pept        join(857006..858168,858249..860153,860204..860414)
FT                   /codon_start=1
FT                   /gene_family="HOG000160298" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269523"
FT                   /orf_name="AFUA_5G03160"
FT                   /product="Protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85989.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG055373"
FT                   /db_xref="HOGENOM:HBG334061"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051F52C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEI8"
FT                   /transl_table=1
FT                   /translation="MAGSRNSPLLRDQWSAPSETRDQRERGRQRPRGSNRDRGRDRFRD
FT                   RERRRRSKGNGPIPPLRSPPPSRSQPQSELGGPRSYREISPNNTSPRGSSGLPYSEARQ
FT                   RQNQDHRQFVDPQPLEGERPTGRDYRRDNSPSAPPPFKRKRTQSPSPVRPFSPRQDPSH
FT                   HHPASEQFDEFDRGYPHKKRGRYPGRGRARRRSPRRGRDRRRKESDRFKGLKSPLRGPR
FT                   SPRHPRERYNSPDPADDIDQEYHHRSPSRYSINSAGSRFSATSRHSFRVDATMNPRPIQ
FT                   SAMNNSFRSSSPPRPVPSFNAEITGVPTEGDPNARETFPFNGERALNANDNQRSHPSRL
FT                   QADTSQYSTSPKYGPSSNSYQGSPQSTSPHPGGRGGLTGQSPHQRPRGSSHSSPYRQSN
FT                   YPSQGGSQDQFNQGQAPPTGPANHPQSYSGPSYRGGHSGYRGNSQNHGRDQRFSGSGHS
FT                   SYNTGPSGRGRFNSFQWNARGGGGSVSPHTTHPEPSQSPAPLPAAGEQSFSGEGDRDQA
FT                   FGSPSRDLQTLDQGSKPCSEDVDFPKISRPTQPSDTNATPNKGGKFSFAFKAKTTPAPA
FT                   PKPVPDLAQRMQAREPPPRVAEPARSRVPLGPPPRFKPEPRFDRRDRDRDRDRHRNRER
FT                   DRGRRDRRDFRRDPRDYREPRDIRDNRKEDRRFDQRHVGRKEDRRQDPRPPRGPRERSP
FT                   GVKQPQVLTRPKPRPTLPEEYAKSDSVYYRKPGNESVIGAGTYGKVFKAIHVYTQRKVA
FT                   LKKIRMEGEKDGFPVTAVREIKLLQHLRNHNVVSLLEVMVERNECFMVFEYLSHDLTGL
FT                   INHPTFTLTAAHKKDLAKQMFDGLNYLHHRGVLHRDIKAANILISNRGLLKFADFGLAR
FT                   FFSKSRQLDYTNRVITIWYRPPELLLGETRYGPAVDVWSAGCVFVELFTKKAVFPGEGG
FT                   EISQLEKLYASLGTPTRAEWPDLVEMPWFELMRPTERKKRVFEDIYREVLSPAALDLVS
FT                   QIFRYDPTKRPSAEEVLTHPYFVSEEPAPQQAIELENIEGDWHEFESKALRKEKDKEAR
FT                   RAEYQKDKEKRKAALSAPQSERETKRVRQDVEENLQPSAQPVEQ"
FT   CDS_pept        join(complement(861906..861918),complement(861512..861678))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269524"
FT                   /orf_name="AFUA_5G03170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85988.1"
FT                   /db_xref="HOGENOM:HBG055366"
FT                   /db_xref="UniParc:UPI000052032D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEI9"
FT                   /transl_table=1
FT                   /translation="MRVYFIGLSRFLRALPLPSSGIQPITIHPVLLRPHHRFSCLFPLK
FT                   KKILSFSPSSFLLL"
FT   CDS_pept        join(862243..862277,862352..863140,863198..863417)
FT                   /codon_start=1
FT                   /gene_family="HOG000160287" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057687"
FT                   /orf_name="AFUA_5G03180"
FT                   /product="Translation initiation factor eIF4E3, putative "
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85987.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG055359"
FT                   /db_xref="HOGENOM:HBG559144"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="InterPro:IPR019770"
FT                   /db_xref="UniParc:UPI000051F7C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEJ0"
FT                   /transl_table=1
FT                   /translation="MDNANLWTRRANSAKLSLSMTGTDGKDGGAKVDLPRGHTSKRFGP
FT                   DSSHGGRSNPFNALSPLSGGVSSPSTNASSAFGLGSGAFASFGTPKTPGTNASDLNSSK
FT                   ALGEKRETASEQDSAADVKAKASASSLTGPKEHALKSTWVIWYRPPTPKYSDYEKSTIP
FT                   LASISSVESFWSIYTHLKRPSLLPTVSDYHIFKKGIRPVWEDDANKKGGKWIVRLKKGV
FT                   ADRYWEDLLLAMIGDQFAEASDEVCGAVLSVRSGEDVLSVWTRIDGGRNIKIRETIKRL
FT                   LAFPADTNIVWKSHDDSIAQRSAIDQARQEKAAGNAGHHHHHLAGDRRRPTANDESMGD
FT                   KGKAAAS"
FT   CDS_pept        865293..866093
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752322"
FT                   /orf_name="AFUA_5G03190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85986.1"
FT                   /db_xref="HOGENOM:HBG055350"
FT                   /db_xref="UniParc:UPI000051F051"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEJ1"
FT                   /transl_table=1
FT                   /translation="MKATRSQVSPKLGAKRFRHRFSPEDELEQCFTENAARERRFSTPS
FT                   VKHEVLQSVEIQKPRRLDRSGSPSLHGHPTKERRGSESRESPDELQGAATVQPAQDFSR
FT                   EFHKKDVRGGFKAGKQVAQRKTSPADIRPTVFVPSSHQGKSKRKITKSGTRPSADRCFQ
FT                   ATSIRFGTITGPSSGDKAVEVHVDPINETIKMAGPDPANSFQIPFNKVYKIFRGTSPSC
FT                   KVRLALREGTGDQSVDIDLTSPEAKEDLYALLAGSGAKVVEKDG"
FT   CDS_pept        866567..868471
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269525"
FT                   /orf_name="AFUA_5G03200"
FT                   /product="Ulp1 protease family protein "
FT                   /EC_number="3.4.22.-"
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL85985.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="HOGENOM:HBG055345"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="UniParc:UPI0000520345"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEJ2"
FT                   /transl_table=1
FT                   /translation="MLLTWRRSDDEEENPPQQQCEKISRKWQRSVEHYSLQSLLCRING
FT                   FNRPLVYPRFGKKKAEVDGQDLERLRDNEFLNDNLIGFYIRFLEDHLERNNKEVSQRVY
FT                   FFNSYFFATLTNLPRGKQGINYQGVQKWTRNVDIFSYDYIVVPINEAAHWYVAIICNLP
FT                   KLPGIMKEEEVIDQHAEEDAEPSALPKRDDAENPNTPQTVGIMSSDSGEAETGARSAPN
FT                   PEKEELARESLAAMSLLDRKEMKERGELEVPPSDEEWPEKEENPVSSPAKLSSPPRDTE
FT                   PSKQVNSQDARQSSASGSQKSRKPKKKRQGPRYEVWQPTVITFDSLDLSRSPTISVLRN
FT                   YLREEAQSKRGVEIDTTLIKGMKAQEIPLQPNYSDCGLYLLAYVEKFVQDPDTFVTKLL
FT                   RRDMRVEDDWPLLRSGLLRSRLRKFLDELYDEQEQLSREKAAERATMVDRQPISYLLGL
FT                   GGKTDLAAENMEDASATRSEKLPSRNPPLEVSGLELAQKAKLGESRSVTRSSSRDGTPD
FT                   STAQAKMSTPQTLAASASGSTTRKEVVEVPDSQEQVQLENVTSHCLLHVGDSQGRQARF
FT                   RPQGPNPVEEDTERTQIPHQSANGSIVEVQVLGTPPPGLSTAEPDGVRQSPRSLKKRV"
FT   CDS_pept        complement(868816..869553)
FT                   /codon_start=1
FT                   /gene_family="HOG000160265" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269526"
FT                   /orf_name="AFUA_5G03210"
FT                   /product="Disease resistance protein Aig2, putative "
FT                   /protein_id="EAL85984.1"
FT                   /db_xref="HOGENOM:HBG055337"
FT                   /db_xref="HOGENOM:HBG334064"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniParc:UPI000051F2DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEJ3"
FT                   /transl_table=1
FT                   /translation="MGDHVLFFYGELFVHDHSLRTCTYAVDKRCSPDASHMPQPVLPVY
FT                   QLNEPPHTQTHTNKRNSGTLMAPQILHRVIHGRPDPEPWQKGMLSFKPAILHGYRRHRV
FT                   RGADYPGIVPCPNDIEDSTGGPGSASVLGTVVSGLTDGDVHRLDVFEGSEYVKERVRVR
FT                   VLAESLSVGGRQEASIAKNPDRHLKDVLDAAGAEFADEREEVEALTYVYVAGQDRLEDA
FT                   EWDFEAFKRDKMAWWVDADESEW"
FT   CDS_pept        join(870080..870225,870289..870362,870418..870956)
FT                   /codon_start=1
FT                   /gene_family="HOG000160254" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752323"
FT                   /orf_name="AFUA_5G03220"
FT                   /product="Microsomal signal peptidase subunit (Gp23),
FT                   putative"
FT                   /EC_number="3.4.-.-"
FT                   /function="peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="signal peptidase complex"
FT                   /protein_id="EAL85983.1"
FT                   /db_xref="GO:0005787"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG175022"
FT                   /db_xref="HOGENOM:HBG334065"
FT                   /db_xref="InterPro:IPR007653"
FT                   /db_xref="UniParc:UPI000051F076"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEJ4"
FT                   /transl_table=1
FT                   /translation="MHSSLSRAQGVFGFFTTVALFVAGVAALSVLLYPAHDAKAEVALK
FT                   NVQVIKGRPNYYSTKKEEYAQIRFDLNADLSSLFNWNTKQIFVYVYASYSSSDKKSSLI
FT                   PNSESIIWDTIISAPESPYSFNALLQRFFPTKSSSSPRKNQKRSVSASKKTSASKKETP
FT                   APGVLRLSNQRAKYQISDITGKLAERKNVTLSVGWNVQPWVGALWWSPGSGAVPRTAGT
FT                   VVSSEAFDFPPVKGSKASATKAAASGAQTA"
FT   CDS_pept        join(complement(871729..871777),complement(871521..871596),
FT                   complement(871260..871413))
FT                   /codon_start=1
FT                   /gene_family="HOG000274029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904457"
FT                   /orf_name="AFUA_5G03230"
FT                   /product="Stress response RCI peptide, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85982.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG440391"
FT                   /db_xref="HOGENOM:HBG741476"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniParc:UPI000051E6F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEJ5"
FT                   /transl_table=1
FT                   /translation="MASTASMLCLILVTLFIPPLGVLMISGCSVDFFINILLTILGHLP
FT                   GHIHAFYLEYVYYRNSSTDPMTRKRAPGVYSQRILQGHDGRTYGSTA"
FT   CDS_pept        join(complement(873791..873921),complement(873618..873737),
FT                   complement(873262..873544),complement(872398..873189))
FT                   /codon_start=1
FT                   /gene_family="HOG000160241" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269527"
FT                   /orf_name="AFUA_5G03240"
FT                   /product="Pyruvate dehydrogenase kinase, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /protein_id="EAL85981.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG058631"
FT                   /db_xref="HOGENOM:HBG447871"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="UniParc:UPI0000520810"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEJ6"
FT                   /transl_table=1
FT                   /translation="MQRNQPFRCWHALRLSCKPRVRFYSGVDNSHSPPPWRPGSVLDEW
FT                   VEREIRPISLRQLTFFGRTLTESRLISSANYVRTELPTRIAHRLRDIQKLPYVVVANPH
FT                   LSLVYELYYKAFERFRVIPEIKTLEDNERFCDILRKTLKEHLVVIPKLAMGVLECRDLV
FT                   APGVMDQFMNTLLRSRISRRVIAEQHLALTETFSSPWHFPGSQDRTDMNADFVGEVFLK
FT                   CNAKEVIERCGKLAQDMMRQSSGTDKIPEILVQGHLDATFPYILSHLEYIIGELLRNSI
FT                   QAVIEKYKESSEKPPPIEVLICEAPQHVIMRVSDQGGGIPREVMPYLWSFDKGPLSKSR
FT                   LQNLKQVPAMAATMQELTVSKERKHADRETYREGSLDSLTSRPPNLRLGIGLPMSRVYA
FT                   EYWAGSLELHSLEGYGVDAFLQISKLGNKNEQVTTRASIDAV"
FT   CDS_pept        join(875137..875145,875253..875373,875558..875702,
FT                   875762..875919,875978..876167,876219..876327,
FT                   876381..877329,877383..878518,878574..878888,
FT                   878942..879071,879132..879241)
FT                   /codon_start=1
FT                   /gene_family="HOG000160240" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057688"
FT                   /orf_name="AFUA_5G03250"
FT                   /product="Ubiquitin C-terminal hydrolase (HAUSP), putative "
FT                   /EC_number="3.1.2.15"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="EAL85980.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG028491"
FT                   /db_xref="HOGENOM:HBG385658"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI000051F045"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEJ7"
FT                   /transl_table=1
FT                   /translation="MDNVADNEMLVDEYEQYHNDRTDDVVVSRSGSEEPEPEPLADDFT
FT                   AMMARILPKDPDLETADEAYHTWHIQDWRKLKKKEHGPIFQCGGFPWRVLFFPYGNHVD
FT                   YASFYLEHAWEKEPPENWYACVQFALVLWNVNDPSIYVSHVATHRFNADEGDWGFTRFC
FT                   ELRRLFNMPWEGRGVPLVQNDEAKITAYVRVVKDPTGVLWHSFQNYDSKKETGMVGLKN
FT                   QGATCYLNSLLQSLYFTNAFRKAVYQIPTEAEATRDNSAWTLQRLFYNLQTSESSVSTT
FT                   ELTASFGWESRQIFEQQDVQELSRKLMERLEEKMKATPVEKALPGLFVGKTKTYISCIN
FT                   VDYESSRVEDFWDIQLNVRGNKTLDDSFKDYIQVETLEGENKYDAGSPYGLQDAKKGVI
FT                   FESFPPVLHLHLKRFEYDINRDAMMKINDRHAFPMEFDATPYLSDAADKSEPWIYQLHG
FT                   VLVHSGDLNAGHYYAFLKPTKDGHWFKFDDDRVTRATDKEVLEENYGGEYELSNGAAGV
FT                   RQPHTRGLSTKRSMNAYMLVYIRKTRLDDVLLPITKDDIPSHIEKRLVEERAELLRRKK
FT                   EREEAHLYINVGVLSDESYTSHHGFDLTSADLPAGDPALPKQYRILRAKKVGEFVEQLA
FT                   EERGLNANQIRLWVMVNRQNKTTRPDQAIKDPEMTVEEAYSRFGTKGNPFKVWMEVGQP
FT                   SADGTISWPDSSTSVLVFLKNFDVPSQTLSGVGTVYVRKNQKVAELAPTILEKMNWPAG
FT                   TEFMLFEEIKHNMIDVMKPKQTFQQSEIQDGDIITFQRTVKESDLPSTALYTEARQYYD
FT                   YLLNRINITFAPIKATDGDEFTLTLSRKMTYDQFSKKVGEHLNVESTHLRFAPVLASTG
FT                   KPKQFIKRNPNQANQTLYHILSGQVSGYGYSMHRQDALYYEVLETSLSDYESKTTLKVT
FT                   LLTEGIVKEQLFEVLVPRDGTFADLLAGLQKKANLEDDVVREMRIFEAHSGKIYKEYQE
FT                   DAKIAGINEYVTLYAERIPEEELQMQAGERTINAFNFDREPSRPHGIPFKFVMKPGEIF
FT                   KETKERLSKRTGIKGKQFEKIKFAVVPKSLYSNPRYLDDDDILSDIVGESDDMLGLDHV
FT                   NKSRSFWSRSESFFIR"
FT   CDS_pept        join(879802..879954,880047..880235,880314..880697)
FT                   /codon_start=1
FT                   /gene_family="HOG000160229" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904458"
FT                   /orf_name="AFUA_5G03260"
FT                   /product="Endosomal cargo receptor (Erp3), putative "
FT                   /function="receptor activity"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85979.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG334070"
FT                   /db_xref="HOGENOM:HBG372468"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI000051E495"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEJ8"
FT                   /transl_table=1
FT                   /translation="MQFSTVLIGLLATLVSTVTATALTYRLEANEKACFYNYVDQRNAK
FT                   VAFYFAVQSGGSFDVDYSVVGPGEKVILDGTKERQGDFVFTAQSIGEYRFCFNNEMSTF
FT                   AEKMVDFEIAVENEERAQLPSRQGASPEQASALEESIYKLSAQLSTIARNQKYFRTREN
FT                   RNFSTVRSTERRIFNFSVIEGLMMVSMAGLQVFIVRFFFQGARKGTYSLSYGGVKPSIV
FT                   FDYCLSRSLIQVHVWLTPL"
FT   tRNA            883190..883272
FT                   /gene_name="tRNA-Lys"
FT   tRNA            883581..883709
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        join(887241..887497,887563..887704)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752324"
FT                   /orf_name="AFUA_5G03269"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27252.1"
FT                   /db_xref="HOGENOM:HBG334073"
FT                   /db_xref="UniParc:UPI0000F51C7A"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA15"
FT                   /transl_table=1
FT                   /translation="MQQPKDTDPNFPVDGGGCRPQGETHIETQRSVDPNMSIEDYNRVM
FT                   LQYTQRRMSTFLDMGNDGGPPPSRNGRSSDSVATLSKRVFLYLLASDTRGIVETSHLRH
FT                   NSLSPLKPLSEVDMAFLHGGFIQWFPSC"
FT   CDS_pept        join(888920..889208,889272..889345,889435..889644)
FT                   /codon_start=1
FT                   /gene_family="HOG000216953" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269528"
FT                   /orf_name="AFUA_5G03280"
FT                   /product="Putative uncharacterized protein "
FT                   /function="structural constituent of cell wall "
FT                   /cellular_component="fungal-type cell wall"
FT                   /protein_id="EAL85977.2"
FT                   /db_xref="GO:0005199"
FT                   /db_xref="GO:0009277"
FT                   /db_xref="HOGENOM:HBG055289"
FT                   /db_xref="InterPro:IPR001338"
FT                   /db_xref="UniParc:UPI0000F51CA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEK0"
FT                   /transl_table=1
FT                   /translation="MRPITILCTLATLSTTLAVPFSQASKSTSASRSTSSSTVPASLPS
FT                   PTLSGPNACPPNKFKQCCTTLSQVGDDLLKPLGAVVPLVGAIQVNSLVGVSCRPMADAA
FT                   PESTCGNAVMCCDSSTVGGDDLMQTSCQDFALAKKREREAIERQQRRFSEYQRMMLSQS
FT                   ATPAPTSTGVDVMGSSFSKAKATPTRV"
FT   CDS_pept        join(complement(891602..891751),complement(889972..891522))
FT                   /codon_start=1
FT                   /gene_family="HOG000160195" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057689"
FT                   /orf_name="AFUA_5G03290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85976.1"
FT                   /db_xref="HOGENOM:HBG055280"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="UniParc:UPI000051F044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEK1"
FT                   /transl_table=1
FT                   /translation="MASHQVAIAKASFSAGLLRPDPTSVPRDEITAFHTLLDTALSHCS
FT                   VANIQTWLLNYVVSSSNRVGVWAKYLVALSSSFTSGENGQTSKPTEVRPGTSSKRKRLH
FT                   ILYLLNDLFHHTKYHTDTPATFSTLSGSLQPHIVELLGYAASYDRFKNPKHHRRLDDLL
FT                   NIWEKNGYYGADYVNKLREVVKNSAESGPVKSSIDVEQNNMDTVNRSVEKNVPFVMPST
FT                   HGDSSTPYYDLPAGNLIPHIIPDSTVPLRPDTIKPLQFLAGSADEKLVTALKAFLKDVD
FT                   RMYNSGQTEQKENEVVDIDEMGQTIIRDSSTGEIVGGDTYYGWSRAFCQQMKKRRAKGS
FT                   SRNRTRSGSRSRSASRRRRYSGSSESGDSRWRSSSSRSRSAPRRHEANDRRYDSRSRSP
FT                   RRSRSRERSYSPRAPSPPRYPPPEHQTSQYSNTGPQGFHSSHPPPPPPMHFAPGGNVPP
FT                   VPPAFPPRIAPGAPPSHPANYQGQWPPPPPPPLSSMQYPQGSGMNPSAFPPPFNAQGQF
FT                   PPWNMGSAQQMPTGSNHFPPPHPGGQGRGTSGQWNQYGSGYPPSDRGWK"
FT   CDS_pept        892820..893002
FT                   /codon_start=1
FT                   /gene_family="HOG000160184" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752325"
FT                   /orf_name="AFUA_5G03300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85975.1"
FT                   /db_xref="HOGENOM:HBG055271"
FT                   /db_xref="HOGENOM:HBG334083"
FT                   /db_xref="UniParc:UPI000051EB99"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEK2"
FT                   /transl_table=1
FT                   /translation="MSVSIPIRPAIRHFSVRRPPPDTRTSRFVASSCLVSAVLLPFVPP
FT                   ALESFREKNKTYSNK"
FT   CDS_pept        join(complement(894081..894116),complement(893651..894010))
FT                   /codon_start=1
FT                   /gene_family="HOG000160173" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209032"
FT                   /orf_name="AFUA_5G03310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85974.1"
FT                   /db_xref="HOGENOM:HBG055261"
FT                   /db_xref="HOGENOM:HBG334084"
FT                   /db_xref="UniParc:UPI00005207F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEK3"
FT                   /transl_table=1
FT                   /translation="MSTGSAGELFASPAAGGGAYYFAKKSINADRASRYEAELKKKAQL
FT                   AAMEAEHRRQSTLNEPTTAPSENPSLKRANMARFQSAADDVASPSAEAGHDPAPTRHEP
FT                   ETEAERVLEKGKYEATQPFRPPKGNRL"
FT   CDS_pept        join(894858..895020,895061..897390)
FT                   /codon_start=1
FT                   /gene_family="HOG000160172" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269529"
FT                   /orf_name="AFUA_5G03320"
FT                   /product="TFIIH complex helicase Ssl2, putative "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /protein_id="EAL85973.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG314410"
FT                   /db_xref="HOGENOM:HBG346543"
FT                   /db_xref="InterPro:IPR001161"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051FC96"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEK4"
FT                   /transl_table=1
FT                   /translation="MSGWKADHRLGGRSSRASKRATPVPGIEDVGSSDEYSDYVDEKDD
FT                   NLKGKRSHIYVVEKFSLESFSNKKNPSVSKHDPNFGYKDFSSLALKPDHANRPLWIDPL
FT                   KGTITLESFSPLAPQAQDFLTTIAEPLSRPTHLHEYRLTGNSLYAAVSVGLQPTDIINF
FT                   LDRLSKTPLPDTVKSFIIDFTKSFGKIKVVLKHNRFFVESTDPAMLQMLLQDEVIGQQR
FT                   VNGSEGIIQQAAPKMGGLVIPGTKDAAGVQQTSEEKPANGVPGQERKEDDILLAIRDDD
FT                   DDDEQAQVHSFEIPNEAVESVKARCQAMGCPALEEYDFRNDEINPTLDIDLKPNARIRS
FT                   YQEKSLSKMFGNGRAKSGIIVLPCGAGKTLVGITAACTIKKGTIVLCTSSMSVVQWRNE
FT                   FLRWSNIDPGDIAIFTSDNKERFRRSTGIIVSTYSMVSQTRARSHDAQKMMDWMQSREW
FT                   GLMILDEVHVVPASMFRKVTSAIATQSKLGLTATLLREDDKIKDLNFLIGPKLYEANWM
FT                   ELAEQGHIAKVQCAEVWCPMTTEFYTEYMREKSRKAALLYIMNPRKFQACQFLIDYHEK
FT                   RGDKVIVFSDNVYALERYALKLNKAYIYGGTPQNERMRILENFQHNEQVNTIFLSKIGD
FT                   TSLDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTDEMFY
FT                   SSKRQAFLVDQGYAFKVITHLQGIENLEGLAYATPAERRELLQEVMLQNETSAEVENVT
FT                   DDLFSERSGGPKGRAKGGVKRSAATLSGLAGGEDMAYIEYNKSRNKQLKDKAGHHPLFR
FT                   KLERERLKRKKELQDIMR"
FT   CDS_pept        join(898019..898367,898439..898741,898795..899154,
FT                   899208..899743)
FT                   /codon_start=1
FT                   /gene_family="HOG000160151" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752326"
FT                   /orf_name="AFUA_5G03330"
FT                   /product="HypA-like protein, putative "
FT                   /protein_id="EAL85972.1"
FT                   /db_xref="HOGENOM:HBG055243"
FT                   /db_xref="HOGENOM:HBG334085"
FT                   /db_xref="UniParc:UPI000051F52B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEK5"
FT                   /transl_table=1
FT                   /translation="MLQRKDIISRLRFCSRTVSTAASVSDTRVSFSVAATKRTYSRACL
FT                   TRYFFPPTNISGPSVSRNSSTMATVRKIQLSTANPGIFNVELREDSARAASEVLQEDLE
FT                   KHHMFFNKSGFHNHIVHHILTIYALGATPDEIRAAYDHNKTYQRPVLPTTQSIVESMHD
FT                   KTQFQQHLGKEENFPNYLAFFQQEIEKKGVAVVLNEYLFSGSECAENMFSRLFGGLLHP
FT                   LIHIGFGLEFDQPAIVAEGLAQTAVHEDWIGQLYLLPGEKAAGGIGKPGKKSLLQILNE
FT                   IRTDKRLAESVKWADGNKIRDGVLKRAPEEMIRYAAQVSVSAEQMEDKLAELLNLVDRW
FT                   LLTIHEAYFTGAAQRPPKQVKLDFFLMHCVTSSIFLSKIVTLPYLDTRTKLRLLEWKGR
FT                   ADLVFYVSRGVPDLLLEEVTTYEAPNDWKTIFYESSVHPRDDGHLSKLVRALANGEKVC
FT                   RPFEARAEELGLLITGDMWLKIANMGKPDARIRLTLRTMFQGFADDRLRTSYQFNQR"
FT   CDS_pept        900468..901964
FT                   /codon_start=1
FT                   /gene_family="HOG000160140" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16269530"
FT                   /orf_name="AFUA_5G03340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85971.1"
FT                   /db_xref="HOGENOM:HBG055237"
FT                   /db_xref="HOGENOM:HBG334086"
FT                   /db_xref="UniParc:UPI0000520580"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEK6"
FT                   /transl_table=1
FT                   /translation="MAGEEEDINRTNNPPPFTERVHDHNPFVAFRRYADEQISSMLQAV
FT                   MGLPSSISAPHSNHWAIFAEEHNCREPNYRQRQTGEGKEGEYPASSGTGASGNTDNIGQ
FT                   DDKPPASSRWPRSDDPWHSLHHGRFDRPSDFFSLDSFFDSFFDRFWFDDHFSSRFFHPF
FT                   HQPFFFNMLNDDSATWPLAYLMFSPYSPLHLERQASYRAHRERGVFSSLISSLKPSSER
FT                   DPAEPQWREAFEDLLRLENGKPMLDREPRTTLVKKESGTEWLKGLVQRGSLGDRWKYVS
FT                   GPDGQGWSGITLESIEPADKDPPRTNESPTQQTQAVADWKDTKSAPETELDMYDRFLAD
FT                   IETREREFFKGAYESPLLRSLLEERRRLKEEIELFEKEGPSKDTDSWIDLVSDGDKNTV
FT                   PETAPQSTSGSSTTGETRPMASATEQQPYVVSTRTSTERIRLPDGSIQTKTVKTKRFAD
FT                   GREETNESVEVMNPPPTSQDSVAGQEALENQKKRGWFWRD"
FT   CDS_pept        join(complement(904930..905024),complement(904556..904882),
FT                   complement(904475..904500),complement(904328..904419),
FT                   complement(904097..904273),complement(903644..904056),
FT                   complement(903239..903573),complement(902390..902949))
FT                   /codon_start=1
FT                   /gene_family="HOG000160137" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904712"
FT                   /orf_name="AFUA_5G03350"
FT                   /product="Glutamine dependent NAD+ synthetase, putative "
FT                   /EC_number="6.3.5.1"
FT                   /function="ATP binding"
FT                   /function="NAD+ synthase (glutamine-hydrolyzing) activity "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="NAD biosynthetic process"
FT                   /protein_id="EAL85970.1"
FT                   /db_xref="GO:0003952"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009435"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG020805"
FT                   /db_xref="HOGENOM:HBG334087"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniParc:UPI000051F2D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEK7"
FT                   /transl_table=1
FT                   /translation="MLARIIDHPDCQDIVVDVGMPVRHRNVRYNCRVIFYNRKIILIRP
FT                   KMWLANGILFSLAVIFLPTSVQLFTNHVAARSDGNYRELRHFSPWQRPREIEDYYLEQI
FT                   VGKITGQYKVPFGDAVISTRDTCIGLETCEELFTPNGPHIPYGLAGVEIISNSSGSHHE
FT                   LKKLDTRVNLITQATKLSGGIYLYANQQGCDGDRLYYDGCAMIVINGNIVAQGSQFSLK
FT                   DVEVITATVDIEEVRHPVRTYRASSSRNMQATRQPPFVRLDLDVRLSRLDDDAEPGLVP
FT                   SEPISAKYHAPEEEISLGPACWLWDYLRRSGAAGFFLPLSGGIDSCATAIIVHSMCREV
FT                   VKAVSEGNQQVIKDVRRLCAEPEGSTWLPRTSQEVCNRIFHTSFMGTQNSSKETRERAK
FT                   ALSTEIGSYHIDFNFDTVVTAITNLFTVITNFQPRFKVHGGTGAENAALQNVQARLRMV
FT                   LSYLFASLLPTVRQRPGGGGLLVLASSNVDDLKKFIAWARDSFDLPILHDFLTATPTAE
FT                   LEPITATYVQSDEADMGVTYAELGTFGYLRKVAKLGPWSMYEKLLHVWGNEYSPREIYE
FT                   KTRHFFYHYAINRHKMTVLTPSYHAEQYSPEDNRHDLRQFLCQLLSSTDGLLARVNADL
FT                   CLLDPPFTWAYKKMEESVKYWESKGWTAGKAQKKSVKAD"
FT   CDS_pept        join(906092..906188,906250..906696,906760..907454)
FT                   /codon_start=1
FT                   /gene_family="HOG000247937" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270525"
FT                   /orf_name="AFUA_5G03360"
FT                   /product="NADH pyrophosphatase, putative "
FT                   /EC_number="3.6.1.-"
FT                   /function="hydrolase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="EAL85969.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG124071"
FT                   /db_xref="HOGENOM:HBG736436"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI000051EB7E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEK8"
FT                   /transl_table=1
FT                   /translation="MPNGPQIPAPAHILADSMLSRHFGRETVNYFSSSPLNRLSFLRSE
FT                   HPFLSAALKHPSTRFVLLKDLAPLTKSPSELYYAKYDEVRKLVPENFFDKSEEEMIKQF
FT                   DSRKTSAQLIFLGLDETRKQDGLAWKIYTGAPYFALDVTPKGSEEQQANAKDIISTVVA
FT                   KGLSFYQSRVVMTFSADEAAIYAQARALIDWNTRNTFCGTCGYPTLSVNSGTKRACPPT
FT                   DVALAEQGKGRPECNTRTTLSNLSFPRTDPTIIVAVLSADAKRILLGRSKRFPPNWYST
FT                   LAGFIEPAESVEDAVRREVWEEAGVTLSRVVIHSSQPWPYPANLMIGAIAQVSDPEHEK
FT                   ISLLHDPELEDAKWFEIQEVEEALRVGTSALGETPGPEYKGGLRLPPPTAIAHQLIRAA
FT                   ITGDYIISKESKM"
FT   CDS_pept        join(complement(911662..912048),complement(907838..911605))
FT                   /codon_start=1
FT                   /gene_family="HOG000160116" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209277"
FT                   /orf_name="AFUA_5G03370"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /biological_process="telomere maintenance"
FT                   /cellular_component="nuclear chromosome, telomeric region "
FT                   /protein_id="EAL85968.1"
FT                   /db_xref="GO:0000723"
FT                   /db_xref="GO:0000784"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG055218"
FT                   /db_xref="InterPro:IPR011564"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000051E488"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEK9"
FT                   /transl_table=1
FT                   /translation="MNSHEQPSMSEPLCSTAIPIAQISPDADRILERSIHAIVTLVWPY
FT                   SSSNKSLSLLLAEPDFRLRRNNGQVKVVFRGRAAEAVAKSQVGIGDHVYLGLAGSKFVP
FT                   SVAVAQTPGKCVPWDVQLDDRVLLEIWRSSQHFSTVKLDPSTVSTQDTENVFAPPATPI
FT                   TNGCVERDEATSAARFESWRSPAFVERTRTSFGGLVDSAYDPFAEADGFVPGKGRKRPR
FT                   FSFKGANWRLVDEPASPGETEAPADWTWMFEEAETHESDIGGEDHIDSATVPQEVSAVT
FT                   ATVPNAPEAADTVADVDNESLDVGLMSTERMAEQPTRPSFEFSQPLRAPGFPQHFARQQ
FT                   LADSDFPYPTDTPRLYPIPSPGLPIPSPLVTRSSSAHDYFPTVASNVQTPSAADGENVE
FT                   MTEKENIVVSKVQPDVPTSKELQPLVTTPQPAIARNTLDLTSQNASIDLEADRQGDMKS
FT                   TSTADTMPIEYRAPAQHPEDVEKQISNAPLVSLDQSYAGKPAEFANSDIRNVVEEELEQ
FT                   SDINQENGEIQVEESNGTSEDELEEQSEMELTEESVEEESAEEEDDDLVEEHGYGDVQE
FT                   QRSQRPPDAFGDNDFHQDDTRRHEDSEVEEISIGTNRALEDDDLSDARSEAYSAAERQA
FT                   AEERGHFHNLEEERGEDEHEGDFEDEGTFDDEGIEGGDGRAEVLGEEEDEEEEEEEDDE
FT                   EEEEQDEIEDEEGSVLKDEQEAYEDDYDRLDSESESYTSEDSPARPEKVVHPEVIVLDS
FT                   DSEDEAVVSPPTNTHMSSAKYAATVDDVDSSATSAGENDGYDRGSVGSEAEEGPEDELA
FT                   EDDQTGDDKTEEESTQDEVDVRDNAEDELMEDAPSDEDFVSEEPIEVQADAEENSASAD
FT                   PVQCEVQQEADIENELISETLNVLQATSGAPQSLEGQSMASLGVSVVQSTQGPYTDSVS
FT                   GPQPRDLAIDPELYRLGGTGEDETRRPETDARAESGPDKSGLEDEGIREPFFQCAVSPQ
FT                   PVDSSAELASPVQEPSTQAPQLVTPDASQLATPSRRLPTAIPVAEFPPTPEQTQEVPQG
FT                   LSTQYDGHTDAPERTLLHISTTSVETDVSSTNEYNVQMSSALAEQQRQMQTDGVSVHDE
FT                   EYAISSVADEIASGVHDWEVSALHSERLSSVVNRDHPGLRSKYSYFAPLAMLIDHYNSL
FT                   IDTISVVSDASPISRATTGKKDFTLSLLVTDPSMAGTIVHVEIFRPYKSALPSVKEGDA
FT                   ILLRNFQVKSFNRSMMLVSVDTSAWAVFHNASKEAQIAGPPVEHGDEERAYATDLRQWY
FT                   HEVGVAMVADYQLQASVLTASREATPVSSAAHSDAGSVDSASREVRGESSVSNRGSKRR
FT                   KSHRRITIHELRDGRRYTEVGSPSDKESIHELRDGTLYANL"
FT   CDS_pept        join(912665..912735,912807..914199)
FT                   /codon_start=1
FT                   /gene_family="HOG000160105" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270526"
FT                   /orf_name="AFUA_5G03380"
FT                   /product="Flavin dependent monooxygenase, putative "
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="EAL85967.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059181"
FT                   /db_xref="HOGENOM:HBG626178"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR012143"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000051F043"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEL0"
FT                   /transl_table=1
FT                   /translation="MTISLPVRRIAVIGAGPCGLSAVKYLLAEKCFDKIDVFEQRGSVG
FT                   GVWNYTPAALKASLVTQVPQLNPDGPIEEPIWYRFGETEETRQLTFTSPIYSTLDTNIP
FT                   KELMAYSDKPFPADCQALPRHSTVKKYLEEYAEDVKDLIQFETQVLDVRPEGQTNKAWA
FT                   LTTRNLRTGAKETHIYDAVVVASGHFDVPYLPDIKGIEPWNKKYPGVISHSKYFDSPEQ
FT                   FRDKRVIVVGSSASAIDIGAQIDRVSKGKVLVSQRTESSLMPFIPSDKSYFPEIVEFLP
FT                   SESHRRAVRFADGRVEMDIDAIVFCTGYLYSFPFLSSLDPPVIGDGRRTLNTYQHLFYI
FT                   YNPTLVFPVLPQRVIPFPLSENQAAVYARVWSGRLTLPSIAEMKQWEESTVATKGDSTK
FT                   FHLMHFPLDADYMNFLHDWADMAETRQGLANNGYGKQCNYWGMKQRWMRQKFPEIRRAF
FT                   VEKGEERYNIKSIAELGFDFDEDWKQRQD"
FT   CDS_pept        join(914610..914859,915441..916450,916503..917333,
FT                   917390..918346)
FT                   /codon_start=1
FT                   /gene_family="HOG000160094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270527"
FT                   /orf_name="AFUA_5G03390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85966.1"
FT                   /db_xref="HOGENOM:HBG055205"
FT                   /db_xref="HOGENOM:HBG334089"
FT                   /db_xref="InterPro:IPR021006"
FT                   /db_xref="UniParc:UPI000052032C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEL1"
FT                   /transl_table=1
FT                   /translation="MMWRKRKAASPAISDPADNFRKRRWKVVYVTSSSDDENDENDDST
FT                   SSLDEDEWYINCILDETESQYLIDWEGPWSPTWVSWAKNFLSSTTWHSKQTSGRGSGDA
FT                   TLRGNYSRKPAYTRHLWYKEVGFADTKYRNQSRIQLHQPRLSLLTRYFLASRLLISHLL
FT                   LFDPRLTTLGISGSSSLLEDITVRHVSSVPETVLSHQSQNAGQSPEQSLNPRPIPSKRK
FT                   ALASVAVETVAMDAGKGGRETPSLAETMEKYSQYEGSTPLEKIRNAHAQIRAKTNPGTP
FT                   LNADASVTPSSAGDIEPSPSLFIPEVTAPLSVRVDREDAPHTAHAEGELSAPDSLVQPT
FT                   EMGPPQQPILQTIHPSALTVSHQEQAIPGSVQLGPSEFAVPLPMDSRVKDDYERILKDE
FT                   AQSIDEFLKTFALQAETSRIEQERLIPRMNSLLERLSNTSTHPDLNITEHIKDSDSDLA
FT                   KEAAWAEYSSAKFLLLGYLINNASSHDLHLVIMVHGAKTLKILERFLMGKGLSYTRPRH
FT                   EMGIGTNLEVSMVKESLSFGIQSTIDDGIMETYKPPAAIVALDSSFNATSPSVEHMRTT
FT                   YARHGNLLPVIRLLVSNSSEHVQLCFANYPEPHRLRLVVQYTSRLRDVVGDLQDDALGV
FT                   YEDSEEILSSLLSDNLNAHWSLPSIEPLHIVSSDELTAALSPYQNQPETALLPIPQVSK
FT                   RLFVEDTTEQTSKRPRMEESQDASQFTEASKESIKFPSQTLDNDLRALEAHLLKLKTSH
FT                   AAELDKLQKALADAQSRLQEREGILSLLQHRYESRTKELHKVRQERDRLVEAKLSSEQR
FT                   LEKQKEDNIKLKDERTQLRHELEKAREALKAGGGSMAELERAQEEIRRLTKANASLERK
FT                   AEYEAKQAEYTREQYQTASNVAAQSGNEILQLKEENESLKRKVAGDASRLRELNIQSDE
FT                   QRHLARVKELEAMLASREDLLRRKEDELREFRKNRPSTRSTSTQPRSPKWTAANSRPTS
FT                   PGINNHNGSGYSGRGSGLRFSSEVPL"
FT   CDS_pept        919690..923394
FT                   /codon_start=1
FT                   /gene_family="HOG000160083" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904713"
FT                   /orf_name="AFUA_5G03400"
FT                   /product="SH3 domain protein (Cyk3), putative "
FT                   /protein_id="EAL85965.1"
FT                   /db_xref="HOGENOM:HBG055197"
FT                   /db_xref="HOGENOM:HBG334093"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="UniParc:UPI000051EDEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEL2"
FT                   /transl_table=1
FT                   /translation="MSPVAPQLPTRFPCWCRAIYSWGGETKRDLGFVEGDLIECLNAGD
FT                   GQWWMGRLRRDRRMVGLFPSNFVEVLGEDFVPVTRATSPMMPAGRSPITNPTSAPKKQK
FT                   TVFRKPFQAHKEALAPAELARNATTTTQASSSIPQTPPRNGSSVRSVKPLRTPTTAVKN
FT                   QSSLSRPPSQHRPSSGGGSPHAPPVADPPPQSPTPARESISRSRPPSRAPSPRLPYDMD
FT                   LLPPSVPVRHTPLARPPSVHPPSHEISPLQLQEREESPPPPPPPPHRIAVNRRPSMDMD
FT                   VPMHLDMNDRYATMSRTPSPAAHSDANGNTPSPLRDAMEDVMTSLEDMGLSRGAHSPSP
FT                   APVFDNPWSPEAFDSLRDSRPARHGHRPLTSLGFEGEQDHQFRDSQIHRNTMYGHDHYL
FT                   DGPPQLNNYVQRMESRLRQMQEQSRRGSEDILPPEDAEEPPPPPPKHLAHHGRHTSVPA
FT                   QYPYLRSQRSGQDLRGDALNRSHTKSSTTTSSSGVQSISTAMTASTEQTSQSLMSGPSA
FT                   GAFSATSAGSYARRGLTTSNERPNTAMETFRSRGFSDVSRMPRPETPLTGISYHSSHNT
FT                   SRQGASSAIPWSQPAADASESTAVFGGLSTPKAKKQGFFKKIFESAKTGAANARSSIAV
FT                   GNSGGSYSPTKGRAISPIRRDTTRDAGTGTVDWVQVRRDVNRASSPSRNERIERAERCQ
FT                   MMDHPVIYAVEELHETAEGDESIDGLPISEPTNFNTVNLNLVDKSARFVNSLPPMTNPM
FT                   SLAQGYVCRPYKSDVQRLRAIFTWVSEKIAWDEPVEEIGIDLKRILQTRRGSPQEVAFL
FT                   VKEMCAAVGLHAEVVQGFLKTPGELFELDSLSRPNHWWNTVLVDGEWRVIDCALANPTN
FT                   PRRNQFVTSGSSTAESWYFLARPLEICYTHVPLYPEEQHICPPISPDVLLALPTACPPY
FT                   FKLNLQFPDYDTSLIRIEGLELLQIRLLVPPDVECAAEVEAPAFARDADGDFFESGEVI
FT                   RKRALVQPDWVGGQKRFTVKAVLPGDEGQGTLKIYAGKKGLMHSSKDIPHPLALALPII
FT                   HTGENPPYEFVLRHPTPHAQRHDLYIIQPQCAKLAINNTFVFAVRQHPSSLPSPTNSSD
FT                   SGPTGRVSPSIFARPASALSMVSSSAGGSSVSAVSNEFSASTSAISSTRSSSGREKPAK
FT                   LAIQSPSGKILRLTRKADHMISSDSSDPTADGSVWETVIKIGERGTWRGLVLADRVARW
FT                   CVFCEWECF"
FT   CDS_pept        complement(923979..925451)
FT                   /codon_start=1
FT                   /gene_family="HOG000160072" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270528"
FT                   /orf_name="AFUA_5G03410"
FT                   /product="Exopolyphosphatase, putative "
FT                   /function="manganese ion binding"
FT                   /function="pyrophosphatase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85964.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016462"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="HOGENOM:HBG055187"
FT                   /db_xref="HOGENOM:HBG334094"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="UniParc:UPI00005205A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEL3"
FT                   /transl_table=1
FT                   /translation="MAIGSMMARSPPSLQNLLRFLKQARQTHLSFITGALLSSSRAETP
FT                   IYVVGNPSADLDSAISVIVYSYFAHNCIPIECPRPHIPLINLPNVPSGPELRRLRPEFV
FT                   KAFCLAIKTPSVEGEDAWDETPESAARILHEHILTVADFAAHLRQHHAEPTDHRITADA
FT                   TLLDWNALPHRSADGQRGKGSIDGLLSVDFCTVGCIDHHVDEGFLPPAESLPRGQPLLV
FT                   RPAGSCTSLVVSTLRELDLWQANTEGNATSTETMQLAKLALAPVLIDTTNLTAKDKVTD
FT                   ADADAVRFLLLQIDQCKSTPGSNWDRDAFYERILHAKQNSLDLLTVDEILGRDYKQWTE
FT                   TAQLGSTSIQIGFCSIVKSIPWIVRKAGSAEAFLDALQAFAKRRDLGIVVVMTAFTSSA
FT                   QDGKFCRELVACALHNGATVHALEAFTAQAGPQLGLQEWNAVEGDSEDYSQAIRRAFNS
FT                   DAPVWRRIWLQNDVTKSRKQVAPLVRGAVTGQ"
FT   CDS_pept        925784..926983
FT                   /codon_start=1
FT                   /gene_family="HOG000022460" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904714"
FT                   /orf_name="AFUA_5G03420"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase,
FT                   putative"
FT                   /EC_number="3.5.99.7"
FT                   /function="1-aminocyclopropane-1-carboxylate deaminase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="EAL85963.1"
FT                   /db_xref="GO:0008660"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG402495"
FT                   /db_xref="HOGENOM:HBG689308"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI000051F068"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEL4"
FT                   /transl_table=1
FT                   /translation="MAVPLPAAFAQIPRYPLLYPHPSPIHPLTLLSTYLNNSRNNNTAK
FT                   TPYISLYAKREDHSSPLACAGNKYRKLEYIIPDIRASHSAPNEPPPTLVTEGAIQSNHT
FT                   VQVAAVAKRLGLEAVVILHKGTGGGLAASTDKVSFLRTGNPQVVRLLGAEVRMLESSTV
FT                   PADGDKDPIPGILEELRAQGKAPYWIPSGASLHPLGGLGYARCAFEIAIQEQAQGLDGS
FT                   GRFDYIFVACGSGSTVGGLIAGLKLLEKKEGRTWLSKPPRQVIGILTSPTKPQEYHEER
FT                   VLTFARRAAALIGLDAEKDISMDDVRLDDRFAGTAYGVLDAQTSTALDLMAKKEAVMLD
FT                   PVYTSKVVRGLLHWVQQEELAKDWSLRLGDRERPDCMNVLFIHTGGQAALGAYADMVEL
FT                   "
FT   CDS_pept        join(complement(932742..933107),complement(931540..932619),
FT                   complement(928806..931486),complement(927630..928749))
FT                   /codon_start=1
FT                   /gene_family="HOG000160061" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270529"
FT                   /orf_name="AFUA_5G03430"
FT                   /product="PHD transcription factor (Rum1), putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85962.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055176"
FT                   /db_xref="HOGENOM:HBG334096"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR004198"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR013637"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000051EDCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEL5"
FT                   /transl_table=1
FT                   /translation="MVAPASTGGISTGVQPPANRQPTRSSSTHPSHSHNVPLSARRSAP
FT                   LDLSTVERRGQPNAPREPSKRIRPHGLQEAPTFRPTEEEFKDPLEYIRKIAPEGKKYGI
FT                   CRIIPPENWQPPFAIDTERFHFKTRRQELNSVEGGMPPRSATFAAGATPQPSSDPDSGT
FT                   RANLNYLDQLAKFHKQHGTNLNRFPSVDKRPLDLYKLKKAVEIRGGFDQVCKMKKWAEI
FT                   GRDLGYSGKIMSSLSTSLKNSYQRWLQPYEEYLRVVKPGVQQQLELEHGGPYTPSPNQS
FT                   PMAKKPVLYDHTTPSTTPQAPPGIPATGGPHGTPKEIEATPDKPTPPAESAAPRPVTSG
FT                   FTPVNAGGGGFTAVNRSPSFVAVNSGPVVKKETETGSLTPQSVAEHPQSSTPVTNGNGG
FT                   HPMKRAISHESGSPTEGGETDASGRRSKRLRKGKHVFSQHSSWLDMSDVLLDAPPPTVA
FT                   GSHMSLLRPAPPRARKSDSRKIGDKCEVCGKSEDRPSILVCDSCDQGYHRNCLDPPLTN
FT                   IPEYDWHCPKCLVGTGEFGFEEGGVYSLKQFQEKANTFKKNYFASKMPFDPVLNTHRRE
FT                   SEDDVEREFWRLVESLTETVEVEYGADIHSTTHGSGFPTIERNPLDPYSTDPWNLNVLP
FT                   FHGDSLFRHIKSDISGMTVPWVYVGMCFSTFCWHNEDHYAYSANYQHFGATKTWYGIPG
FT                   SDAEAFEEAMRQAVPELFESQPDLLFQLVTLMPPDQLKKAGVNVYALDQRAGQFVITFP
FT                   KAYHAGFNHGFNFNEAVNFAPADWEPWGAMGVERLQAFRRHPCFSHDELLLTAAARDTS
FT                   ITTAKWLAPALQRTCHREVAERAAFIHRHREIAPHNCALGSLDSSASGECQLKFVIEEE
FT                   DLPEDDYQCQYCKAYTYLTQFRCHKSGKTVCLLHTETFDCCGDSSSQRLLGPDHTLRYR
FT                   MSDDTLKAVVQKVQERARIPEAWGEKLDKVLENEPKPQLKVLHSLLSEGEKIPYHLHGL
FT                   QDLAAFVQRCDKWVEEANNYITRKQQNRRKNEKAWRKSTSKAAQLEERDREVRRIENMY
FT                   ALLAEADKLSFDCPQMAALEEKTREIEKFRQDVNVALMNPHIRSIQEVEELVESARNFN
FT                   VEIPEVEGLEHILRQMRWNDEARRKRDQYMTLKECQELVQAGEQLGLSETNEHLSHFKE
FT                   LCRHGETWEAKAKELMSVESVHYQQLEALSAQALRFPVSPETLSAVDAILTKQREAQKK
FT                   IQNLYERSKDPDFRKRPKYKEVRELMDSLEALNSRPTGAIDLEREQKRHEDWMRKGKKL
FT                   FGKANAPLHILKSHMEYVEKRNSYCFDLEDRCRPPVEPSSRNNTPDGLLENHTATTSSS
FT                   MWGGGKSRKRDVFCICRHSEAGMMIECEVCHEWYHGKCLKIARGKVKEFDKYTCPICDW
FT                   RQKIPRDAARPKLEDLQDWQAEIPSLPFQPDEEQVLENIINQATTFRDFIQSFTNAACT
FT                   TTEEVPTLIFYLRKIEGAEVLLAYETNFFRQEIHKWAPVAPEPPPILEQSLSTRKPRPT
FT                   KQQKIMAQLGVERPEDLPPHLRTKQPNHAKRKSLESQTPRPATLQRTSHTPCEDSNRTG
FT                   PALTPMTEAQNPPYPFSANYSLPASDSTPAFAPGASAFLPHVSAHSPSFPPRSPSPHHG
FT                   LDSALFSSPRFNRDPTEGPPVVDVDNQDPFNSSPRQNLDDVFADLTNQDAEPEPEPEPM
FT                   ENTHANEALEALDASNGGDHSDAMQDDNSPDTGVNGDMNGQADAENTTESS"
FT   CDS_pept        join(935343..935590,935640..936663)
FT                   /codon_start=1
FT                   /gene_family="HOG000160050" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752554"
FT                   /gene_name="slx1"
FT                   /orf_name="AFUA_5G03450"
FT                   /product="Structure-specific endonuclease subunit slx1 "
FT                   /EC_number="3.6.1.-"
FT                   /function="endonuclease activity"
FT                   /function="metal ion binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85961.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG055172"
FT                   /db_xref="HOGENOM:HBG334099"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniParc:UPI000051F2DC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WEL6"
FT                   /transl_table=1
FT                   /translation="MDDTQIEHPRPIPIFYCCYLLRSTVRHASLYIGSTPNPARRLIQH
FT                   NGVVKGGARRTAAEKLRPWEMVLVVEGFMSRLAALQFEWAWQNPWYSRHLRSEESSALA
FT                   EVKHRRMRKAKSEDPEFLDSNCDSAKSRVKGTPKKSKRRHRPPRSLDTYFSDLHRLLRS
FT                   TYFSHWPLKIRFFSGDIYQSWKAWYDRVDVRLRSPVKVILDGSCPEISAHTGGNDTRFG
FT                   GVENAKITYAAIRDYIEKAIFLLDDPKDVRCHVCQGQIVPTEELTTVCPQAECHCTCHL
FT                   LCLSRKFVDAALEPNQIVPKHGICPACEATIEWPLMMKELSFRSRAKQELLEILKRKRR
FT                   VDRKQGAVTGEVESSSRRTVSVDLDDRFGQHAEDEFLLDEDWWEGLAAESDSDTDLRLK
FT                   PLSKAAPKLETVIEDSECDDADIL"
FT   CDS_pept        join(complement(937295..937430),complement(936710..937239))
FT                   /codon_start=1
FT                   /gene_family="HOG000229079" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18209278"
FT                   /orf_name="AFUA_5G03460"
FT                   /product="Thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /function="ATP binding"
FT                   /function="thymidylate kinase activity"
FT                   /biological_process="dTDP biosynthetic process "
FT                   /biological_process="dTTP biosynthetic process "
FT                   /protein_id="EAL85960.1"
FT                   /db_xref="GO:0004798"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006233"
FT                   /db_xref="GO:0006235"
FT                   /db_xref="HOGENOM:HBG460048"
FT                   /db_xref="HOGENOM:HBG626009"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="UniParc:UPI000051F7C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEL7"
FT                   /transl_table=1
FT                   /translation="MNSQRNRGALIVFEGLDRAGKSSQCERLRDSLQASGHSVKYIRFP
FT                   DRTTPIGKLISSYLQGQSQADDHSIHLLFSANRWEIAKSIEDDIANGISVIVDRYSYSG
FT                   AVYSAAKGNPNLSLEWAWQPEIGLPQPDMCLFLRISPEEAAKRGGFGVERYENETMQNR
FT                   VRELFQTLFDLQQGDYIHTIDAGRSFDAVSQDIMKIVTDYIGRLDAMGPLKRLGALSN"
FT   CDS_pept        join(937711..937951,938035..939067,939145..939325)
FT                   /codon_start=1
FT                   /gene_family="HOG000160039" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904715"
FT                   /orf_name="AFUA_5G03470"
FT                   /product="TRNA-guanine transglycosylase family protein "
FT                   /EC_number="2.4.2.29"
FT                   /function="queuine tRNA-ribosyltransferase activity "
FT                   /biological_process="queuosine biosynthetic process "
FT                   /protein_id="EAL85959.1"
FT                   /db_xref="GO:0008479"
FT                   /db_xref="GO:0008616"
FT                   /db_xref="HOGENOM:HBG056006"
FT                   /db_xref="HOGENOM:HBG334101"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="UniParc:UPI000051FA19"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEL8"
FT                   /transl_table=1
FT                   /translation="MSLLEASSQSPDEMVNFTLLSPATAPILAPRLGNLAIAGRKAIPT
FT                   PNYIPLTSRGAVPHIAHDVMRDQTAIGSLFIGLEDFIERKAHTGPLRNGRPPIYNVPTA
FT                   PHESALRKFISVPEDFLLILGPRRVPSIACPPNNTPNSISILTSVGFRQLEAGEYVEAV
FT                   RKLRPDIVVGLADLAQGQTPGTKRRVKMADRTHAFTSHALEQLYGQTVPEGSRSKSAYF
FT                   APVLPLENTQQSLYLADLEHELRPHISGLALHESASLSILPEKLGNLPRLLFSDPATPH
FT                   DILRQVSLGADIFTIPFLGATSDAGIALDFTFPAPSTVETIVSEPRPLAFDLWSTSFKV
FT                   DTAPLNTSCECYTCKNHHRAYIHHLLSAKEMLAWTLLQIHNHHIMDKFFSAIRTSIERE
FT                   TFLTDADMFHRFYAPELPEKTGEGPRLRGHQLPAAGPHQPRRFPRVYGRLDDAAEKFAE
FT                   SESSIATPDTGADGLEAHGFAQKTSS"
FT   CDS_pept        join(complement(941824..941910),complement(939768..941750))
FT                   /codon_start=1
FT                   /gene_family="HOG000246234" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270530"
FT                   /orf_name="AFUA_5G03480"
FT                   /product="Methylenetetrahydrofolate reductase "
FT                   /function="methylenetetrahydrofolate reductase (NADPH)
FT                   activity"
FT                   /biological_process="methionine metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85958.1"
FT                   /db_xref="GO:0004489"
FT                   /db_xref="GO:0006555"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068938"
FT                   /db_xref="HOGENOM:HBG649727"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="UniParc:UPI000051EB7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEL9"
FT                   /transl_table=1
FT                   /translation="MEKITDKIAALPPNENYFSLEFFPPKTQMGFSNLQARLERMSQAL
FT                   RPLFVTVTWGAGGSTAARSLELAEICQRQLQLTTCLHLTCTNMSRALIDEALEEAKVLG
FT                   IRNILALRGDPPRSEEYNTHGEDDSNKDFTFAVDLVRYIRKMYGDYFCLGVAAYPEGHP
FT                   VDSYQDVQDPVRDLPYLVEKTLAGADFIMTQLTYDIDAYTKFEQMLRNHESGAFKTIPI
FT                   IPGLMPIHSYKILTRTTKLSHVKIPPQIMSKLEAVKHDDDAVKRIGVDVLSDLVEAIKK
FT                   IPCPGFRGFHFYTLNLEKTVSFIIERCGLIPDYPEDSGAVVDDDYTTAPTGAQHRSLSR
FT                   RRASSVNSLPHNRVIVDRLQVPSDGSSRASTHEAPAASAGMPAMPPDRNTTLQISEGQG
FT                   ALGREATWDDFPNGRWGDARSPAFGEIDGYGPSLHVSGAVARRIWGYPVSREDISALFR
FT                   HHVSGDLYIVPWSEGGAEENSSGLNAETEVIRPELLKLIDGKGWWTLASQPAVNGVRSD
FT                   DPTFGWGPPGEGFVFQKPFVEFFCPSKDFRTVLKPLFAKHGHEKLAWFATNVKGEFESS
FT                   LPADPAHADTIEMNPNNVNAVTWGVFRGKEIVTPTIIEEVSFRAWGEEAFRIWDEWRRV
FT                   YPRGTPTERLLEEVKNDVWLVCVVGQDFGAGTENGSEEEQQETKWMWNVLINSQ"
FT   CDS_pept        join(942046..942061,942175..942382,942516..942599,
FT                   942631..943129)
FT                   /codon_start=1
FT                   /gene_family="HOG000253039" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057957"
FT                   /orf_name="AFUA_5G03485"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27251.1"
FT                   /db_xref="InterPro:IPR018811"
FT                   /db_xref="UniParc:UPI0000F51C86"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA14"
FT                   /transl_table=1
FT                   /translation="MPTIDASFNVSFPKHNNTLVLSTRYIVDGCAECKQDKPGQAPSMS
FT                   PNKSVGDDKESSNQGPALTSRWSQKWHCSSDFNFASFSSIAALQFVLSASPGDTALSRL
FT                   NDRLPPFLRSYTTPLLGAPGTHITSFLILHEITAIVPLLGLVASFHYGDWLPDFTSKSG
FT                   FDEGVQRFGRWLRKKGWVEDADVDIVNSDGSASGNDSTTGSPGQSQLRPEDRKGVRLVL
FT                   EFATAYAITKALLPVRIVVSAWATPWFARSVLAPVGRGVGALLGKK"
FT   CDS_pept        join(complement(944264..944280),complement(944113..944143),
FT                   complement(943961..944004),complement(943806..943909),
FT                   complement(943670..943735),complement(943540..943604),
FT                   complement(943353..943487))
FT                   /codon_start=1
FT                   /gene_family="HOG000224564" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270531"
FT                   /gene_name="ndk1"
FT                   /orf_name="AFUA_5G03490"
FT                   /product="Nucleoside diphosphate kinase "
FT                   /EC_number="2.7.4.6"
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /function="nucleoside diphosphate kinase activity "
FT                   /biological_process="CTP biosynthetic process"
FT                   /biological_process="GTP biosynthetic process"
FT                   /biological_process="UTP biosynthetic process"
FT                   /protein_id="EAL85957.1"
FT                   /db_xref="EMBL:AAP85295.1"
FT                   /db_xref="GO:0004550"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006183"
FT                   /db_xref="GO:0006228"
FT                   /db_xref="GO:0006241"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG174293"
FT                   /db_xref="HOGENOM:HBG445152"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="UniParc:UPI00001B2908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7Z8P9"
FT                   /transl_table=1
FT                   /translation="MSNEQTFIAIKPDGVQRGLIGPIISRFENRGFKLVAMKLVSPPQS
FT                   QLEQHYADLSDKPFFKGLVSYMLSGPICAMVWEGRDVVKTGRTILGATNPLASAPGTIR
FT                   GDFAIDVGRNVCHGSDSVENAKKEIALWFKPEELISWKSATFDWVYEKA"
FT   CDS_pept        join(944721..944805,944864..945617,945672..947736)
FT                   /codon_start=1
FT                   /gene_family="HOG000115864" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752555"
FT                   /orf_name="AFUA_5G03500"
FT                   /product="Alpha glucosidase II, alpha subunit, putative "
FT                   /function="carbohydrate binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85956.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG020925"
FT                   /db_xref="HOGENOM:HBG315035"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000520344"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEM1"
FT                   /transl_table=1
FT                   /translation="MARSSSSLSRWTLLLALVVILGCLVVPGVTVKHENFKKCSQSGFC
FT                   KRNRAFADDVSAQGASWISPYELDPSSIHFKDGQLQGTILKSISANEKVKLPLVISFLE
FT                   SGAARIVVDEEKRMKGEIDLRHNSQVRKERYNEAEQWALVGGLESSKTAAVDTESETGF
FT                   TKVLYGPDNKFQAIIRHAPFSVDFQRDGQSHVRVNHKGFLNVEHWRPKVDVAEGDSVQE
FT                   KSIPQQDESTWWEETFGGNTDSKPKGPESIGLDITFPGYSHVFGIPEHADSMSLKETRG
FT                   GDGNHAEPYRMYNTDVFEYELNSPMTLYGAIPFMQAHKKDSTVGVFWLNAAETWVDIVK
FT                   SKSSPDPLSLGVGSKTDTQTHWFSESGRIDLFVFLGPTPQEISKTYGELTGYTQLPQQF
FT                   AIAYHQCRWNYVTDEDVKEVDRKFDKYQIPYDVIWLDIEYTDDRKYFTWDPLSFPDPKG
FT                   MEEQLDDSERKLVVIIDPHIKNKEGYSISEELKGKDLAIKNKGGETYDGWCWPGSSHWV
FT                   DCFNPEAIKWWTGLFKYDKFKGTQPNVFIWNDMNEPSVFNGPETTMPKDNIHYGNWEHR
FT                   DVHNVNGLTFINATYNALLERKKGVVRRPFVLTRSFYAGAQRVSAMWTGDNQATWEHLA
FT                   ASLPMVLNNGIAGFPFAGADVGGFFQNPSKELLTRWYQAGIWYPFFRAHAHIDTRRREP
FT                   YLIAEPFRSIISQAIRLRYQLLPAWYTAFHEASVNGMPIVRPQYYVHPADEQGFAIDDQ
FT                   LYLGSTGLLAKPVVVEGATTTDIYIADDEKYYDYYDFTVYQGAGRRHTVPSPIEKVPLL
FT                   MQGGHIIPRKDRARRSSGLMRWDPYTLVIVLDKNGKAEGTLYVDDGESFNYQQGAYIHR
FT                   RFKFEKSTLLSEDIGTKGSKTAEYLKSMTNVRVQKVVVVDAPKEWQGRTSVTVIEDGAK
FT                   MASTAPLEYHAQQAGKAAYAVVKKPDVGIGKTWKIEF"
FT   CDS_pept        join(948708..948952,949026..949355,949498..949507)
FT                   /codon_start=1
FT                   /gene_family="HOG000160028" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270532"
FT                   /orf_name="AFUA_5G03510"
FT                   /product="PQ loop repeat protein"
FT                   /protein_id="EAL85955.1"
FT                   /db_xref="HOGENOM:HBG055979"
FT                   /db_xref="HOGENOM:HBG334102"
FT                   /db_xref="UniParc:UPI000051F075"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEM2"
FT                   /transl_table=1
FT                   /translation="MHDDVNIPVIRVFYWFGHYYSLSLLVQAVIMIGVQIVLLKVALDN
FT                   RPSPGVKNSVEHVPFSNLDEKGFARPYEFWQWKSAKPYWMFLAYFVGALSFVQILLPPI
FT                   ARSDFYVSLLGYAGLAVEAILPLPQIVANHRTRSCKGFRVSVLAAWILGDVMKMSYFFC
FT                   SKEVIPWAFRLCGMFQCACDLYLGVQFWIYT"
FT   CDS_pept        join(949870..949900,950087..950412,950470..951084)
FT                   /codon_start=1
FT                   /gene_family="HOG000029258" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270533"
FT                   /orf_name="AFUA_5G03520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85954.1"
FT                   /db_xref="HOGENOM:HBG058495"
FT                   /db_xref="HOGENOM:HBG398170"
FT                   /db_xref="UniParc:UPI000051E927"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEM3"
FT                   /transl_table=1
FT                   /translation="MASIRIGYVPEHYLAPLHLALRSPAASSLPFKTTLVPFPSGTGHM
FT                   ITSLREKEIDVAIGLTEGWIAGLAGKQQAQKDAASGGYKVVGHWVDTPLRWAIVTGRER
FT                   EELHTVADLKDKRVGMTDVSHSGSHIMSFVLAQKQGWKPDSLTPAVLGPFQALRNGVTG
FT                   YNASHPDQATPAAEFFMWEHFTTKPYFHADADKPHPPLKKIGEIFTPWPSWLIVASTSV
FT                   FPDPEHDEKLKQLFQVLDQGIKDFQADHDNVVRLLGTGELGCTYVEEDAKEWLKDVRFT
FT                   SSTRGVDRKVVDGVVDVLKVAGVIDPGMSNDEAAERVIGIPR"
FT   CDS_pept        join(952062..952170,952239..952372,952425..952552,
FT                   952612..953350)
FT                   /codon_start=1
FT                   /gene_family="HOG000160027" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057958"
FT                   /orf_name="AFUA_5G03530"
FT                   /product="Class III chitinase, putative "
FT                   /EC_number="3.2.1.14"
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85953.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG324485"
FT                   /db_xref="HOGENOM:HBG588556"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051E926"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEM4"
FT                   /transl_table=1
FT                   /translation="MSLLAQLLALTAAAASLERVYAKLDLSSSSNVAVYWGQNSFRGTG
FT                   DLAQQRLSYYCDGESFMFGYFQVNVLMETSLDPKIDVFELAFLIRINGQGGVPEVNFSN
FT                   ANDNCTLFKDTNLLKCPQIGEDITTCQKKGKTILLSIGGATYSEGGFSSEPAAKAGAEL
FT                   VWQTFGPPSINATAHRPFGNASVDGFDFDFEASVSNVAPFANRLRELMDADHRRDYFLT
FT                   AAPQCPYPDAADKDILNGPVSVDAVFVQFYNNWCGLNSFEAGESKQNSFNFEVWDNWAK
FT                   TVSLNKKAKVFLGVPANTGAAGSGYVPVDTLKPIIEYSKKFSSFGGVMMWDVTQAYGNT
FT                   GFLDGVAQALGKTASHVRRSCRYRPYGWF"
FT   CDS_pept        join(954371..954596,954657..955454,955521..955657)
FT                   /codon_start=1
FT                   /gene_family="HOG000160006" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270534"
FT                   /orf_name="AFUA_5G03540"
FT                   /product="Thioredoxin reductase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85952.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG055963"
FT                   /db_xref="HOGENOM:HBG334105"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000051E710"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEM5"
FT                   /transl_table=1
FT                   /translation="MAPKSLLYTIFSSLAVALAASVPHTDYEVMIIGGGPSGLSAASGL
FT                   SRVRRKNIVFDSGEYRNGPTRNMHDVIGNDGAVPSDFRALARNQISKYNQTTWVNEKVD
FT                   SVRVITDEERNTTYFRASVAGETYTARKLILGTGMKDILPETPGLDEAWGKGVYWCPWC
FT                   DGWEHRDQPFGILGSLVDVVGSVLEVYTLNTDIIAFVNGTQTPKAEAKLAEKYPNWKKQ
FT                   LEAYNIVLNNETVKSIERVQNGEDVYDDQGRQFDIFRVNLADGSSVTRNAFITNFPSEQ
FT                   RSSIPKELGLKMKDNKIDTNIDGMRTSLPGVFAVGDANSDGSTNVPHAMFSGKRAAVFV
FT                   HVEMAREESRAAVSKRTLPSKRAMEKEAERRMGSDLEKLWERVRRA"
FT   CDS_pept        join(complement(958740..959199),complement(958451..958674),
FT                   complement(957724..958386),complement(955956..957662))
FT                   /codon_start=1
FT                   /gene_family="HOG000160005" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18209279"
FT                   /orf_name="AFUA_5G03550"
FT                   /product="Plasma membrane H(+)ATPase, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /biological_process="cation transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85951.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0006812"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="HOGENOM:HBG706356"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051FA28"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEM6"
FT                   /transl_table=1
FT                   /translation="MAEQAHSQGQGQSQGQGQGQGDVERGPSRISQQSSRRISRVSYKE
FT                   DWANLDEYGKLVKYVSTYREPGREEGVEEEKVKRVWYAPWKKRKVKVKHVDKEPGQFPP
FT                   EWLITDIRQGLPSSEVPIRRRVSGWNELTSEKENPIAKILSYFRGPILYVMELAVLLAA
FT                   GLDDWIDFGVIIGILCLNASVGWYQEKQAADVVASLKGDIAMRATVVRDGQQQEILARE
FT                   LVPGDVIIVGEGQVVPADAKIICDYNDPNGWEEFQRMQEQGDLSSTSESDVEDNEKEGK
FT                   EGKGEQESSRKRSHPILACDHSAITGESLAVDRYMGQLIYYTTGCKRGKAYAVVQSGAK
FT                   TSFVGKTASMVLAAKGAGHFEIVMDQIGTSLLVIVMAWILAAWIGGFFRHIPIASPPQQ
FT                   TLLHYTLSLLIIGVPVGLPVVTTTTMAVGAAYLAKKKAIVQKLTAIESLAGVDILCSDK
FT                   TGTLTANKLSIREPYVAEGVDVDWMFAVAALASSHNIESLDPIDKVTILTLRQYPRARE
FT                   ILRRGWKTEKYIPFDPVSKRIVTVATCDGIRYTCTKGAPKAVLSLTNCPKEVADVYKNK
FT                   AQEFAHRGFRSLGVAVQKEGEDWTLLGMLPMFDPPREDTAHTINEAQNLGISVKMLTGD
FT                   ALAIAKETCKMLALGTKVYNSDKLIHGGLSGVMASDLVEKADGFAEVFPEHKYQVVQML
FT                   QERGHLTAMTGDGVNDAPSLKKADCGIAVEGATEAAQSASDIVFLEPGLSTIIDSIKVA
FT                   RQIFHRMKSYIQYRIALCLHLEIYLVTSMIILNESIRVELIVFLALFADLATVAVAYDN
FT                   ASFELRPVEWQLPKIWFISVLLGLLLAMGTWVVRGTMFLPSGGIIQNWGSIQEVLFLEV
FT                   ALTENWLIFVTRGVETWPSIHLVTAILGVDVLATIFCLFGWFTNETMPTKPADSFVETR
FT                   NGWTDIVTVVRVWGFSLGVEIVIALVYYMLNKFKWLENLGRAKRDKGDIKIQNLLGHLA
FT                   RLTVEYDQPGQPKGRFFLTSSKEEEEAE"
FT   CDS_pept        join(complement(963061..963324),complement(961870..962993),
FT                   complement(961797..961818),complement(960949..961686))
FT                   /codon_start=1
FT                   /gene_family="HOG000259234" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057959"
FT                   /orf_name="AFUA_5G03560"
FT                   /product="Glutamyl-tRNA synthetase "
FT                   /EC_number="6.1.1.17"
FT                   /function="ATP binding"
FT                   /function="glutamate-tRNA ligase activity"
FT                   /biological_process="glutamyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85950.1"
FT                   /db_xref="GO:0004818"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006424"
FT                   /db_xref="HOGENOM:HBG334108"
FT                   /db_xref="HOGENOM:HBG389548"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="UniParc:UPI00003E6144"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEM7"
FT                   /transl_table=1
FT                   /translation="MSQYQLTVATRANQPYVLPVLLVATSINEARPSPVISITYEDTAV
FT                   LREGDKAVVQYTGASGNPIFGLINAVQELRKDFPFLNSKDEKLENEWLSQLEAFAPLDF
FT                   KALDPELQRLDTHLLLRSFVVGYALSTADIALWGAIRGNRVAVAAIKKGSLVNVTRWFY
FT                   FLEDLCPWATSTLEVLNQAVREKKAAKAKEGASYDIALLNTEKGVVTRFPPEPSGYLHI
FT                   GHAKAALLNDYFAHEKYNGTLLVRFDDTNPSNEKLEFQDAIIEDLALMGIKPDKMSYTS
FT                   DYFDELYQYALQIIKDGNAYADDTEKEVMAEQRMNGKPSKRRDASVEENLARFEEMKKG
FT                   TPEGLRWCIRAKMSVDNPNKAMRDPVIYRCNPAPHHRTGTKWKIYPTYDFACPIVDSIE
FT                   GVTHALRTIEYRDRNPQYQWFLDTLKLRHVQIWDFARMNFIRTLLSKRKLTKLVNQGVV
FT                   WGWDDPRFPTIRGIRRRGMTIPALREFILKQGPSKNITNLDWTLIWATNKKYIDPVAPR
FT                   HTAILKKDMVKAIVKGGPATPYTEEKPKHGKNPAVGMKKVVFGNTVIFDQKDAKSFKQD
FT                   EEITLMSWGNAIVRKIETDPTSGIVKELELELHLEGDFKKTEKKVTWLSTEGQDLIPVE
FT                   LVDFDYLLNKDTLQEDDVLEDVLNKNTEFREDAVADCNVAELKEGDIIQFERKGYYRVD
FT                   RAYVPGKPAVLFNIPTGKTGK"
FT   CDS_pept        join(963554..963807,963875..964439,964493..964585)
FT                   /codon_start=1
FT                   /gene_family="HOG000159984" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270535"
FT                   /orf_name="AFUA_5G03570"
FT                   /product="Mitochondrial large ribosomal subunit protein L1,
FT                   putative"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85949.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG334109"
FT                   /db_xref="HOGENOM:HBG529802"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniParc:UPI000051FA0D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEM8"
FT                   /transl_table=1
FT                   /translation="MSSFGSILPSAARSILSTCQLPLRQRTMAPLLSSFHQQVRGAKSN
FT                   AQARNKKAKAKSKKEKKGPREFKQKDLKDVEQFSLCDAIRYLRAFEVGREPTVSKYEIH
FT                   IRLKTKRDGPVIRNMLRFPHSVQTESRICVVCPPGTRHEKEARAAGAVLVGEQDVFDAV
FT                   KAGKIEFDRLICHPDSLDALNKAGLGRILGPRGLMPSIKTGTVVEDVAARVEMLRGGTV
FT                   YRERDAVIRLPIGQLAFSPEQLRDNLRATIEQVKKDAASLNDRIVKEIYEVVLSSTNGP
FT                   GFSLNGEFKSDNSPDTASLTGL"
FT   CDS_pept        join(complement(965990..966127),complement(964766..965641))
FT                   /codon_start=1
FT                   /gene_family="HOG000159973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270536"
FT                   /orf_name="AFUA_5G03580"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="Golgi organization"
FT                   /biological_process="protein transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85948.1"
FT                   /db_xref="GO:0007030"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG055934"
FT                   /db_xref="InterPro:IPR009316"
FT                   /db_xref="UniParc:UPI0000520809"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEM9"
FT                   /transl_table=1
FT                   /translation="MRKSAIHVGMHLRDSVDSSVGNFQVMVAPSDATLLQLVGFRKTTD
FT                   VFGDPEESASDLDDDTSDLPFPEPLTRASFLAPDFNPADYLSSLTNRHQSLEDLRQELR
FT                   NLDQALSRELLDLVNENYGDFLSLGSALQGGEEKVEQVRVGLLSFQREVQAIRDKVEAR
FT                   QSDMEKLLNEKRRLTGHANIARALLDFAERVEDLEKRLMIGDAPTQHQRESAEGLDTDS
FT                   DLLDSESEESDEEDLPTGSSAAPLVSLRRLENHIQKYVYLTRLASRIGGDHPFLLNQRP
FT                   RLAKIRATVLVDLKTALEQGSHAGAKRDTKTMAVLRLYKLMGEDTSAVTALKNLKI"
FT   CDS_pept        966428..967678
FT                   /codon_start=1
FT                   /gene_family="HOG000159962" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752556"
FT                   /orf_name="AFUA_5G03590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85947.1"
FT                   /db_xref="HOGENOM:HBG055930"
FT                   /db_xref="HOGENOM:HBG334111"
FT                   /db_xref="UniParc:UPI000051EDC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEN0"
FT                   /transl_table=1
FT                   /translation="MDYRSDRLSSHHGVQLSPSLSGQKWSQLTPSHSRPVVETVGPSHQ
FT                   ASSGRYRVALDTSARTYRTTALRQINGNHRPPSWVNRQANRSGNRSSTLASQPVLVRAY
FT                   SGSTDDTGEISNMPSRLSFPFSVRSGTPKRGPSLPSEDDFSIDGILRAIEPEIRNTLDA
FT                   IGEICGRSKLSLANEYGSHIAPLGEIRAPPGGLLTVEEASSDHERQPDDAMIIFDDDSN
FT                   SVMGVRDYTTLPQYRYLEQTRPSTIPPSTMGYHSFVPFSVAEGLSVLAQSANLDENTSD
FT                   PVADSLPATREFMSKPNSSGRTLLGKQSECITEDHLKSILTPALVAEIRLEAQANGHSL
FT                   HALPSDSRRGQLSAAENGDTATRDGGQTDKLSVLTDVQALFNWLRNASQDGQPRSAEKL
FT                   LRAMLEKQNEHPPRNTC"
FT   CDS_pept        join(complement(969142..969174),complement(968011..968928))
FT                   /codon_start=1
FT                   /gene_family="HOG000079916" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270537"
FT                   /gene_name="cfd1"
FT                   /orf_name="AFUA_5G03600"
FT                   /product="Cytosolic Fe-S cluster assembly factor cfd1 "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85946.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG411641"
FT                   /db_xref="HOGENOM:HBG586485"
FT                   /db_xref="InterPro:IPR015223"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="UniParc:UPI000051E487"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WEN1"
FT                   /transl_table=1
FT                   /translation="MPLDGVKNIVLVLSGKGGVGKSSVTLQLALALSLQGKSVGILDID
FT                   LTGPSIPRIVGLEDAKITQTPRGWLPVSVHPPENTAQDGAPPRGALRCMSLGFLLRDRG
FT                   DAVIWRGPKKTAMIRQFLSDVSWGPTDYLLVDTPPGTSDEHIALAEQLLTLASTDPAVA
FT                   SSMGRPRLAGAVLVTTPQAVATSDVRKEANFCVKTQIPALGVIENMSGYTCPCCGEVSN
FT                   LFSSGGGKVMAEELGIRFLGTVPVDVKFGELVEGKMVVDSDSDEEDGPTQAQQPEEPVD
FT                   NRPLVERYKDCWSYSRFEEFAKTLISQIESGSAAS"
FT   CDS_pept        join(complement(970899..970973),complement(970444..970832),
FT                   complement(969655..970375))
FT                   /codon_start=1
FT                   /gene_family="HOG000159961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057960"
FT                   /orf_name="AFUA_5G03610"
FT                   /product="Cdc48-dependent protein degradation adaptor
FT                   protein (Shp1), putative"
FT                   /protein_id="EAL85945.1"
FT                   /db_xref="HOGENOM:HBG055918"
FT                   /db_xref="HOGENOM:HBG717153"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR012989"
FT                   /db_xref="UniParc:UPI000051E6F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEN2"
FT                   /transl_table=1
FT                   /translation="MERNPAENDEVVSQFCAMTGTRPAEAQEYLAANGWDIEAAVTEFF
FT                   AEQDEAMLGANTAGGRSLGGAESAASAGRSLGGSSSQSGTATPKQSSSSSRKPTSKKRF
FT                   ATLGDFASGGGDSSDEDDTENQDFFAGGEKSGLAVQNPDDLKRKIIEKARKTQLPSSDE
FT                   PQTRRSYFTGTARTLGGDDTPSRVIESPSAPTLQRPQRVQRTLHFWADGFSVDDGDLFR
FT                   SDDPRNAEILDGIRQGRAPLSIMNVQPGQEVDVEIKQHEEKYVKPKPKYKPFSGTGQRL
FT                   GSPTPAVRSQAPSEAPAPSQPSAESVKPDVDESQPIVTLQIRLGDGTRLTSRFNTSHTI
FT                   GDVYQFVSAASPSSQSRPWVLMTTFPNKDLTDKSAVLGDLPEFKRGGVVVQKWQ"
FT   mobile_element  complement(972106..973062)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(973677..973952,974065..974181)
FT                   /codon_start=1
FT                   /gene_family="HOG000159940" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057961"
FT                   /orf_name="AFUA_5G03630"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="transport"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="EAL85943.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG055903"
FT                   /db_xref="InterPro:IPR013262"
FT                   /db_xref="UniParc:UPI000051F067"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEN4"
FT                   /transl_table=1
FT                   /translation="MADEHSHSRVELYDSGLTVPSDSEIYSANHEVSSPMSASSSPLIL
FT                   YKPPSIWGILRGAAINLILPFVNGLMLGFGELFAHEAAFRLGWSNTKIFPTYRRSRPMG
FT                   PGVEIRDLPSRRQPRAGSLQDTTSLE"
FT   CDS_pept        join(974942..975592,975661..976320)
FT                   /codon_start=1
FT                   /gene_family="HOG000159929" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270538"
FT                   /orf_name="AFUA_5G03640"
FT                   /product="Mitochondrial export translocase Oxa1, putative "
FT                   /biological_process="protein insertion into membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85942.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051205"
FT                   /db_xref="HOGENOM:HBG055898"
FT                   /db_xref="HOGENOM:HBG334112"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniParc:UPI000051F542"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEN5"
FT                   /transl_table=1
FT                   /translation="MSARFNSTSSVTDAAASEHLSGAPTDTGVPDLSDLSAADLSSIPE
FT                   HIGYLKNLGLDYGWGPSSIIQFFIEHIHIWGGLPWWASVVGTGILLRLALLYPTLGAVD
FT                   TSTKMLNIKPVTEPLRQQMIMRGKEGNQIEMLKLRAEIQKLHQEQGIVAWKSFIPMLQI
FT                   PFGFGCYRVVKGMAALPVPGLTLESVAWLKDLTVADPYFILPAASALFMYLSIRKGGEN
FT                   GVNQLQGTALGRLLMFGLPALSFLFMAFFPSALQLYFVTTGLFGLGQAYLLSSDTFRKS
FT                   MNIALPVRQPKNGQSPGRDDSQQSKSIRILREHLEAERAKMIQEQHKSPNSLEISFIDR
FT                   ALNNLKEAKENIKRETAEKLDAVRGQAPVKNADGTIAEPPRLGEKDLKLAADYERRRKE
FT                   EEDWKREERNHARREAHLKAMELEREKARSAFKVKQR"
FT   CDS_pept        join(complement(977666..978059),complement(977292..977575),
FT                   complement(976894..977202),complement(976732..976839))
FT                   /codon_start=1
FT                   /gene_family="HOG000216951" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270539"
FT                   /orf_name="AFUA_5G03650"
FT                   /product="Adenylate kinase family protein "
FT                   /function="ATP binding"
FT                   /function="nucleobase, nucleoside, nucleotide kinase
FT                   activity"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /protein_id="EAL85941.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0019205"
FT                   /db_xref="HOGENOM:HBG055891"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="UniParc:UPI0000F51C8C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEN6"
FT                   /transl_table=1
FT                   /translation="MRYLFSFSSCTVNTCEQVFNVNSPFLCLLLCRTAFACCPLFKMSD
FT                   KIEEISEIEEPAQSQSEENGASLTRRTHVQRVEHPMSELDSNNGDAWTCDEETYRRGGI
FT                   LIPVEVPNDIAPSDNVDVRSAKLIFLFGPPAAGKSTAAANVSAELGCIHICPDQTIKRL
FT                   GKTGPYLAWLRVVQAIETEGSVPPELLFRLVKMEIQRHMEFGATTFIIDGWPHCSEDFT
FT                   QLHETFTIVSAFHLYATQDTLEKRAMQNPMTFDEGTKCLKSFRDGMVRYYQELGDLLTL
FT                   DSFKDVLIPVRIQPHFQEYDRIHRLTPYEMSAEHDYQVFYPQIKFIIEERLARVEAVPE
FT                   LEQIETSSDEHEHEPEPVGDENLE"
FT   CDS_pept        join(complement(979956..980470),complement(979195..979885))
FT                   /codon_start=1
FT                   /gene_family="HOG000159918" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209280"
FT                   /orf_name="AFUA_5G03660"
FT                   /product="Transcription initiation factor TFIID subunit
FT                   beta, putative"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85940.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG055885"
FT                   /db_xref="HOGENOM:HBG325013"
FT                   /db_xref="InterPro:IPR006809"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000F51C95"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEN7"
FT                   /transl_table=1
FT                   /translation="MSSPPPHPTPTNPLKRPSLSSSASQPLGSNPKRPRMHPLRQTSFP
FT                   ASIDNDQRAFSATSDAGSVTGSFTGSLGGTSADGVFLGAAKKGKRGRKSKAEKEREREQ
FT                   REDAASLRGDTRLGSVDADGMSVRAGGTARGDAAGEEGDEDEDFDDEGELLRGEEGVTD
FT                   TEAEKKNLALLVDAFNPIQSERYDLFKRAKLRKETLRRIVNHALSQSVPASVVTTINGF
FT                   TKVFAGEIIEKARTVQAEWAIAHDQAARAAFDAEEAEAEARAAEAAAREGQGQSQPQTS
FT                   VKKEHSDSNRSTPIPPSSSSPMPQQQASQPSTPSVSGPPQQQQQQEQQPPPARPKREFK
FT                   PPPNPHRGQLLPSHLREALRRYKRDGEGGGVGFSGSSMGNLGVRGSVTWNAGSAGGRRI
FT                   FR"
FT   mobile_element  979900..980247
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   CDS_pept        join(complement(982666..982786),complement(981245..982605))
FT                   /codon_start=1
FT                   /gene_family="HOG000159915" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270540"
FT                   /orf_name="AFUA_5G03670"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme "
FT                   /EC_number="4.1.1.50"
FT                   /function="adenosylmethionine decarboxylase activity "
FT                   /biological_process="spermidine biosynthetic process "
FT                   /biological_process="spermine biosynthetic process "
FT                   /protein_id="EAL85939.1"
FT                   /db_xref="GO:0004014"
FT                   /db_xref="GO:0006597"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG436692"
FT                   /db_xref="HOGENOM:HBG610629"
FT                   /db_xref="InterPro:IPR001985"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR018166"
FT                   /db_xref="InterPro:IPR018167"
FT                   /db_xref="UniParc:UPI00003E6147"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEN8"
FT                   /transl_table=1
FT                   /translation="MVYIGIPKNYTASPSSFAGTPSLTINYEATQDLDSTNAFEGPEKL
FT                   LEVWFAPSAQELGPAQPAGLKAVPEEIWKDMLDLVNCQVLSIVSSEDVDAYLLSESSMF
FT                   VWPHKLILKTCGTTTLLSGLPRILEIAALFGGFPKSTAPSRGISVAAAPYRVFYSRKNF
FT                   LFPDRQRGPHRSWRDEVRTMDKLFLNGSAYMIGKMNGEHWYLYLTEPHTMLTPPTSPGA
FT                   KTEFTETETKVLSVPQGAALQTDSEDETLEVLMTDLDEENAKQFYLENATAVAENRYRN
FT                   SNSEKSGHVDVFSNTSSDISDFDSDGSQVLPPELTTEGHALGTVVSEACGLSSVYPKEK
FT                   YPDSRIDAYLFTPCGFSANGVIPPPEGKAGTHYFTVHVTPEPHCSYASFETNVPHSQNG
FT                   QTTAGIIKQVVDIFKPGRFSVTLFEAKPALSQVEDEWKEAKYLAARRTAKMEHVEGYRR
FT                   VDRIVHDLDGYELVFRYYERLDWKGGAPRLGEERS"
FT   CDS_pept        join(complement(985456..985825),complement(984976..985394),
FT                   complement(984370..984918))
FT                   /codon_start=1
FT                   /gene_family="HOG000159894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209281"
FT                   /orf_name="AFUA_5G03680"
FT                   /product="Transcription initiation factor TFIID complex 60
FT                   kDa subunit"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="transcription initiation factor activity "
FT                   /function="translation initiation factor activity "
FT                   /biological_process="regulation of transcription factor
FT                   activity"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85938.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016986"
FT                   /db_xref="GO:0051090"
FT                   /db_xref="HOGENOM:HBG182997"
FT                   /db_xref="HOGENOM:HBG320214"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR011442"
FT                   /db_xref="UniParc:UPI000051F2CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEN9"
FT                   /transl_table=1
FT                   /translation="MSVWNPDNIRDVAESVGIVNLSNDVTENLARDVEYRIAQVLEEAL
FT                   KFMRHSRRTLLTTQDVAQALRVLDVEPLYGYETTRPLRFGEASLGPGQPLFYVEDEEVD
FT                   FEKLINAPLPKVPREISFTAHWLAVEGVQPSIPQNPTAADSRNLELTAKGPNANSTLAA
FT                   MSGTGDVAVKPLVKHVLSKELQLYFEKVCNAFLDESSEEYRTSGYASLREDPGLHQLVP
FT                   YFVQFISEKVTHGLKDIFVLTQVMHMAEALVQNKSLYVDPYIASLVPPILTCLIGRQLG
FT                   GNADLSEQFALRDLAGSLLGLISKKYSHSSHTLTPRLARSCLKTFLDPSKPFGAHYGAI
FT                   IGLHAVGGTEAVRVLILPNLSTYATLLADGMAEDNPRRPEAEKVLGALLAVLSTLREGR
FT                   KTLANGHGAIVTDELRERLNAKVGDIIASRIADAGEVQMVYAILEA"
FT   CDS_pept        join(complement(987112..987794),complement(986454..987045))
FT                   /codon_start=1
FT                   /gene_family="HOG000048479" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270541"
FT                   /gene_name="sfh5"
FT                   /orf_name="AFUA_5G03690"
FT                   /product="Phosphatidylinositol transfer protein sfh5 "
FT                   /biological_process="lipid transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="microsome"
FT                   /protein_id="EAL85937.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0005792"
FT                   /db_xref="GO:0006869"
FT                   /db_xref="HOGENOM:HBG055864"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI000051E94A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WEP0"
FT                   /transl_table=1
FT                   /translation="MSVTMADQQPEKTTAPASDVADSQPAVVSNTDTRKETTETAEPQS
FT                   EDKTATTTAQPAVETTATQSGTAETPAEADKAPAEVQQPPQAEEEKPVAQQPEQPAYLA
FT                   KNPALSQFFERLPAIVSSSGHAEMWGVPLKDSNDAPTVNVLIKFLRANEGNVKLAEEQL
FT                   TKALKWRKETNPSALAESTSYSATKFGGLGYLTTYKEANGAETVVTWNIYGGVKDINTT
FT                   FGDMNEFVKWRVALMELAVKELKMAEATSVIDYDGEDPYQMIQVHDYQNVSFLRLNPAI
FT                   KAATKKTIEVFTTAYPELLREKFFVNVPAIMGWMFAAMKVFLSKNTTRKFHPISNGANL
FT                   AREFPSLKDQFPKVYGGSAPALQEGARTVSLIQDESAPAATEQSKEQANKEEAAQEESK
FT                   PESAPEQPKADPDVIVQEAPAADAK"
FT   CDS_pept        join(complement(989919..989967),complement(989126..989849),
FT                   complement(988978..989068))
FT                   /codon_start=1
FT                   /gene_family="HOG000159883" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270542"
FT                   /orf_name="AFUA_5G03700"
FT                   /product="Putative uncharacterized protein "
FT                   /function="protein phosphatase inhibitor activity "
FT                   /biological_process="regulation of phosphoprotein
FT                   phosphatase activity"
FT                   /biological_process="regulation of signal transduction "
FT                   /protein_id="EAL85936.1"
FT                   /db_xref="GO:0004864"
FT                   /db_xref="GO:0009966"
FT                   /db_xref="GO:0043666"
FT                   /db_xref="HOGENOM:HBG055859"
FT                   /db_xref="HOGENOM:HBG397087"
FT                   /db_xref="InterPro:IPR007062"
FT                   /db_xref="UniParc:UPI000051E704"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEP1"
FT                   /transl_table=1
FT                   /translation="MMTMAHNHEGVPKRPKGILKNSSGNVPQTAHATENFFINPARMDN
FT                   VDTKEITLQNTLQNAGRRRSSSNMGAGSSSRRQSLASIRGHDEQISPRLKWDEANLYLT
FT                   EQEKTAKMKIDEPKTPFAPHYDPAEDDEELRLAEAEESLIDAQDVVVDELDKTKKGTRK
FT                   GISVDDIPDLELGEPEEPSYMVGSGEGNRIIRERSLSNESHRSDKHVVVGTGEENGVGA
FT                   DGDHLMTTEEAKEKHRQFEQMRKKHYEMRNIKKLLAHPEDLDEMEEDNDDDDDNDNGSV
FT                   NPPRLP"
FT   CDS_pept        join(complement(994689..996023),complement(994504..994613),
FT                   complement(991279..994429))
FT                   /codon_start=1
FT                   /gene_family="HOG000159872" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057962"
FT                   /orf_name="AFUA_5G03710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85935.1"
FT                   /db_xref="HOGENOM:HBG023890"
FT                   /db_xref="HOGENOM:HBG055852"
FT                   /db_xref="UniParc:UPI000051E716"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEP2"
FT                   /transl_table=1
FT                   /translation="MSPMLLVPDDGSVDRSSVSQVDLTIGESEDSGRSSAQFIAAPMRS
FT                   DSRQAMDQPPPPPPTTTPTLPSISTEPPKVSFEDFAIRYRQNQHKQARRKTLENRLHAT
FT                   KISIGISTRLVRVGGVVQRGLVESLKHEDKANFLALYHTFLDLQDSHDLAMRHHFYRQD
FT                   PSEDWSSAQESTVERSPDFFLQLSPQSRSDLLRILQLVRTNPQFLCDRLCSLTSAQLNA
FT                   LLSTSTTSLDSGDHTFLPAARSRNQYSLPKRASAASVPFRDHAVNFERTDAISNLVFNV
FT                   FATPLDSDTPEARLRLDVWSSVCSELITQGGNRFYPLIGHILSSWTMGSAWQARPKFEL
FT                   YLMDILQTGAFLLEHIETPAGLGFDAGSLDPLKTDVAEEYFASAVDALFKLLDDPDAGF
FT                   PHTVFKFARAILQKLGSPDSRARFLEYLLLQWFFPKFLSGALAYPETFGLLLDFHIRKD
FT                   AREKLLGQVALRAYSQVFAILRSMHHFSMTRPAVRQHVENMLHQFQTTDNDNMQFAQRS
FT                   QPKSHQESPCAFLMLSATDVLTLLGALFPTATSPACSSPTPCAASSALSPSSLQSFPDR
FT                   RTNTVPEPGFYRGNLSGGSSPQLSSTAFPSADIHFFTCSEDHLSRNADRIRFELSALVE
FT                   PDGRPGLAYPSTEEWAIFSVTDGGHRLVWGLFADGQLSDAGNLSADTCPSTTLGMEDNF
FT                   EALHTAIIKLVREYPTGDRSDYCGERGQMAPSQSSSLQSRFNQVMSHCYHNSDFMGAHY
FT                   WWNASRQLRRSIADVPSRLGDDSWILEPMHTACSRSLRVAHSVIERCEADFVALDRSLW
FT                   QLQGTVKEMVKTITKLRNKMWYMTDVKNSMRYEDARNVALALKTMVYSARLYQPISTSD
FT                   RRTRSSPRALGGSVLQKPELQVMNVMKAPSSQGGPNKLSDEQVELTRKWLAQNNIDNFC
FT                   KGEERIHRFCYEVKVSINRLVGDTMAEAPVLWASELFQKERVKFEGSSNRSFLGLSSSS
FT                   LRPMSTAGEELSFASQSSGGSLRSSDCFSRYTQDLPPLNRKSSFQSSISDKWRMPRDPS
FT                   PADGLSIGDSPSKATSVSTADTYSTFWSVPHQNAPYAASASSFYSRPPSMLSETVVQPA
FT                   PQKDFKGQGKAAFLDELKQALTSLLLSDLGSPVWSCGSETDAWFGNALDQERIRVQMKK
FT                   REKIQCFYAECNARTVRQIPRHYQSRGRRSRSLGPPLSGRAQESDDTTSVPMSESARAA
FT                   EDQSPFSYGVVFRQLIEIFSRHGNPFVKLNALRDLRALVIASLNVDNDKAYAHADQERT
FT                   HSRELGLHGKRAARHSFSEVGTLRGAEKGFLQTPTSPAAESVTLDSRPSEYSAPTENQI
FT                   VDALRSLLLEVKPKTLFRDLQFISAFVPSETLNKTDSGTAFLQFGLAALSLKEEVCNSM
FT                   VEIADRIVSQELSRRHVPQPFGFNARPSHAIEDAAGMWIITAKEGNPVAQRELAILYLT
FT                   HPELLPRVTLPLTSPRDTFKAEMMYRRDKDSKSDPQSMCLALHWMQLSANGGDQLARNR
FT                   LREREEFDSIA"
FT   CDS_pept        join(complement(999968..1000630),
FT                   complement(998760..999895),complement(998589..998688))
FT                   /codon_start=1
FT                   /gene_family="HOG000159850" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057963"
FT                   /orf_name="AFUA_5G03720"
FT                   /product="Chromatin assembly factor 1 subunit A, putative "
FT                   /protein_id="EAL85934.1"
FT                   /db_xref="HOGENOM:HBG055846"
FT                   /db_xref="InterPro:IPR022043"
FT                   /db_xref="UniParc:UPI000051F2AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEP3"
FT                   /transl_table=1
FT                   /translation="MEVSVDSSSGLSSLPPQSYPTSPSASRKRSIQEIEASPHSPESRK
FT                   TSKICDQENQDPSLSHAAASCTPTDQHVKTPSGPPASIEIPNQQNVANTTTPGGSVFVE
FT                   VRQPSSTTETTSKNTQPSTPTKTTNAPAPSAKKRKLSPASKEAKQQEKEAKERQKLEEK
FT                   AKKEEEKRIKEEERKKREAEREEERKRKEEKKRLKEEEKAAKEEEKRKKEEEKLKKERA
FT                   QTKLNAFFVKPKPPAQPTDDTASDSPKIPIADGVSKSTSQNPTPPQSDYQREFPDFFLQ
FT                   SHTRIAPPHQFERDPQALSHVRERVDACLQSYRNGSAEPLSFRPSELFRLMPYNRRRGR
FT                   QAASVKEILLRMQSLEQSDPDSARRAQELLRRIKMKSLKFGEDVRPPYQGTFTKTLPES
FT                   AAIKLMRNPFHRGLPDINYDYDSEAEWEEPEEGEDLDSEEEEEGSDEGDDDMDGFLDDD
FT                   DDNLEGKRRLIVGDLEPLSTGLRWQGEGGDHELEMYRIQTTMDSVTFPIDPFSTAYWQK
FT                   PKPTEQLPAGGVGRCTLHSFMVVPSSTQSQTAAPATAGVTPTLLTASGKAKRTLTPEQL
FT                   AEFKEVVNGSDLTKTGLIEVLKKRFPKISKDVLKETLTHVATRVGQREVDKKWVCN"
FT   CDS_pept        complement(1002437..1003552)
FT                   /codon_start=1
FT                   /gene_family="HOG000159839" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057964"
FT                   /orf_name="AFUA_5G03730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85933.1"
FT                   /db_xref="HOGENOM:HBG055838"
FT                   /db_xref="HOGENOM:HBG334132"
FT                   /db_xref="UniParc:UPI000051EDDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEP4"
FT                   /transl_table=1
FT                   /translation="MTDYRLPIHQAPSRKPVPGMHRGYPFQSYEPHQQQPPHHYRPQQQ
FT                   QQHHHHHLQQEVSPHPSVSSASRNRASSSHVSPYGAHQQQYAGAPSPQYTMTSHVSHQS
FT                   RRLSNTSATTSTSSTGNNFSSDIRRSTSSRSTNTQVGYVALMRRQKATVWCDRAQPEDP
FT                   RLRAQKLADKKRAYLEVHGAGAGRTGTLASGKNKHGNKGVTEFSASALVGATVPVRLSA
FT                   NEVGDGDEDGHSDNGFPHRRTGSGRSSLGSNYRYPSSYQRPSQGTSGSNNTPPNERADL
FT                   PEVTENPPAERHEQERASSAKDDSATSHSKTSEQEDSFGSVGDMAAPSAATTAAEKARK
FT                   ADELRRRGSVDERTTTMTNVRLFVANPDLSD"
FT   CDS_pept        join(complement(1007360..1007423),
FT                   complement(1006225..1007309))
FT                   /codon_start=1
FT                   /gene_family="HOG000219744" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270543"
FT                   /orf_name="AFUA_5G03740"
FT                   /product="Isopenicillin N-CoA epimerase, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="EAL85932.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG370804"
FT                   /db_xref="HOGENOM:HBG659028"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="UniParc:UPI000051FA18"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEP5"
FT                   /transl_table=1
FT                   /translation="MSKSSLPLAGVRVVELAGLAPGPFAGLLLADYGASVLRVDRPKSI
FT                   STDQLTRRKTSITLDLRDKTSHRLLLSILTKADVLIDPYRPGVLERLGLSPSDVLLKHN
FT                   PRLIVARMTGFRRDGKYKDMAGHDINYIAVSGVLSMLGRKGEPPYAPGNILGDFAGGGA
FT                   MCFLGILLALLARAHTGRGQVVEANMVDGSAYLATMPRLNRQTPLWNLPRGENMLDGGS
FT                   PFYGTYECKDRGKYFAVGALEPQFYAALIKGLGFETGDLPAREDRANWPALRAAFERRF
FT                   KEKTRAEWEAIFDGTDACATPVLEQAELEQSGYEQRPAVHLVDTPGLPIPADDGGWTGG
FT                   GLLPGTGGQETLKTWMGWERGRDYDIRGDGVLVWIEGGKSKL"
FT   CDS_pept        join(complement(1008228..1008681),
FT                   complement(1008086..1008171),complement(1007788..1008009))
FT                   /codon_start=1
FT                   /gene_family="HOG000159828" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270544"
FT                   /orf_name="AFUA_5G03750"
FT                   /product="WW domain protein"
FT                   /protein_id="EAL85931.1"
FT                   /db_xref="HOGENOM:HBG055826"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000051F2AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEP6"
FT                   /transl_table=1
FT                   /translation="MDGFLGKMIEKFAEKATGGSSNSGGDGYSSYNQQQPSYGGQGQGY
FT                   NSGPAPPQDLPYPWVARWDDRDQRWFYVNEQTGERSWERPYGGSGGPSYGERSYGQPQP
FT                   SYGYEGGYLQAQEQRPEHKDHSMMYGAAAGAAGLVGGAILMHEGEKIHEDWDEKKERIE
FT                   QNVEDFPENAARWTGEKVGEIEAIPENIEQGWDRAEDRIEQKWDNAVDDIEEFPENAAE
FT                   WTGRKVGEVEQFGDNIGNAYDEGRAEGRDDW"
FT   CDS_pept        join(complement(1012497..1012601),
FT                   complement(1012000..1012432),complement(1009794..1011922))
FT                   /codon_start=1
FT                   /gene_family="HOG000159794" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057965"
FT                   /orf_name="AFUA_5G03760"
FT                   /product="Class III chitinase ChiA1 "
FT                   /EC_number="3.2.1.14"
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85930.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG055819"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051F7C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEP7"
FT                   /transl_table=1
FT                   /translation="MVSSKLSFVATAVAALAPLASAFDASSRSNLAIYWGQGPNQLRLS
FT                   HFCQETSLDIINIGFINYFPDMSPGHWPGSNFGNQCDGSVYVTNDGVVTKLLSGCHQIM
FT                   EDIPICQAAGKKVLLSIGGAYPPDQSILSEDSAVAFATFLWGAFGPVAEGWEGPRPFGD
FT                   VVVDGFDFDIEHNGGFGYATMANTFRQYFNQVPERKFYLSAAPQCIIPDAQLSDAIFNA
FT                   AFDFIWIQYYNTAACSAKSFIDTSLGTFNFDAWVTVLKASASKDAKLYVGLPASETAAN
FT                   QGYYLTPDEVESLVSTYMDRYPDTFGGIMLWEATASENNQIDGAPYADHMKDILLHCDP
FT                   SPPVTSSSAIPSSTPVTTPSPSSSAVPSSTPAVSETPSPSSSAVPSSTPVASSTPVVPG
FT                   TSASSSPVSSSSAVASSTPVVPGTSASSSPVSSSSAVASSTPVVPGTSTSPSTPVIPGT
FT                   SASSSPVSSSSAVASSTPVVPGTSASSSPVSSSSAVASSTPVVPGTSASSSPVSSSSAV
FT                   ASSTPVVPGTSVPSSTPAIPGGSSSSSEAVASSTPLVTLTLTVSPTPAPSSSESSSTDL
FT                   SSSTQTDVGTAPSQPAGPSTTATATTSSSSSSTDESSTTVGSGNGNGSGSTTTTAATDS
FT                   ITAAPTATSSATATGATSEPVTITTIIVTSYIDICPTGFTTVTTTYTTTYCPGTNTATA
FT                   TATVTNPPSGPGGAGSQTTAPTVPEGWTTTVTICTQCAAKPTTVTLTLPVTETGSTSTD
FT                   AVPAPPAATGEGSNPTQPSGASPTGGNGSFSEEPVPPPAVTQVSTSTEIVTLVRPTSSR
FT                   PLILGTGTVHPSSTLAVKPSAKPSGQNSGSSSHVPIPPSYTQEAVSPLSTGAASRVTGL
FT                   GHGLVLTVLTLSAFFVL"
FT   CDS_pept        join(complement(1016251..1016663),
FT                   complement(1015590..1016199))
FT                   /codon_start=1
FT                   /gene_family="HOG000152322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904716"
FT                   /orf_name="AFUA_5G03770"
FT                   /product="Lipase, putative"
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /protein_id="EAL85929.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="HOGENOM:HBG413490"
FT                   /db_xref="HOGENOM:HBG757640"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI000051FA32"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEP8"
FT                   /transl_table=1
FT                   /translation="MSVSTDISQPPYPLHDSVKDKLDPEYVDFYNKYVINLQQVHLQPV
FT                   AASRTSGILIPGGGPLLEVGKTEDITIKRRATEGPDILLRSFLPPGEKPADGWPVMLYF
FT                   HGGGWVLGNIDTENPVCTNLCVRGNCVVVTVDYRLAPENPWPAAVHDCWEALLWLISDG
FT                   ASVLPVNTSKMATGGSSAGGNLASIITHKALTLSPPVRFHAQLLSVPVMDNTATVDNNE
FT                   SYRLYEHTPALPAAKMIWYRNHYLPNIADRANPEASPLFYDDDWSQLPPALIMVGELDV
FT                   LRTEGEQYAAKLRKAGVKVDLQVMKGMPHPFLAMDAVLKEGRRSITLMCDTLKRIFWES
FT                   "
FT   CDS_pept        join(1017353..1017514,1017625..1017782,1017849..1017915)
FT                   /codon_start=1
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752557"
FT                   /orf_name="AFUA_5G03780"
FT                   /product="L-PSP endoribonuclease family protein Brt1,
FT                   putative"
FT                   /protein_id="EAL85928.1"
FT                   /db_xref="HOGENOM:HBG407921"
FT                   /db_xref="HOGENOM:HBG695954"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI000051FC71"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEP9"
FT                   /transl_table=1
FT                   /translation="MATKTPVLTEKAPKPLPGIYSQAIIANGVVYCSGAVAMDPETGKL
FT                   IDGDVKAHTHQCIKNLTHVLEAAGTTIDKVVKVNVFLSDMDNFADMNSVYMQYWGDVKP
FT                   CRTCVAVKTLPLNTDVEIECIAVL"
FT   CDS_pept        join(complement(1019922..1020263),
FT                   complement(1019368..1019862),complement(1019096..1019316),
FT                   complement(1018682..1019031),complement(1018316..1018616),
FT                   complement(1018189..1018258))
FT                   /codon_start=1
FT                   /gene_family="HOG000159793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270545"
FT                   /gene_name="fetC"
FT                   /orf_name="AFUA_5G03790"
FT                   /product="Ferrooxidoreductase Fet3, putative "
FT                   /EC_number="1.10.3.2"
FT                   /function="copper ion binding"
FT                   /function="laccase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85927.2"
FT                   /db_xref="EMBL:AAT84595.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008471"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324004"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI000046E5D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SE94"
FT                   /transl_table=1
FT                   /translation="MAVGFLLLTAFVVNILTTSAATLHYDWNITWVTANPDGQFERPVI
FT                   GINGQWPPPVLSFTRGDRIIAKVHNALGNETTSVHWHGFFQNGTNHMDGPPSVTQCDIA
FT                   PGSTFVYNFTVEQSGTYWYHSHTKGQYPDGLRQALVVTDPKNPYIGQYDEERVISLSDW
FT                   YHDQMPTLLKSFISISNPTGAEPVPKAALMNDTQNLTVAVEPGKTYLFHLVNVGAFASQ
FT                   YFWIEDHTMKIVEVDGVWTHASEANMIYIASAQRYSVLVTMKNETSQNYAMVGSMDTDL
FT                   FDTLPESLNYNVTGWLMYNDQADKPTPALVSAFEPYDDFNLVPVDGMALHKEADYTVTL
FT                   DVTMDNLGDGANYAFFNGITYVMPKVPTLYSVLTTGSAATDPAVYGYNTHPIVLKRGDI
FT                   VDIVLNNDDAGKHPFHLHGHTFQVIARSEENAGHYDPSNHTTFPSIPMRRDTVIVRPQG
FT                   NFVLRFQADNPGVWLFHCHIEWHMDSGLAATFIEAPLDLQKTLKIPEDHYQVCEASGTL
FT                   TAGNAAGNTKDLFDLTGQNVSPAPLPAGFTAKGIVALVFSCVAAILGLLSIAWYGMAPI
FT                   TAPRAGSTPSNDSDEN"
FT   CDS_pept        join(1021613..1021640,1021716..1021840,1021914..1022359,
FT                   1022423..1022936)
FT                   /codon_start=1
FT                   /gene_family="HOG000159782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270546"
FT                   /gene_name="ftrA"
FT                   /orf_name="AFUA_5G03800"
FT                   /product="High-affinity iron permease "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85926.2"
FT                   /db_xref="EMBL:AAT84596.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325002"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniParc:UPI000046E5D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SE93"
FT                   /transl_table=1
FT                   /translation="MAKDVFAVPIFFICFRECVETSIIVSVLLSFIKQTLGQEQDATTR
FT                   KRLIRQVWWGVAIGLFISVCIGAGMIGAFYGYGKDHFASTEDLWEGIFSLIASVIITIM
FT                   GAALLRVTKLQEKWRVKLAQALEAKPLTGGTFKNNLKLWAEKYAMFLLPFITVLREGLE
FT                   AVVFIGGVSLSFPATAFPLPVFTGILAGVAIGYLLYRGGNQASLQIFLIISTCILYLVA
FT                   AGLFSRGVWYLENNTWNHVIGGDAAETGAGPGSYDIRQSVWHVNCCSPLVNGGGGWGIF
FT                   NAILGWTNSATYGSVLSYNLYWIAVIVWFVAMRHKERHGRLPVVDPLLNRLRGRKSAEP
FT                   GNGEQDVEVSTIPSDLQTESKIPKSGASLV"
FT   CDS_pept        join(1024076..1024255,1024393..1026084)
FT                   /codon_start=1
FT                   /gene_family="HOG000216950" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270547"
FT                   /orf_name="AFUA_5G03810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85925.1"
FT                   /db_xref="HOGENOM:HBG055785"
FT                   /db_xref="HOGENOM:HBG334126"
FT                   /db_xref="UniParc:UPI000051E49B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEQ2"
FT                   /transl_table=1
FT                   /translation="MAGQPTTPQRRGSWTKVVIFVSLYVLLLESLIEWVLVIYLFVNQQ
FT                   VDSKMLPSLVLILIASPRIPAAKELLAWRVHVSAAADNNRLGSSECGGLGDHFAADFMS
FT                   SGQYQRWFLENRCQLCASQSCRYHFSSILVSDGNSPVVMGKVLMRIFSITVCLYFCSRE
FT                   LCRRPYDVSLLGVYSQRQPIRSDSVYSQTSFDRESCLSNDIYYLCRGPDVTFGTQGVYI
FT                   PSSNDDLMEKAFSPTIQHPRPIRPKSQLRLDTDQACEAAEILSGTTLASTGKTSLTEKE
FT                   AVKLTNLAPVSRTPTVATLKTASEVSSQNPPCAELSGTPEVPPISSSLGHSGQKSSISS
FT                   LCRSLLKVLPISIPLSADPQIRALAEADPHRGVEQQARRDGVTVGQEQTEQSPNSSPSQ
FT                   HPSPSIADGSSEMESFIAGAQLKGPSRPRSMTANSADAPEVVAPPATVHRSNTSNTLPA
FT                   YQPQHPAYMLIPPNQIARRPMDRPPKRRVSLMEPNMVARRHTHRYNQRQRPSYQFDPNH
FT                   IPRHTQSHYHRPHHRPHQQFEQCRTRGPAWRRNDAEFIYPSTRRPRSSTCGGIASLGYG
FT                   PLDSIRETGSSVDEARTAVTLDDQGGRTILNRNTYRGANRISMHRFS"
FT   CDS_pept        complement(1026612..1029110)
FT                   /codon_start=1
FT                   /gene_family="HOG000159761" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270548"
FT                   /orf_name="AFUA_5G03820"
FT                   /product="Spindle pole body associated protein SnaD,
FT                   putative"
FT                   /protein_id="EAL85924.1"
FT                   /db_xref="HOGENOM:HBG055779"
FT                   /db_xref="HOGENOM:HBG334125"
FT                   /db_xref="UniParc:UPI0000520343"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEQ3"
FT                   /transl_table=1
FT                   /translation="MADTRYTSPDPTTHDTVGASTIATPLFLPSSPPPAEERMVDSRPR
FT                   ADSPVSDRVAAESEGARSPALSRSSSPDHQVNELDARLAEYTVDFRALSGTQLARDGDT
FT                   LPDLKFPHEEDKLSEVGGPEDFTANMERYLMGMDDDLEDKGWEEGQSALVNDNPQPAIT
FT                   PGDKHEGQGEEKEADHQPQQQGHGLQQPGPDDEAEVSEYSEFGPPVDMSTPSHFLRRTG
FT                   AFAKEMTQLEDIEEDPDDEAPPVSTPSVQRQTATPQHDTTDSNEDLRRQIAELKAAIRD
FT                   RDQQLERNHRRVLEAASAGEQIKHLQAELQKKSSQLDDLQAKIDDEANLRQQIQMPQSE
FT                   NDEKESYMQRSSFSQSGLSALQKQLGDMQKELQSRDTRPDLDAERLETIAYLRQQLDLA
FT                   QEQLRKRDAALEDTLAKLRDVTAAKELQLREKNAEIDGLKAQIDDNLMEIDRLETELGQ
FT                   ANQEYRILEEKVESLETKNRPLEEKNSTLEADLNRAQSQVTAQGNALKAMAAEMPLEAG
FT                   GRNTYTEILELIKDLDPHSTTHSSGKPSLSRDADSRDEIMEEYRQDLAKARAELEEASS
FT                   VRKALELDLKRSQEQAAEAQTLFKSVEDENTRLTKQIDDLRTSLDKVQGELGQMKAEHS
FT                   EALETISRLQTERKTQQPSPPPSPPTPHNIGQAEKLEESYRAQLKSLHTAHATAISTLR
FT                   SSHADSTRKLRDLLAAAEKRESKLKAEVQSLLAARAAQDTQLQSLDTEVRRLQSAIAVK
FT                   EEAAAALDERIARSVEKREKEWERRVDLLLKERERMAKALMWAWGEKEVGEVKENLGED
FT                   GRRVRQAYRYKYAQRKGREG"
FT   CDS_pept        join(complement(1029716..1029949),
FT                   complement(1029515..1029658))
FT                   /codon_start=1
FT                   /gene_family="HOG000159750" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057966"
FT                   /orf_name="AFUA_5G03830"
FT                   /product="Conidiation-specific protein Con-10, putative "
FT                   /protein_id="EAL85923.1"
FT                   /db_xref="HOGENOM:HBG055771"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniParc:UPI000051FC95"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEQ4"
FT                   /transl_table=1
FT                   /translation="MQCSLFRPHLLSNRLGRSPSLWRTTTARVATRADHHPNPGNFANR
FT                   PKEELSEIGRKGGRKGGRARGVGGFHDMDPEKQHEIASRGGRATNKAAEQAEKHLGVAG
FT                   ERRHTHEPSAASPGFEESWTV"
FT   CDS_pept        join(1030952..1031228,1031295..1031698,1031801..1031971)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057967"
FT                   /orf_name="AFUA_5G03840"
FT                   /product="Oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85922.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000052058D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEQ5"
FT                   /transl_table=1
FT                   /translation="MASRRLLKSLPSSIARPGRLFTVTTPVTVYRTFSSSTLCLDSETQ
FT                   KNGKPVATSTENAYPNFSLRKKAYVVTGGGRGLGLTIAEAMVQAGAQVHCFDRLDTPHP
FT                   DFALSQEASKNLEGSIHYHHVDVRDREHLNQTIRTITKEHGQIDGLVAAAGIQRVKDAV
FT                   DHTPQEVADLMDVNFTGVFMSANAVAEQMMQTKRPGSIVLVASMSGMIANKGLTCPAYN
FT                   ASKAANFEEVPGLKETWEKENMLGRLAAPEEFTGATIFMLSPASSFMTGSCLVVDGGHT
FT                   AW"
FT   CDS_pept        1032426..1033385
FT                   /codon_start=1
FT                   /gene_family="HOG000159739" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057968"
FT                   /orf_name="AFUA_5G03850"
FT                   /product="Class III chitinase, putative "
FT                   /EC_number="3.2.1.14"
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85921.2"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG055754"
FT                   /db_xref="HOGENOM:HBG324999"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000F51C64"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEQ6"
FT                   /transl_table=1
FT                   /translation="MPPVPGRPEHRRVICYHQTLCPNRGDYVSVLPLVKNNTGVTHIII
FT                   AAFHLNEDPGHITLNDDPPDHEMYNPLWAEVPVLKRSGVKVMGMLGGAAQGSYRCLDGD
FT                   QEKFERYYQPLLAMVRRHQLDGLDLDVEEEMSLPGIIRLIDRLKLDLGDDFIITLAPVA
FT                   AALLGIGNLSGFDYRQLEQQRGSKISWYNAQFYNGWGLAEDPRMYAAIVAQGWSPQRVV
FT                   YGLLTNPGNGSQGYVPRERIGPVLAVLVEQFPNFGGVMGWEYFNSIPGEQQSPWQWAAE
FT                   MSLSMHMKDVLAAARQMLTAGPMANSLMNVLRDMMHQP"
FT   CDS_pept        join(1033700..1033777,1033846..1033978,1034038..1035809)
FT                   /codon_start=1
FT                   /gene_family="HOG000159728" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209282"
FT                   /orf_name="AFUA_5G03860"
FT                   /product="Alkaline phosphatase family protein "
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL85920.2"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG055745"
FT                   /db_xref="HOGENOM:HBG324998"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="UniParc:UPI0000F51CC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEQ7"
FT                   /transl_table=1
FT                   /translation="MVSFPRIAAATSSAILRLATFVFLRWVPGHHFPPIIFTSLAVYLA
FT                   SLRSLIYQDSDNAAPRNSGKKAPDSKKIEPTSKARPLKTLLTGLPCTQSPLATRLTALV
FT                   NIVLTLLTLDFMLRGVVFHSGKNLTFSRIGYVSPTTANLLVREPDSAQLPLVVYYQEIL
FT                   EDDPSKWVEEGIVYSLDDSTDYTTSVTIQGLKPASSYRYSLSNKQTGTFVTAPLPGTEP
FT                   ANRLAFVTSSCMKQNFPYNPLSHSLRIPGIETMTETLAKLPELLRPAFMMFLGDFIYVD
FT                   VPQRFGSSVSHYRSEYRRVYSSPSWTQNDAIGLPWIHTLDDHEIANDWSKGNTTAPYPA
FT                   AADPYIHYHVSVNPPIPPMAFAKPENTTYLSFIHGPASFFMLDTRTYRSEPAQVNSTIL
FT                   GSAQLQSLLAYLARPESAEVRWKIVASSVPFTKNWHVGTTDTWGGFLHERRTVFEAMWR
FT                   AERELGVRVVLLSGDRHEFGATRFPDPMLDYTSEDLLAHTAGEGVHEFSVGPLNMFYLP
FT                   IRTYRQTDTEDVAVKYVPDGNVKYGLVDISIQDEQIDTASGTPVTVPSSVLTYTLYVED
FT                   QVVWKYKLSVPLPEYDSLMAASSAKHPRLPPGKVLVDNRKAEGWHAAIQTMVGRLEEAA
FT                   RQFAHRAVDEFYELLDKTERAERLD"
FT   CDS_pept        join(complement(1037738..1037815),
FT                   complement(1036183..1037673))
FT                   /codon_start=1
FT                   /gene_family="HOG000036165" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904717"
FT                   /orf_name="AFUA_5G03880"
FT                   /product="Signal recognition particle protein SRP54 "
FT                   /function="7S RNA binding"
FT                   /function="GTP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle "
FT                   /protein_id="EAL85919.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0048500"
FT                   /db_xref="HOGENOM:HBG235775"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR006325"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI000051EB8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEQ8"
FT                   /transl_table=1
FT                   /translation="MVLQDLGRRINAAVNDLTRSSNLDEKAFDDMLKEICAALLSADVN
FT                   VRLVQTLRKSIKSSVNFSSLPPAVNKKRLIQKAVFDELVALVDPHAEPFRPKKGRSNVI
FT                   MFVGLQGAGKTTTCTKLARHYQMRGFKTALVCADTFRAGAFDQLKQNATKAKIPYYGSL
FT                   TQTDPAVVAAEGVAKFKKERFEVIIVDTSGRHKQEEELFTEMTQIQNAVTPDQTILVLD
FT                   STIGQAAEAQSAAFKATANFGAIIITKTDGHAAGGGAISAVAATHTPIIFLGTGEHLMD
FT                   LERFEPKAFVQKLLGMGDMAGLVEHVQAVTKDSAAAKETYKHIAEGIYTLRDFRENITS
FT                   IMKMGPLSKLSGMIPGLSNLTAGLDDEDGSLKLRRMVYIFDSMTAAELDSDGKIFVEQP
FT                   SRMVRIACGSGTTVREVEDLLSQHRMMAGMAKRVGGQKKQMQRAQNMLKGGNKEQQLAA
FT                   MQKRMAAMGGAGAGGLPGMGDMAKMMQMLQGQGGGGMPGFGGMDLQSMMSQMSGLMGGG
FT                   RGRGR"
FT   CDS_pept        1038135..1039037
FT                   /codon_start=1
FT                   /gene_family="HOG000159717" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752558"
FT                   /orf_name="AFUA_5G03870"
FT                   /product="DUF1665 domain protein"
FT                   /protein_id="EAL85917.2"
FT                   /db_xref="HOGENOM:HBG055723"
FT                   /db_xref="HOGENOM:HBG324995"
FT                   /db_xref="InterPro:IPR012459"
FT                   /db_xref="UniParc:UPI0000F51C5B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WER0"
FT                   /transl_table=1
FT                   /translation="MAPPMAKKRKVLDSLKNKAGRPKKKFRKQLEYHSSSDEAEDEQPT
FT                   DFQAVNLADSDAEEERKPVERKPQKPASSETRSLGAQKKRKAEDSDDSSAASENESDAD
FT                   DNNGSDSPDSSDMEDDEYGDSDTSLPTSTNGRRRPVAKRNDPTAFSTSISKILSTKLPS
FT                   SARADPVLSRSKSAAQTTSELADEKLDKQARAKLRAEKKEELDRGRVRDVMGIERGLTG
FT                   VVAEEEKRLRKIAQRGVVKLFNAVRAAQVRGEEAAREERKKGTIGIGEREKAVNEVSKQ
FT                   GFLELISGKKGKPLNIEEA"
FT   CDS_pept        join(complement(1039832..1040085),
FT                   complement(1039657..1039763),complement(1039341..1039585))
FT                   /codon_start=1
FT                   /gene_family="HOG000244518" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270549"
FT                   /orf_name="AFUA_5G03900"
FT                   /product="2Fe-2S iron-sulfur cluster binding domain protein"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="electron carrier activity"
FT                   /protein_id="EAL85916.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="HOGENOM:HBG267069"
FT                   /db_xref="HOGENOM:HBG524254"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="UniParc:UPI000051E486"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WER1"
FT                   /transl_table=1
FT                   /translation="MSFWREACQQLRHAVQKTAKGDRMWLPYTRRFISSSTQTMRVQSY
FT                   GRRIAQVGGGQKTFNSPRRSFSITARVQHGHVTPPKPGEELHVSFIDKDGQKHDFEVAE
FT                   GDNLLDIAQANDLEMEGACGGSCACSTCHVIVEDPEVFDKMEEPSDDENDMLDLAFGLT
FT                   ETSRLGCQVVMNKDLDGLVVRLPSMTRNLQASDFAQKK"
FT   CDS_pept        join(1040396..1040776,1040809..1041966)
FT                   /codon_start=1
FT                   /gene_family="HOG000159706" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270550"
FT                   /orf_name="AFUA_5G03910"
FT                   /product="Mitochondrial fusion protein (Ugo1), putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85915.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG055711"
FT                   /db_xref="HOGENOM:HBG334124"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="UniParc:UPI000051F52A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WER2"
FT                   /transl_table=1
FT                   /translation="MNSSREGPNPLRPYYVPPSFGLEASNASSSHPPAPSSAQVFGSSA
FT                   RDLLPDLDYSEYLESSPSLSEWIRDAMDAAIWRYTSVLTAQPFDVAKTILQAYVVPNSQ
FT                   DGQRPADERRRSGRMGSFDESDERVRDRLANQHPWWRQDSQTSDDESNYFTSAAPRATS
FT                   PRAARSRKSRRHITDRSGYIPTPPSSPKYSLTIKNPSSLMEVLSQLWTTSGPTSPWKAT
FT                   NATFIYSLLLPTLNTFIRSLLSAIVGLPEEDIASSMTADILTSTSPFATLVLSFIASSL
FT                   SAMLLSPIDTARTFLILTPATHGPRSLLRAIRQLPTPNCMIPSHLIPITILHSSLPNFI
FT                   TTTTPLFFKTYLSIDPVLNPSMWNLLAFLGSGLELAVRFPLETVLRRAQIATYTSPSIR
FT                   QKYAATSRSNTSAATEETSVVETIVPVPQTYRGIVGTMWGIVYEEGVSAPSSDAERVLG
FT                   KPISSRKRQGQGIGGLYRGWRIGMWGIAGIWGAGLLGSIGGGGDEEVMVSGGRF"
FT   CDS_pept        complement(1042978..1044453)
FT                   /codon_start=1
FT                   /gene_family="HOG000159695" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904718"
FT                   /orf_name="AFUA_5G03920"
FT                   /product="BZIP transcription factor HapX "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85914.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG055702"
FT                   /db_xref="HOGENOM:HBG334123"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR018287"
FT                   /db_xref="UniParc:UPI000051FED2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WER3"
FT                   /transl_table=1
FT                   /translation="MSTPSIAPAPAPLVPALAAKPAISPSPGPGTPGSITSKEWVIPPR
FT                   PKPGRKPATDTPPTKRKAQNRAAQRAFRERRAARVNELEEQIKKIEDEHEIHIAAFKEQ
FT                   ITNLSREVEQCRSEMTWWRDRCHALEKEVSVERSAKEAIVKEFRSSLSDREAVRSDKGL
FT                   APLTTSTPQARSSDRPDNGDASNNDSGEGREEVPLGCNDCSTSHCQCIEDAFTMPGVVA
FT                   QEQSRRLDTTKPGLSEPQIKPDPEEMEIDFTSRFAATQQQDQSPTSVSSPAVDPCGFCS
FT                   DGTPCICAEMAAQEEQRPRRNSFENNRLAPIQNLSQFTPPPSDGDVRSDVTLPPISQAT
FT                   NPCANGPGTCAQCLADPRRTLFCKTLAASRSPSAAPSGCCGGKGADGGCCQSRNTNVSR
FT                   GRSGSNNNTSSGSSAAPSLTLSCADAYTTLSRHPNFSRATDELSTWLPKLHTLPKPRDF
FT                   PLTDRGVPRAALEVEAASVMGVLRYFDRRFADK"
FT   CDS_pept        join(complement(1047780..1047945),
FT                   complement(1047619..1047714),complement(1047317..1047544),
FT                   complement(1046668..1047245),complement(1046331..1046609))
FT                   /codon_start=1
FT                   /gene_family="HOG000294694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752559"
FT                   /orf_name="AFUA_5G03930"
FT                   /product="Alcohol dehydrogenase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85913.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51CC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WER4"
FT                   /transl_table=1
FT                   /translation="MAASQAAGLVEKVIGHGDNAAVTTDVSNYSKNDYGQETGARIKAT
FT                   TWQGKNSIQVVEMPKPRVIDEADVIVKVTGSTICGSDLHLYHGVIPELEKGDVLGHEFC
FT                   GIVESVGPGVKSIKTGDRVVAAFPIACGNCMNCKKQLTSACERTNSNSIANALYGKRTA
FT                   GMFGYSHFTAGFAGGQAEYVRVPEGDVNLLQLPDDVPFEKGLYLSDVLATSYHCVTDTG
FT                   VDKGDVVAIWGAGPIGQMCAKFSFDQGASRVILIDGGEGAWRLDFVKSKIPKVETLDFT
FT                   NLPKGESVTSGLKKRVHGGPDVALECAAGEYAKGWLHYFETLLGMETDTSEILNEMITS
FT                   VRPFGRVGVTGVYAGYTNHFNVGAMMQTGVRLIGNGQAPVQKYWKHLLELIRKGEINPL
FT                   DMVTHRMRLEDMEKVYALFDKREEGMQKIFVQTRFSAPPAAGSPSLTVL"
FT   CDS_pept        join(1049449..1049544,1049600..1050241,1050306..1050908)
FT                   /codon_start=1
FT                   /gene_family="HOG000158769" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904719"
FT                   /orf_name="AFUA_5G03940"
FT                   /product="Alpha-1,3-glucanase, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /protein_id="EAL85912.1"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="HOGENOM:HBG051622"
FT                   /db_xref="HOGENOM:HBG332366"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniParc:UPI000051EDD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WER5"
FT                   /transl_table=1
FT                   /translation="MILTYLVLMLLAVSSVVCQYPVEEQRVFAHFIVGNAAAMTPAQWE
FT                   ADIIEAQKAHIDGFALNIAPQDNYTDRVLQVAYDAAERVGNFSLFLSFDYLSGGPWPAD
FT                   RVVKTINAFKDRPAQFYFRGKPLVSTFEGAGNTGDWPNIKAATGCMFIPCWTSLGPTGI
FT                   VDVLDIIDGAFSWDAWPVGARDKDTASDEAWMKALAGKPYMLPVAPWFYTNLPQWHKNW
FT                   LWRGDDLWHYRWRQIMDLQPPIVQILSWNDYGEAHYIGPIHEEGVPEGALPYVSRHPHD
FT                   AWRTFLPHYIDAYRRNSPICQQSSCRFSTLSKTQYPISFADKIVYWYRLNPGGSGSADG
FT                   TTGNNPAMGQPAMPPQELAQDRVFVSAFVPEPSHVYVQIGEHPPTILRAQASVINHFSV
FT                   PFNGQTGRVKFAIVRDHEEKASAVGPAITDQCIHNKVDWNAYVGSSD"
FT   CDS_pept        complement(1051419..1054046)
FT                   /codon_start=1
FT                   /gene_family="HOG000216949" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270551"
FT                   /orf_name="AFUA_5G03950"
FT                   /product="Protein kinase, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85911.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG055679"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00005205A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WER6"
FT                   /transl_table=1
FT                   /translation="MSETLHNSESSDGTGDQTGPGILTVKLGWAYGLRLPVPDPTMCER
FT                   WRPYAIGEYEGLQLSTEAMAVYAAKGAVSWAAGHRPFEFEVSASPASELTVSLFVRDSG
FT                   SDASSSSSSAGEYENQCIPLGLIRLNPFLISPGRQKVDVQDGTGRVEVEVSYTQKEVPP
FT                   LETREVWSVRREHGAGDPDLIYVEKKDTGRSYGLKAVDICTAHAGVAESDADTDVVNIA
FT                   PSLSFRSAIQHPFIAPLKFAFRSSEGILDLLSPLASGGYLFDHLQRERQFDVDKARFYA
FT                   AELVCILEYLHEDKHIILHSLEPENILLDSSGHVSLCKPGLFALELGDGDHILPGTPKY
FT                   PAPEALLDDRKASRAVDWWALGIILYEMLMGIPPFYHKDGGERRRKILGQDLQLRENLP
FT                   STARDILTKLLDKDPIERLGANGAAEVKAHPFFHGVKWHECLQRKYTTPFKPYDAAVIF
FT                   WREPCTYQPFKRPEREQRELEGEVYEQIGTSEFPLWRPIGSVNDQSKRHAADKNASVSP
FT                   SRGADDDNNDDGWEFMWEPTKQEFYFKNRFTDERVTAKPKAAVWDKMLPPAVEHEALAA
FT                   ALEAGYSQHVFSEILKHRPDLNVRILDYDQTPDDYAIRPEIRDIIPVTPLEWAIEHERL
FT                   DLVNLFLENGADASFTISPRDGPALLKAVKRKSQRLVEILVQKTDRVSCTRALALAVEQ
FT                   QDITTANTLLTQGVRCDFGESDRPLPAHPFFGDYESNLSRGLEAEDLTPPLVRAARLGN
FT                   VALVALLLEHGADANTAYHDLGGRRRDGYGCETRDSTIPASFSCGRVVQIAMEMGHCEI
FT                   VHLLVDAGADIALPHPVWPRPVWPVPGHICQPVPRAVYVEVRAGLLAAVAARRGKRIET
FT                   FGGA"
FT   CDS_pept        join(complement(1056051..1059015),
FT                   complement(1055763..1055895),complement(1055379..1055689),
FT                   complement(1054435..1055300))
FT                   /codon_start=1
FT                   /gene_family="HOG000216947" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270552"
FT                   /orf_name="AFUA_5G03960"
FT                   /product="Class V chitinase Chi100 "
FT                   /EC_number="3.2.1.14"
FT                   /function="cation binding"
FT                   /function="chitin binding"
FT                   /function="chitinase activity"
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="EAL85910.2"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0008061"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI0000F51C7B"
FT                   /db_xref="UniProtKB/TrEMBL:A4GYY9"
FT                   /transl_table=1
FT                   /translation="MRLPSLAAAVPLAAVWASSDPLAFSSTANDAVNAFLASLSVSTVS
FT                   KTVAGSPTDLASARAAVLAGNYTSRLHHQGRDRCPVGCSSAGVDTSAWFVYGSLDRLDR
FT                   ACNRSMLLDFALVNPIDDEKSHVAISACTADYAGLSDNNAPASSGSACALKGVALTKTT
FT                   LSLQLASSGASSSTHAADVAAALEQLRAFATLSDTGCNETIKYAYSRDVVVGVYAGSGL
FT                   AGQGVLGAVLQKLSAQVKDDGGVAERLSVEMCRNVSSRYSLGVLVNTKGDLGAVQRGLQ
FT                   ASKNGHCVSTETRTTGSDWQTLTYLVPAATNITRPTNNSTKLVSTRATECRTIQVESGD
FT                   SCASLATECGITPAQFTQYNPSSSLCSSLTPGKHVCCTAGTLPDFTPQPGADGYCYSYL
FT                   VKTGDSCASLAAAYDLTNEEIESFNKETWGWNGCEKLFADYNICLSTGYPPMPAPIANA
FT                   VCGPQVNDTAKAPPGTDLSTLNQCPLNACCNIWGQCGTTGDFCTPSNSSTGAPGTAAPG
FT                   QNGCISNCGMDIITSSAPAETYSIAYFEAFSWKRSCLRMSVTSIDTSAYTHIHYSFITL
FT                   NEDLSINIDEVADQLPLFKGMVGIKKIVSVGGWAFSTEPATYQIFRNAVATQANRKTLV
FT                   SNIIRFLDDYSLDGVDWDWEYPAEPDIPGIPAGTEADTTGFFLLLNELKQEMPAGKTVS
FT                   VTAPASFWYLQYFPIEALSLVVDYVVYMTYDLHGQWDYINKYATPGCPSYDQGLGNCLR
FT                   SHVNLTETINSLSMITKAGVPSNMIVVGVSSYGRSFKMSTPGCWTEQCTYTGPDSGAYP
FT                   GRCTNTSGYIADYEIREIIRQNPTVQELWDASSYSNIVVFNDTEWVAYMDEDNKATRKA
FT                   LYPGLAFLGTADWAVDLQSETGGGSGSNPNSSSGGTIYVNPDIWNSAAPVVTAPPGASL
FT                   IWPPMPLSTPTTITFPPWTTTISYSSLTTRTSTLSDGTTSTYPAYVYESWLTVITIPPL
FT                   TTTAIDVWGVSLPSSASSSSTGGPVPIILTSSVQPPPFTVTVTPVISGTTSIIGATETT
FT                   TLSLDPIIWGSSTYSPPVETRSLGGSTTVIGGTTLPPTPITVTPNPHPTTTPDPGSTDP
FT                   ALNSKKPSWTPGKPPTPTAEPGCPGCGTRCLLFCNPDCPFCPPGAFGPPGGGGGDNNNN
FT                   DDDDDDDEDPDHEGAQYTIVFDSMNDDPFPTAFVGAADLSSVDAEVMSRVSSAWGLSTT
FT                   TTTTTTTTTKPTTTTTTEKPTPTPTADCMFWDSIFYYTFEIYNIDGWVSDGGDSLHDEE
FT                   GGCGALTGWEWHEESSDHYAYVYFNLPFFMKAGCVERAIVSAGGPKISCQGGGVGPTKR
FT                   EVNVDVDFDIEDEDEDVWISLDARGNGKTLDTPVFPSWTNEQLQEFQTFYEAINMQSGT
FT                   AEKTYVPMTWGGTSTSPMTTSA"
FT   CDS_pept        join(complement(1061837..1061902),
FT                   complement(1061259..1061775),complement(1060580..1061194),
FT                   complement(1060308..1060492))
FT                   /codon_start=1
FT                   /gene_family="HOG000216946" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057969"
FT                   /orf_name="AFUA_5G03970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85909.2"
FT                   /db_xref="HOGENOM:HBG055662"
FT                   /db_xref="UniParc:UPI0000F51CB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WER8"
FT                   /transl_table=1
FT                   /translation="MARRVNFGKKNIDRCSPGRRFMTDTYPRSYNALFRLFPFYFGDNL
FT                   VYLAFPQHNMRWSLAGLLPSLCLVVLTNTSPLGHQSAYDIEGVDSLNALVRRVRTGPGG
FT                   GTVTTPKKTTDLFLLDSGPGGCVGKEAILDNWLTEVFLLHDAIKTAYANIQGDRSWMLM
FT                   WYTWFGVQLNMQTGGVDVSDAANKQLWDTIGDHISRVTKFLSGAGLPNPQVAGENPRLF
FT                   CGPEAGEHQPWSESVVKDHNGQDVVTERDPETQQPTEYLKLGTAFLNTARDPDANAFWF
FT                   SSFKGYDLDFSGETSLCAGNRFAKTARPASSWPVIFSDGADFTFGRANRHILFCPRSFS
FT                   PPTGFHSYPSLTKAVEEDNYPTAGLKDENESLDKMMPVSSTLYHELYHLTDDDNTKDQA
FT                   YSLDRVIRNARDSSKREGNSHNPETYTLFATAAYLYLNAPQAEEPCLYISGFPKKASDP
FT                   FA"
FT   CDS_pept        1062766..1063902
FT                   /codon_start=1
FT                   /gene_family="HOG000164686" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270553"
FT                   /orf_name="AFUA_5G03980"
FT                   /product="LysM domain protein, putative "
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="EAL85908.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="HOGENOM:HBG055654"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI000051F528"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WER9"
FT                   /transl_table=1
FT                   /translation="MMKSIRFLASALALCLVDAYLVTPPGTPAPGAASACSAWVQASYG
FT                   LTCDIIHRFYGMTAAEFEEWVSKCPAAQLYPLNYICTDSAKNPSVSQLGDGCTLISGLY
FT                   YCVQVNYITQSPTWTPPTTTTRSTSSSAGNGVTTPTPTQTGMVSSCNRFYLVVSGDSCY
FT                   DIAAAQGISLDNFYTWNPAVGSSCGGLWPDYYVCVGVISDGTTTTTTTTTTPTTTSTTT
FT                   TTAGNGVTTPTPIQTGMVTNCNKFYQVVSGDGCYDIAAAAGIALNDFYTWNPAVGNTCA
FT                   GLWPDYYVCVGIIGSSGTTTTKTTTTTTSGNGVATPTPTQSGMVSNCKKFYLVVSGDGC
FT                   YDIAAAAGIALSDFYAWNPAVGDTCAGLWPNYYVCVGI"
FT   CDS_pept        1064415..1065965
FT                   /codon_start=1
FT                   /gene_family="HOG000253244" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18209283"
FT                   /orf_name="AFUA_5G03990"
FT                   /product="Vacuolar aspartyl aminopeptidase Lap4, putative "
FT                   /function="aminopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="vacuole"
FT                   /protein_id="EAL85907.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG011112"
FT                   /db_xref="HOGENOM:HBG630643"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="UniParc:UPI000051F2C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WES0"
FT                   /transl_table=1
FT                   /translation="MTKKSVFDLHDSNMAYRLSGQLRGPTTPVCAPSTAPSQTTTTTSF
FT                   SPADYAQPFCDFMTAHPTIFHAVDGFTKELESKGYKRLPEREAWTSKLQRGGKYYCTRN
FT                   GSAFIAFSVGKNYQSGNGLAIVAGHIDALTARLKPVSKLPTKAGFVQLGVAPYAGGLNE
FT                   TWWDRDLSIGGRVLVRDPTSGKVESKLVKLDWPIARIPTLAPHFGAPSQGPFNKETQMV
FT                   PIVGIDNSDLFQQQVSPTAHSSSGIKPGSFAATQPERLVKIISKELGITDYDTILSWEL
FT                   ELYDSQPARLGGLEKDLIFAGRIDDKLCCYAAQQALLASSDDTSTGSIKMVGMFDDEEI
FT                   GSLLRQGARSNFMSSVIERITEAFASSNYGPNLLSQTVANSFFVSSDVIHAVNPNFLNV
FT                   YLENHAPRLNVGVAVSADPNGHMTTDSVSYSFIKRVADRCGSTLQVFQIRNDSRSGGTI
FT                   GPMTSARIGMRAIDVGIPQLSMHSIRATTGSLDPGLGVKLFKGFFDHFEEVDKEFADF"
FT   CDS_pept        join(1066836..1067627,1067701..1068216)
FT                   /codon_start=1
FT                   /gene_family="HOG000159692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270554"
FT                   /orf_name="AFUA_5G04000"
FT                   /product="Proteasome maturation ans ribosome synthesis
FT                   protein Nop10, putative"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="EAL85906.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="HOGENOM:HBG347991"
FT                   /db_xref="HOGENOM:HBG379306"
FT                   /db_xref="InterPro:IPR014881"
FT                   /db_xref="InterPro:IPR017117"
FT                   /db_xref="UniParc:UPI000051EB98"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WES1"
FT                   /transl_table=1
FT                   /translation="MADSSTPTKPVHTIILDAGPILKNTPPLSTLLTQCEELLITPSVV
FT                   REIRDPDARLRVETLYLPFLKQRTPSPKSVSVISEFARKTGDRAVLSKTDLEVLALAYE
FT                   VECERNGGDWRLRSTPGQKQLNGKPPVKEEEKKVEEPEQANITETTADTTETAVAADAT
FT                   ATSKVPQVDEVAEDLSKTTLENDNTAAEEPAQSTEDVEIPETAQADDAETGGEDDDGSD
FT                   SDGGWITPSNLKKRQALDESISASAAPEPKVMQVATMTTDFACQNVLLQMNLNLLSTTT
FT                   LQRIRHLKSFIKRCHGCFFTTKDMTKQFCPRCGKDTLTRVSCTTDANGQFKMHLKKNMQ
FT                   WNNRGNRYSIPKPTHGSASGKWKGGGGKDGWGRELILAEDQKEYIRASVEESRRLRKER
FT                   DLMDEDYLPGILTGERTKHGGRPKVGAGRNVNARRR"
FT   CDS_pept        1069882..1071336
FT                   /codon_start=1
FT                   /gene_family="HOG000159660" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209284"
FT                   /orf_name="AFUA_5G04010"
FT                   /product="TRNA-splicing endonuclease subunit Sen2, putative"
FT                   /EC_number="3.1.27.9"
FT                   /function="nucleic acid binding"
FT                   /function="tRNA-intron endonuclease activity"
FT                   /biological_process="tRNA splicing, via endonucleolytic
FT                   cleavage and ligation"
FT                   /cellular_component="tRNA-intron endonuclease complex "
FT                   /protein_id="EAL85905.1"
FT                   /db_xref="GO:0000213"
FT                   /db_xref="GO:0000214"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0006388"
FT                   /db_xref="HOGENOM:HBG055635"
FT                   /db_xref="HOGENOM:HBG397103"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016589"
FT                   /db_xref="UniParc:UPI000051F7B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WES2"
FT                   /transl_table=1
FT                   /translation="MASSSRSLPSSPAGLVESPSKSMSPNNARPAHRARPPKPNYKHIH
FT                   RFPLPLDVHPLPPLIPHNPLSLISVVLSYLTYFISPPHQETYAAYFDSATSSVHVTDHK
FT                   AIQALWEMGFFGKGTLSRSQPSWLEREKKRRGLLGGQTNEELTRQRRTERRELKLERAR
FT                   MEKVAIEKRLKAEAAARESGATTVDQTTATLLTDVASGGTAVTLEKFSLRKAREARMLE
FT                   SRRSKEQENKEPASPSSGQESPSKAVRFSPVVQEKEFASDSATLRLPGLATEAQETSQE
FT                   ELPLKNEEHLQLSNEEAFFLAYGLGVLHVYDHQQKTIIPHTSLLSLFCHNSYYPPRDPS
FT                   TDLKPDDPFMISYIVYHHFRSLGWVVRSGVKFGVDYLLYNRGPVFSHAEFAVVVIPAYE
FT                   HSYWSETSDRRSYCATKQARSWWWLHCVNRVQAQVKKSLVVCYVEVPPPRSHDSKTHSE
FT                   DIGALLSRYRVREMLIRRWVPNRTRD"
FT   CDS_pept        1072173..1076189
FT                   /codon_start=1
FT                   /gene_family="HOG000159649" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057970"
FT                   /orf_name="AFUA_5G04020"
FT                   /product="DNA damage repair protein (Rad9), putative "
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85904.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG055632"
FT                   /db_xref="HOGENOM:HBG334117"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR013914"
FT                   /db_xref="UniParc:UPI000051F05F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WES3"
FT                   /transl_table=1
FT                   /translation="MSSADGVPSDTQVVSQSVFDDMIRQNKNAARNASDSNLVERATMM
FT                   TLHEGDSGHVDLLSGFENTCPDIIDAEDNGEQNSSRLGESSPLHYQPNLFPESQRFLTS
FT                   TPATAFKLGQPERSNSETPCVPKNPLPSDIQSSGGVMALSQVFKATQAPSSPLVYGQQP
FT                   DLMSDRPSPNLPIQNHPLAAVLSSPLNALAATFPQDRSETPMAYISMKESQARRDRLLQ
FT                   ERMTRSAEHIYAEDQSDSEFEKEPSFVERIIRQRTIDQEASAQFAGVAAPARQSSRRRT
FT                   GEETTSSLSELKQRDQADVLKSPTSRVDPNKIDAVLQSGAISEAETEHSGDLTRSQPTQ
FT                   QVPSLSTDEDKENCNNDSEHCLPITASAHDRLSQALSLHDDSLAQEDIQLSRSPDREAN
FT                   EPKATLETMVVKDSQQSPRQEDRGHHDKIVTNSLRHHSGRPRPRVRYHGDPSDRDRVIS
FT                   SPTRPLALRSSPPPPECVQDPVLHPAHLNRAITRSQSSSPNCHDSSSQLPRDASSAQEL
FT                   ATTESSNVASRKPNGTESKGARVDPHEKPSSMPSRVTETPVPQRPRGFGDVIPTMSVPE
FT                   TSPNTIHNQSWADDVDNDPMDQEDDDLPPTYPTEQARISHSQPLIPESSTPTRPFRTAK
FT                   ILSSPSGRQRRALTEIAADASPQAGTTLIDVDIGILTADDKEFSSVVSASPIPPRKKRR
FT                   GNGQNVYASDPILTFTPRITSQYAQSQNGEKPRGQILQTEEFVDKSESSFLKRSRSSKR
FT                   IGTVWEVEDTPQHHVSRRERLKKLSLPRAEAESGPQPLERAKNMNLHAAEREDPCEGSL
FT                   KFPQATGEKMKDKSPELLRNDESDPAGPGHRDSSPIALNQVIAPWSGQKRAYYPATCVG
FT                   KPPGISQTRVLVKFEDSAPLEVPMGAVKRLELKIGDAVKVDMPHVPKVTHIIRGFEDKI
FT                   SAEDLTKAASDGVLPITDVYGYTTLILGPKQRKSLPSGGLTGPDNLIKVPVSRIYLDTI
FT                   LWNQLKDRAFTYSSGATHSESRLQTPSDRYSTPASPGSRLPRSIRLMNGIFAGMVFAVS
FT                   YGDNDEAKSRITKMILDNDGSILKDGFNELFELPSHPPLTTPTKSAAPGTNCDNGQFRL
FT                   APTAEEVGFACLIADKHSRRPKYMQALALNIPCLSDRWIEDCIAQNRILDWEIYLLPSG
FT                   ESIYLNGATKSRFLAPYPATTARLPDTIASRPNLLKDQSVLLVMGRGGRSDEERRKAYI
FT                   FLTYALGASRVERVSDLKSARASLDQQAAAGTGCAWDWIYVDGDEMASAKATILGSSMP
FT                   STLKSQSFKGTKKRKRTELIEFIDGSDLGLSTSVKIVGNEFVCQSLILGRLFGQ"
FT   CDS_pept        complement(1076636..1077523)
FT                   /codon_start=1
FT                   /gene_family="HOG000159638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057971"
FT                   /orf_name="AFUA_5G04030"
FT                   /product="50S ribosomal protein L27, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85903.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG055621"
FT                   /db_xref="HOGENOM:HBG334116"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniParc:UPI000052057E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WES4"
FT                   /transl_table=1
FT                   /translation="MSFRSPRRLGIGVTPLSVQPTMLQPRLLAPFRALERTFVSSLRSS
FT                   QAIHHPPRSSLLFQRTPISAPSPISKFLLPLSHVRHASHATQGTANRHSRDPAGKRLGA
FT                   KRTGGEYVVPGCIIFRQRGTKWFPGENCAMGRDHTIYATEAGYVRYYLDPERHPDRKYI
FT                   GVCFEKDGKLPTPRNAPTKRRLNRIAVPRIPDGPEVVAQSDLLATVEEGTMISSVVAAN
FT                   ATTGPPLRPGYMYREANWQIGRAAEKAGITAKPYKRKNRWLAWRKRQARAERAAQMKSL
FT                   KSKKKAAKKGKGGR"
FT   CDS_pept        join(1077704..1077878,1077959..1078152)
FT                   /codon_start=1
FT                   /gene_family="HOG000159627" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752560"
FT                   /orf_name="AFUA_5G04040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85902.1"
FT                   /db_xref="HOGENOM:HBG055610"
FT                   /db_xref="HOGENOM:HBG334115"
FT                   /db_xref="UniParc:UPI000051E715"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WES5"
FT                   /transl_table=1
FT                   /translation="MLSSWVRCLGALLFLASVAQAQFQFFEHMFGGGHQEHHQQNTQNS
FT                   ASDSARYQQLWEGTNCNKYLCPGTLACVDFPHHCPCAHPNVEDKVELGEGSAVCISKGG
FT                   YKPGEAARKIELARKGLL"
FT   CDS_pept        join(1078688..1079046,1079102..1079273,1079332..1080426)
FT                   /codon_start=1
FT                   /gene_family="HOG000159616" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209285"
FT                   /orf_name="AFUA_5G04050"
FT                   /product="Scramblase family protein "
FT                   /protein_id="EAL85901.2"
FT                   /db_xref="HOGENOM:HBG055602"
FT                   /db_xref="HOGENOM:HBG397434"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="UniParc:UPI0000F51C5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WES6"
FT                   /transl_table=1
FT                   /translation="MWSSRLRTPLTGLVAAPGRAFASSFTRGRRSPRVARDVARRLRPV
FT                   AHNRGALSPQQFEPTATESNRPTPNYDPAQNTLLSPVHIPEDPNGVLKETHPAMGILAN
FT                   SGLVIQRQLELMNVMIGFEQANKYVIMDANGNHIGYMAEQEKGMANMMARQWFRTHRSF
FT                   VTHVFDRHENEVLRFHRPFSWINSRIRVYDPLDVAKSAFSSSTAVQTASSGSLVQATGT
FT                   SNARISPLGLEDMRVIGEAQQQWAPLRRKYNLFTYHHSPLSATEMGTQRLPLSQTGLSN
FT                   SQQMQLTQTNASGQDVGEYHQFAYVDEPFLSWDFSLRSADNRLIGSVNRNFVGFARELF
FT                   TDTGVYALRMDSAALGSEDLTTRTNAPTGMTLDQRAVMLATAVSIDFDYFSRHSGAGGF
FT                   GFMPIWFPGIGGEAAAGGAAAGGAAAGEAGAVGEAAAGTIGRAGAAEGIAEGAAAGAAG
FT                   AGAMAGYDALSRGMAGDSNSQHPPPPEQQPYSADQQSSVSGQAGPYGDVWAEEQEDPFA
FT                   RAPEDPWNIEEPDDEGEEGDNDWF"
FT   CDS_pept        join(1081043..1081289,1081365..1081618)
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270555"
FT                   /orf_name="AFUA_5G04060"
FT                   /product="Ubiquitin conjugating enzyme (UbcH), putative "
FT                   /EC_number="6.3.2.19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="EAL85900.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000051FED1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WES7"
FT                   /transl_table=1
FT                   /translation="MSSVAQKRLFHEYKNLSTNPPEGITAGPVSEDDMFHWEALIQGPE
FT                   GTPYEGGVFAAELKFPKDYPLSPPTMKFVGGGVWHPNVYPNGTVCISILHPPGDDPNHY
FT                   EHASERWSPIQSVEKILISVMSMLAEPNDESPANVEAAKMWRERRSEYERKVRDEVRKG
FT                   LGL"
FT   CDS_pept        join(complement(1083261..1083591),
FT                   complement(1083144..1083210),complement(1082979..1083087),
FT                   complement(1082831..1082920),complement(1082696..1082725),
FT                   complement(1082565..1082630),complement(1082034..1082507))
FT                   /codon_start=1
FT                   /gene_family="HOG000216945" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270556"
FT                   /orf_name="AFUA_5G04070"
FT                   /product="Meiosis-specific topoisomerase Spo11, putative "
FT                   /EC_number="5.99.1.3"
FT                   /function="ATP binding"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /biological_process="DNA metabolic process"
FT                   /cellular_component="chromosome"
FT                   /protein_id="EAL85899.2"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="HOGENOM:HBG055587"
FT                   /db_xref="HOGENOM:HBG324968"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013048"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="UniParc:UPI0000F51C76"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WES8"
FT                   /transl_table=1
FT                   /translation="MYRHIVVDNEQNREAMENAPDNAGSSPARFFTNQEQSQKERVQTF
FT                   IDNILIEILDELRTPDGRPTLTLKRRSRGVPRSINPENLALESEEKEILSSYSWPGTNA
FT                   YEAWKFTAIIRGLSVIAEAIQAGLVVSKRDIYYSDPACFGSQQIVDTIIDDIAHTIGVD
FT                   RAALNVEAVAKGLVAGYYRLMTKTGEMVDARLSTKVVKWVLILEKEAVYRRLSRSSYHT
FT                   RAAAGKGVLGKGYPDLSTRAFVRRLLDETRHLPAEESPRFYALVDSDPDGMAIMSTYKY
FT                   GSMAHAHDNEKLNVSKLCWLGLRTSDVIGSADSFGDEAFIRLSLRDRKKAVAMLSNNPV
FT                   WAEDGPEQEWRAELQQMLMLNLKAEIEILYNRQEGLEGWINKKMTLPS"
FT   CDS_pept        join(1084167..1084421,1084444..1084907,1084972..1086417,
FT                   1086474..1086564)
FT                   /codon_start=1
FT                   /gene_family="HOG000234317" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270557"
FT                   /orf_name="AFUA_5G04080"
FT                   /product="Oxidosqualene:lanosterol cyclase "
FT                   /function="intramolecular transferase activity "
FT                   /protein_id="EAL85898.1"
FT                   /db_xref="GO:0016866"
FT                   /db_xref="HOGENOM:HBG433946"
FT                   /db_xref="HOGENOM:HBG750669"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR002365"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR018333"
FT                   /db_xref="UniParc:UPI000051FED0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WES9"
FT                   /transl_table=1
FT                   /translation="MTGGPIASWRTAAQGHLTPDENGDLKTDYSRWRLLDDRGRQTWHY
FT                   LESDEENEKWPQSVADKHFLGLPTVTPLAPAATNRMFAIHELPELPKAKTPLQCAENGL
FT                   EFFSKLQLPPGNWACEYGGPMFLLPGLIITYYVTNTPIPPEYATEIKRYLFARQHPEDG
FT                   GWGLHIEAHSSVFGTCMNYVALRLIGVSEDDPRMIKARGLLHKFGGAIYGPHWAKFWLS
FT                   VLGVMEWECVNPVPPELWLLPDWVPFTPWRWWIHIRQVFLPMSYLWSKKFTHPLDPLTK
FT                   QLRQELYTQPYDSISFANHRNSIHAADNYYPKTWLLNLINQLLVSVWNPYFRIPALVKR
FT                   AEEWTWELIRMEDENTDYAGLGPVSNPMNMVACYLHDGPDSYSVRRHRERLNDYMWMKN
FT                   EGMLMNGTNGVQVWDTAFITQAIVVAGFADDPKWRPMLTKALEFLEDHQLRENVPDQEK
FT                   CYRQHRKGAWPFSNKTQGYTVSDCTAEGLRSTIQLQEMHNYPRLISVERLKDSVDCLLL
FT                   MQNPSGGFTEYETTRGSEKLEWLNAAEVFGGIMIGYDYPECTTASVTALSLFSRFYPDY
FT                   RADEIKAAKDKAVKYIKRVQRPDGSWYGSWGICFTYAAMFALESLASVGETYETSEYAR
FT                   RGCEFLLSKQKEDGGWGESYLSSEKHVYVQHEKSQVVQTAWACLALMEAEYPHKEPLQK
FT                   AMKLLMSRQQPNGEWLQESIEGVFNQSCMISYPNYKFYWPIRALGLYSRKFGNEELM"
FT   CDS_pept        join(1087047..1087898,1087979..1088563)
FT                   /codon_start=1
FT                   /gene_family="HOG000159594" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209286"
FT                   /orf_name="AFUA_5G04090"
FT                   /product="SGT1 and CS domain protein "
FT                   /function="binding"
FT                   /protein_id="EAL85897.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG055569"
FT                   /db_xref="HOGENOM:HBG334135"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR007699"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="UniParc:UPI000051F05E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WET0"
FT                   /transl_table=1
FT                   /translation="MNAAAEGDKALANSDCPTAIRYYTQALTELPRAPAYYIKRSTALS
FT                   RLKPADGGPNFQAALQDAEIALTLARERAKRELILSAQMRRGIVLYQLERYGDAAFVFS
FT                   TIQDKIGTTTEGQDRSEKVKDAMAGGGTARSSTKKGYEQELPIWILKVKGKLSKLAEGD
FT                   EKARVTIEEFPKGVSIPSEKDLKKQFDAFKAGKVEEASAQAQATSADDKAADSTKTCTP
FT                   TTESQATIGKAPPAMSTTSPPTGPSIEKVRHEWYQSHDSVVVTLYVKGVPKDRVDTELK
FT                   DESAAIQFPLPSGADYAFTLDPLFAPIDPSASKVSVMSTKIELVLRKKTAGQKWGALEA
FT                   SSSSAKLADRQAIIGATPAAESGPSYPTSSRRGAKDWDKVASALTAKKSKGKGKERSAE
FT                   KDAKAGDDSGDDSDGADSIDSDYGTGDPVDAFFKKLYANADPDTRRAMVKSYVESQGTS
FT                   LSTNWKEVSQGKVEARPPSD"
FT   CDS_pept        join(complement(1090150..1090205),
FT                   complement(1088912..1090031))
FT                   /codon_start=1
FT                   /gene_family="HOG000159593" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270558"
FT                   /orf_name="AFUA_5G04100"
FT                   /product="PQ loop repeat protein"
FT                   /protein_id="EAL85896.1"
FT                   /db_xref="HOGENOM:HBG113700"
FT                   /db_xref="HOGENOM:HBG736343"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI000051E494"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WET1"
FT                   /transl_table=1
FT                   /translation="MFPSQAGNLDLDALSGICGSISIACWVVVFSPQIIENFRRGSADG
FT                   LSLLFLVVWLAGDVFNILGAVLQGVLPTMIILAVYYTLADIVLLGQCFYYRGFTLRDKL
FT                   SNPTSPADINSEEEPSQTRKATEHTSLLPPKSNGHSHHVLAQEPHYQSGQAGPAAAATT
FT                   SQVRPLPSHPDHRRHSATSFREIIHLNVDGTHLSPATPFIEPTSKEYLSARRISTLQTV
FT                   LFNLTTIALVCAAGVLGWYVSPSSSKNEESDLPGDDRDSSSLTFDTVGQVFGYLCAALY
FT                   LGSRLPQILLNYRRKSTEGVSLLFFLFACIGNLTYVLSILAYSPVCKRHSHHPHDCRPG
FT                   EAAALYGRYVLVNLSWLIGSFGTLLLDMCIFIQFFLYKENGDGIDGSSACD"
FT   mobile_element  complement(1090851..1092368)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        1092632..1093777
FT                   /codon_start=1
FT                   /gene_family="HOG000085953" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270559"
FT                   /orf_name="AFUA_5G04120"
FT                   /product="SIR2 family histone deacetylase, putative "
FT                   /function="NAD binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="EAL85894.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG055545"
FT                   /db_xref="HOGENOM:HBG641281"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI000051FA17"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WET3"
FT                   /transl_table=1
FT                   /translation="MTKPSIRIPLTGPLPPPIIVPPSASTLSGAINAVLSFFTAPPSPY
FT                   LSGVDVGRHSQAVLLTGAGISVASGLSDYRGEKGTYVTNKFYRPIYFHEFLSRHESRKR
FT                   YWARSFVGWPGLLKAEPNSTHWAIRDLAAKGFVSSVVTQNVDSFHSIAHPELPTIELHG
FT                   HLKSVVCTSCRNQFSRAEFQKSLERLNPAWAEFLARMVEAGALDTNNPEEQRRKGFKLN
FT                   PDGDVDLAEAPYSTFRYPSCPTCLENPPRLKDGTLARVEVEKDGAWLPSSTAGILKPAV
FT                   VMFGENIDPGVKTAAEEAIDDAGRLLILGSSLATYSAWRLVERAHRRGMPIAIINLGGV
FT                   RNESVLFETSSDVSSSHVRCSFPSEAILPPVVSLLPKSIYG"
FT   CDS_pept        join(1094146..1094376,1094452..1094475,1094557..1095471)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270560"
FT                   /orf_name="AFUA_5G04130"
FT                   /product="Cyclin-dependent protein kinase PhoA "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85893.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051E49A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WET4"
FT                   /transl_table=1
FT                   /translation="MDYRNSYRTAEDSRSEYNNPASFSEIVSTLVSPKSFLFNNQRPKP
FT                   STQQTSITTRGNISSQTMDKSQQPSSFQQLEKLGEGTYATVFKGRNRQTGELVALKEIH
FT                   LDSEEGTPSTAIREISLMKELKHESIVSLYDVIHTENKLMLVFEYMDKDLKKYMDTRGD
FT                   RGQLDHATIKSFMHQLLKGIAFCHENRVLHRDLKPQNLLINKKGQLKLGDFGLARAFGI
FT                   PVNTFSNEVVTLWYRAPDVLLGSRTYNTSIDIWSAGCIMAELYTGRPLFPGTTNEDQLQ
FT                   KIFRLMGTPSERSWPGISQLPEYKPNFHVYATQDLGLILPQIDPLGLDLLNRMLQLRPE
FT                   MRISAADALQHPWFHDLPQLQAQLQQQQQQQQQQMAGGYGGMVPPQQTY"
FT   CDS_pept        join(1097079..1097335,1097412..1097613,1097686..1098189,
FT                   1098267..1098545)
FT                   /codon_start=1
FT                   /gene_family="HOG000159571" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270561"
FT                   /orf_name="AFUA_5G04135"
FT                   /product="CAMP receptor-like protein, putative "
FT                   /function="transmembrane receptor activity"
FT                   /biological_process="cell surface receptor linked signaling
FT                   pathway"
FT                   /cellular_component="membrane"
FT                   /protein_id="EBA27250.1"
FT                   /db_xref="GO:0004888"
FT                   /db_xref="GO:0007166"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG324964"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="UniParc:UPI0000F51C8D"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA13"
FT                   /transl_table=1
FT                   /translation="MSLSPRELFAISTTERICSAISLAGTSIIIISFLSSRSFRKPINR
FT                   LVFYASWGNIMANVATMISQSGIAYGTSSCLCQFQAFLIQWFMPADALWTLAMACNVYL
FT                   TFFHKYNSEQLRQLEWKYVLFCYGLPFIPAFVYFFIETEARGKVYGSAILWCWVSLPWD
FT                   FLRIAVFYGPVWFVIFLTFAIYLRAGKVIFEKRRQLEEAECPESSGEIDSPMEPAVSKK
FT                   TEIHVTSEITHSGSESNRLSIMSASLIPHRYLSPYSPYSVTIEGGSAAGNDEHVPMRTL
FT                   RSSQHDPYAQHHAMARDVNSAAWAYTKYAMLFFIALLVTWVPSTINRLYALIYPRNFNF
FT                   GMNYTSSFVLPLQGFWNSIIYVSISWPAFKEAFAKIKWRHSLQRGPSQHIITGHGAVGS
FT                   LHSHGNDSTRALTG"
FT   CDS_pept        join(1098813..1099198,1099272..1099566)
FT                   /codon_start=1
FT                   /gene_family="HOG000159560" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270562"
FT                   /orf_name="AFUA_5G04140"
FT                   /product="MIND kinetochore complex component Nnf1, putative"
FT                   /protein_id="EBA27249.1"
FT                   /db_xref="HOGENOM:HBG324961"
FT                   /db_xref="InterPro:IPR007128"
FT                   /db_xref="UniParc:UPI0000F51C52"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA12"
FT                   /transl_table=1
FT                   /translation="MAEDAQSTNANHPRQAASPSPPPPAPVPLTPGPRASRLQQVFGQA
FT                   LARTLRANSYANFSGCFPTPAKHVPASLESVWRQLNAKLEESAKAEFDDILHERDAVRH
FT                   LNELDRLVGEARHRRDNGQGESRVAPHTLTPDELYRAHLTPYLQEAQSSLNARIQATEA
FT                   ENAELAQHIQSQRAEIERLLSSLESIVADIEGAAAAASHFSKENDLRQEAFKMDEEVKA
FT                   RSEI"
FT   CDS_pept        join(complement(1101323..1101379),
FT                   complement(1101236..1101266),complement(1101008..1101149),
FT                   complement(1099636..1100908))
FT                   /codon_start=1
FT                   /gene_family="HOG000159549" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752561"
FT                   /orf_name="AFUA_5G04150"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="EAL85891.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG055525"
FT                   /db_xref="HOGENOM:HBG324960"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0000F51C77"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WET6"
FT                   /transl_table=1
FT                   /translation="MPKRKAFLKEAKSKKAAQRAPETADEFLAAGVEQEEGGEKWRAGD
FT                   AAKSFRFFMRAIAIYDEGLQKHPQAFDLAYNKARLQYEITQHPKLAAQLPTPLLDALQI
FT                   ALQSHREALNLEQDNADALFNTAQVLTSLAEAATDTKHPSDEQLSGAIKLLQEAIELFQ
FT                   RCLMLQELRYTEMQEQLKQMESGDMGPPEEEMKQAQDAMDIAGQPDPSEPQEQWAAVIE
FT                   PVTKNTLVDTAVAQLDTLTTLSNLLTFNPGVGLAWVEEYSSDLLQRIPVYLEGSERQYE
FT                   ASLARARFVCALNELVYRSGRIEVETYHREITGAFGPDLDISTDPDGLCSKADALTSFN
FT                   TALTDLPPSHDAEAFAKSLHMRWQSLSTALDALTKASKLPDANNLPKIHMARGDVEMHR
FT                   WRLGLAPWEYAVAGQNASTLLGNAQTYYRGAAALARRDGAMEETRDGTCKEAIAAALGG
FT                   QKDKLEQLKAAAPKELTAVAQDMVEDGLLTPVEMEALLSYQS"
FT   CDS_pept        join(1103242..1103292,1103427..1103687)
FT                   /codon_start=1
FT                   /gene_family="HOG000159538" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904720"
FT                   /orf_name="AFUA_5G04155"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85890.1"
FT                   /db_xref="HOGENOM:HBG055518"
FT                   /db_xref="UniParc:UPI000051F7A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WET7"
FT                   /transl_table=1
FT                   /translation="MPRQPSLDSERPIIAKSTIGSLPSGDPRLAEFNHLRDGLERLENK
FT                   PLLKQRFVPTPEKSDNLSKLALGAKVERALGRRMTSQDAVMRKPVLDEKVATSETSAA"
FT   CDS_pept        join(1105009..1105326,1105397..1106395,1106463..1106759)
FT                   /codon_start=1
FT                   /gene_family="HOG000159527" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057972"
FT                   /orf_name="AFUA_5G04160"
FT                   /product="NTF2 and RRM domain protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85889.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG055514"
FT                   /db_xref="HOGENOM:HBG334138"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniParc:UPI000051F7A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WET8"
FT                   /transl_table=1
FT                   /translation="MSDTTQPPMNGNYPAQHAYPDSYNHAHTAVTSVSNFQPAQSSTPT
FT                   NAPPNDQKNGISKDEVGWYFVEQYYTNMSRSPEKLHLFYSRRSQLVFGTEAESVPVAVG
FT                   QKAINEKFKQLDFQDCKVRVLNVDSQASFDNILISVIGEISNKSEPSRKFVQTFVLAEQ
FT                   PNGYYVLNDIFRYLVDEEEEEIINEDAAPAEAPSAAAAPAEEQVAEPAEEPATAEAAPE
FT                   VTEAQVTNEAAAAQVDEKLEQAQENGEPAQVNGATAEAPEAPQEAPAPVQPEVAAPEKP
FT                   ATPRSTPAEPVKKEAPAPEKETAAPVKAVPKTWATIASKSGASAPVVPAIPVAPPKPTP
FT                   APAASQPSPAPAPSQPAPSSASTPTAAASEITPEQPTSTDSAGWQTAGHDHKKTQSRAA
FT                   EEQNVLAYIKNVNEKVDASLLKQTLSRFGKLKYFDVSRQKNCAFVEFAEPAGYAAAVAA
FT                   NPHQIGSEQIFVEERRPRGNAYGGNANYGAGRGGAGRGRGDRAGNQGRGGFQRDGRGGF
FT                   APRGRGGNVNGKPRNQPQAA"
FT   CDS_pept        join(1108402..1108662,1108724..1110583)
FT                   /codon_start=1
FT                   /gene_family="HOG000031988" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI19904721"
FT                   /gene_name="hsp90"
FT                   /gene_synonym="hsp1"
FT                   /orf_name="AFUA_5G04170"
FT                   /product="Heat shock protein 90 "
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to stress"
FT                   /protein_id="EAL85888.1"
FT                   /db_xref="EMBL:AAB51544.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG244366"
FT                   /db_xref="HOGENOM:HBG631012"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="UniParc:UPI000052080F"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40292"
FT                   /transl_table=1
FT                   /translation="MSSETFEFQAEISQLLSLIINTVYSNKEIFLRELISNASDALDKI
FT                   RYQSLSDPTKLDTGKDLRIDIIPDKENKTLTIRDTGIGMTKADLINNLGTIARSGTKQF
FT                   MEALSAGADISMIGQFGVGFYSAYLVADRVTVVSKNNDDEQYIWESAAGGTFTLTQDTE
FT                   GEQLGRGTKIILHLKDEQTDYLNESRIKEVVRKHSEFISYPIYLHVLKETEKEVPDEEA
FT                   EETKEEEDEEKKAKIEEVDDEEEEEKKKKKKTKTVKESKIEEEELNKTKPIWTRNPADI
FT                   TQEEYASFYKSLSNDWEDHLAVKHFSVEGQLEFRAILYVPKRAPFDLFETKKTKNNIKL
FT                   YVRRVFITDDATDLIPEWLGFIKGVVDSEDLPLNLSRETLQQNKIMKVIKKNIVKKTLE
FT                   LFNEIAEDREQFDKFYSAFSKNIKLGIHEDAQNRQTLAKLLRYQSTKSGDEATSLADYV
FT                   TRMPEHQKQIYYITGESIKAVAKSPFLDSLKQKNFEVLFLVDPIDEYAFTQLKEFDGKK
FT                   LVDITKDFELEETEEEKAEREKEEKEYENLAKSLKNILGDKVEKVVVSHKLVGSPCAIR
FT                   TGQFGWSANMERIMKAQALRDTSMSSYMSSKKTFEISPKSSIIKELKKKVEADGENDRT
FT                   VKSITQLLFETSLLVSGFTIEEPASFAERIHKLVSLGLNIDEEAETTEEKATEEAAPAE
FT                   ATTGESAMEEVD"
FT   CDS_pept        join(complement(1113044..1113785),
FT                   complement(1112534..1112968),complement(1111437..1112479))
FT                   /codon_start=1
FT                   /gene_family="HOG000159516" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18209287"
FT                   /orf_name="AFUA_5G04180"
FT                   /product="Putative uncharacterized protein "
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /protein_id="EAL85887.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG055498"
FT                   /db_xref="HOGENOM:HBG334140"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="UniParc:UPI000051F2C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEU0"
FT                   /transl_table=1
FT                   /translation="MRPPVPEVPMPRSRKSSIEQPWTDPRSTAPATFFLARSHTPHSEE
FT                   LSLEDSDVSKEYMYGVQSLADSVQDASISSSQNIFDRSTSDRLSSGSAVADLRPDINLD
FT                   VKENDSEDENGVDAPPLGPRRSTVRQFDSLRTEVSLQPPSDRASSRPLTPLNPDEPSSL
FT                   PSSPKSVSNQSMKHLDDISITDDLSSHAVGSEDEGNDAREAPNSTGFDSTSQLIMPSIR
FT                   MPSRRPFTDRGKTMGRFKVLIAGACGSGKTSLIKSIVQACEDIVHVDPFPSLSPSNLPA
FT                   RAQPPTTAAVISEIYASTKPYPAWWSGLEDSRVLRRRKSSGDIVLERNLCFVDTAGNGL
FT                   TRVGQTDAIIHHIQQQLLRATTAVTSSNTDFENLLAGNGGAQVDAILYLISENTLDEDI
FT                   ECIRKLCVWTNVIPLISKSDLLTPDQIATLKSSFHAKAQMASIKPFHFGDATSAAADGF
FT                   SSHSPFAVSSAKVDDEDVMDASTLMSPDYVQPLAPSELSLLVKKLFDLDNMAWIRHSAA
FT                   KKLVQRQHDQGPQWEVSRHSTNPFDGQSTVSRCTSSIFSASYLEGTMSPPSGRFPSYTM
FT                   ARISDYTQREEKMARVQLAKWASDLQRSLQNERERYAALARGERAVWLTERLGECVVDG
FT                   SLVPITKTPGFCGLRFPMDNAGGRLFVRTQDGKNMEYRVTSISPHDPLGIVWWSDDLKQ
FT                   RGWAIVQIVGSLGVVGGLAFLLARTWGLSSRSLSEWRFDCCSTCN"
FT   CDS_pept        join(1116356..1116988,1117071..1118109,1118180..1118736)
FT                   /codon_start=1
FT                   /gene_family="HOG000159505" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057973"
FT                   /orf_name="AFUA_5G04190"
FT                   /product="HLH transcription factor (PalcA), putative "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85886.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG055490"
FT                   /db_xref="HOGENOM:HBG334142"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI000051F2AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEU1"
FT                   /transl_table=1
FT                   /translation="MDQDNSMAWPGSLQEQSLMAASGEDEFTNFLEFGMHFPDLEGHGP
FT                   GERQLQPPHSLPASASMMPTTTAEQEQLIRMDTDSLPNAHSSSSYSNRIMGDFPFDLSN
FT                   HNQQSQPQGQIPSSYTSAPVTPAFYNQELAQPQIYHHPQQPPQKQQQQQQSHHGLPTTS
FT                   QPYIPHGQAIIPPTPNSIELQGNAARYPAQVDENHELYDRYPHMNEEQALYTPLVSPAM
FT                   TPLETQFRLPEYTIPGEYFTPLTSPALEAQNSNGNGYPFQSVSEVGFLHSPADAIPASS
FT                   APSSPGLMRKHRRRPSATKSFSSRAKKQQSPSVRPQTRKKSMLNLNSDEVLNGLSQDQG
FT                   VSKILPHGVSGLRQSSNESSDQDSVSPEPLSEPLMPPPALPPARKSPTIVPQANQSQTS
FT                   TPATPAMLMRLQRPQPAENPTGQFNGQARLVSTESYDDVMEDVMLPEAANPSSELSRPQ
FT                   VGRIDTAMKSGSATPVTSASITPSLEPKSAPVMDRNLTSIAPSPRTMAMPSPSGPIAKK
FT                   SDTPKLGPMGRKRQSLSSTHASPNLRPKISPSIQPLVRGEGISSETSALYLASKSNYQH
FT                   ILDGTLLPGVSYPETLAENLSSKRTNHKLAEQGRRNRINNALKEIESLIPSAFIQMKQT
FT                   KENVASHVKGDKEKEKEKAGAPTISKASTVELAIDYIKALKQELEETKGKLAAAEARIG
FT                   ENGAAKDEDCKAATVSSPGDEKSKSSNGTQDSSTAEGAVSSTEATGSS"
FT   CDS_pept        join(complement(1121573..1121584),
FT                   complement(1121446..1121502),complement(1120454..1121327),
FT                   complement(1119411..1120357))
FT                   /codon_start=1
FT                   /gene_family="HOG000048480" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057974"
FT                   /gene_name="rpc82"
FT                   /gene_synonym="rpc3"
FT                   /orf_name="AFUA_5G04200"
FT                   /product="DNA-directed RNA polymerase III subunit rpc3 "
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85885.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG055482"
FT                   /db_xref="HOGENOM:HBG334143"
FT                   /db_xref="InterPro:IPR008806"
FT                   /db_xref="InterPro:IPR013197"
FT                   /db_xref="UniParc:UPI000051F535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WEU2"
FT                   /transl_table=1
FT                   /translation="MTSQFAAELCELLVEENFGELFGRIFATLSRYDRLNLPRLKAYSE
FT                   LPNRQLLPALAAMIQQHLVYHYTSYDDGVTYYEANMQSAYYLVRSGKILEFVEERLGKY
FT                   AATVLSTIMYLGHAQVSYLETLPELTSEAVKANGVPEEHGEHEEDEEQSNGLNGEHSNE
FT                   QPELLHPTLKALAAHGYIIRVREAQFQSHADNILDAERAIRSKPEMKALKGKRLEEAVI
FT                   EGTLGLLKERTDGDLTRGLIVHGVPRGAKRKHSSRRADEPNKKCRTDFASVDENDEHDE
FT                   EEENEWSDDEMGYDTTPMEVSARELYATVSERETEQGVSPATAKVYECLLRRIEYQTHQ
FT                   CRDTAEIPREGEEGEQYSVPIALSALAEDVNPQLDLSSSTGPMDSSQPDGRRGKRPWDG
FT                   DVEGTNHEEANGLSSGGSGGNRTFEIDQHLSLLAQPPHNLTSKRMVSGLITWTVEFRHL
FT                   ARKLRHLELERMIEARYGDVALRVVRVLHAKGKLDEKRLQEISLLPFKDLRQVLASMQA
FT                   GGFVDLQEVPRDAQRQPSRTIYLWYYDPDRICNSVLQDTYKAMSRCLQRLRFERSRIKD
FT                   FLEKTERSDVKGNEQRFLSEPELVLLEQWRAKEALLLGEVARLDEMVAVMRDY"
FT   CDS_pept        join(1122054..1122305,1122392..1122566,1122630..1123489,
FT                   1123564..1123659)
FT                   /codon_start=1
FT                   /gene_family="HOG000159494" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904722"
FT                   /orf_name="AFUA_5G04210"
FT                   /product="Ubiquinol-cytochrome C reductase complex core
FT                   protein 2, putative"
FT                   /EC_number="1.10.2.2"
FT                   /function="metalloendopeptidase activity"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL85884.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058522"
FT                   /db_xref="HOGENOM:HBG737788"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI000051F54E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEU3"
FT                   /transl_table=1
FT                   /translation="MLSRSSLSRNAPRALSAATASSRRSMASAATPGLQYDVSESAGVK
FT                   VANREVAGPTGTLALVAKAGSRYQPFPGFSDALEFFAFKSTLKRSALRITREVELLGGE
FT                   VSSTHSRENVVLKAKFLSKDLPYFAELLAEVAFQTKFAGHELNELVLNLIKYRQQAFAA
FT                   DAENIAVDAAHALAFHRGLGENITPSASGPFEKYLSADAIAEFAKDAYAKSNIAIVGSG
FT                   SSTAEVSRWVGEFFTEVPSAGGSSQFKVRPNTASKYYGGEQRISSKSGNAVVIAFPGSS
FT                   TFGTSGYKPEASVLAALLGGESSIKWTPGFSLLAKATQGFSQVRVATKNNAYSDAGLFT
FT                   ITVSGKADQVAAASKNVVDVLKKTAAGEIAGDEIKKAIALAKFRALESAQTLETGLEAT
FT                   GAALINGSKPYQIGEIAQGFDSVTEAQIKDAAKSFLSGKASVAAVGDLFQLPYGEDLGL
FT                   TV"
FT   CDS_pept        join(complement(1126167..1126245),
FT                   complement(1126056..1126080),complement(1125969..1125987),
FT                   complement(1125818..1125914),complement(1125058..1125734))
FT                   /codon_start=1
FT                   /gene_family="HOG000159483" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057975"
FT                   /orf_name="AFUA_5G04220"
FT                   /product="Mitochondrial DNA replication protein (Yhm2),
FT                   putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85883.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG055469"
FT                   /db_xref="HOGENOM:HBG330351"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000051EDCD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEU4"
FT                   /transl_table=1
FT                   /translation="MSATTAEKASTGRTLEKKPVKFSNLLLGAGLNMFEVTTLGQPLEV
FT                   IKTTMAANRGDSFAGAMARIWGRGGILGYYQGLIPWAWIEASTKGAVLLFVASEAEFRA
FT                   KVLGAPDFLAGIAGGMTGGVAQAYATMGFCTCMKTVEITKHKMAAQGVKPPGTFATFMD
FT                   IYRKEGIRGINRGVNAVAIRQTTNWGSRFGLSRLAETAIRKVTNKDENQKLSAIEKVIA
FT                   SGLGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYETNGIKGLYRGVTPR
FT                   IGLGIWQTVCMVALGDM"
FT   CDS_pept        join(complement(1129051..1129170),
FT                   complement(1128914..1128978),complement(1128756..1128840),
FT                   complement(1128633..1128680),complement(1128518..1128578),
FT                   complement(1127912..1128467),complement(1127534..1127834),
FT                   complement(1127276..1127464))
FT                   /codon_start=1
FT                   /gene_family="HOG000130831" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270563"
FT                   /orf_name="AFUA_5G04230"
FT                   /product="Citrate synthase (Cit1), putative "
FT                   /EC_number="2.3.3.1"
FT                   /function="acyltransferase activity"
FT                   /function="citrate (Si)-synthase activity"
FT                   /biological_process="cellular carbohydrate metabolic
FT                   process"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="EAL85882.1"
FT                   /db_xref="GO:0004108"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0044262"
FT                   /db_xref="HOGENOM:HBG127450"
FT                   /db_xref="HOGENOM:HBG309523"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010109"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="UniParc:UPI000051F2AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEU5"
FT                   /transl_table=1
FT                   /translation="MASTMRLGAFALRSTSITAKPAVQSAAFNGLRCYSTGKAKSLKET
FT                   FADKLPGEIEKVKKLRKEHGSKVIGEVTLDQAYGGARGVKCLVWEGSVLDSEEGIRFRG
FT                   YTIPECQKLLPKAPGGEEPLPEGLFWLLLTGEIPTEQQVRDLSAEWAARSDLPKFIEEL
FT                   IDRCPSTLHPMAQFSLAVTALEHESAFAKAYAKGINKKDYWNYTYEDSMDLIAKLPTIA
FT                   AKIYRNVFKDGKVAPIQKDKDYSFNLANQLGYGDNNDFVELMRLYLTIHSDHEGGNVSA
FT                   HTTHLVGSALSSPMLSLAAGLNGLAGPLHGLANQEVLNWLTKMKKSIGNDLSDQAIKDY
FT                   LWSTLNAGQVVPGYGHAVLRKTDPRYVSQREFALRKLPDDPMFKLVSQVYKIAPGVLTE
FT                   HGKTKNPYPNVDAHSGVLLQYYGLTEANYYTVLFGVSRALGVLPQLIIDRALGAPIERP
FT                   KSFSTEAYAKLVGAKL"
FT   CDS_pept        join(1130792..1130911,1130983..1131228,1131457..1131607,
FT                   1131693..1132721,1132782..1132815,1132870..1133038,
FT                   1133092..1133343)
FT                   /codon_start=1
FT                   /gene_family="HOG000159472" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752562"
FT                   /orf_name="AFUA_5G04240"
FT                   /product="RNA binding protein Nrd1, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="EAL85881.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG055459"
FT                   /db_xref="HOGENOM:HBG334146"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000520354"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEU6"
FT                   /transl_table=1
FT                   /translation="MSSAVAELENYLQSMLALKPPGVSGSKINSITSLCTANVQNESVL
FT                   IQKIYTHFKKAPGTHKLGVLYVVDSVTRQWVEAARKAGQPSGSAAPDGTFAAGVNRVTE
FT                   LLPVLMTDIINNAPEDQKEKIKKLVDIWERGYTFPAPMLASFKEKLNAPASQSKLSLLI
FT                   PLRSRSWSCHVESTTPEGSPAPNYIPLGGSQQQQQANGASSTTPAQAAPDTSSILKALA
FT                   DMAKQNTTTPAAPATTNPLNALNMQGTVSQPVTSSVDQASQVQAGQSGVNPYAAGTMAT
FT                   PFAALNNLAQNPALIPSQSQSQTPPNPLAAAANPLAALLPQATSAAAQPTPSIAPDALQ
FT                   QQLQLLQLLAAQGIPQEQWATALQILSLSNATNMANVNPGQAVGFNLPGQAAAAWGSRP
FT                   DSQSRDFDRGDRERDRDYMRSPPGQYRRRSRSPGWDRRRDVSPPRRRDSPVYGEYHGDS
FT                   PGRRGDMRGRRGNDYRQRSPPGRRRRSPTPPRKDPTLPPPGPKFIEWDYSIGQGNIKVL
FT                   SRTLFVGGVTSSEAHLRSLFSKYGVVQTCIVNVDKRHAFIKMITRQDAVNAREGMESYK
FT                   SGDMQLRTRWGVGFGPRDCSDYQTGISVIPIERLTEADRKWMLTAEYGGTGGRPIESGM
FT                   VVEEPDIEIGAGVSSKGKRISFLVLRINEMK"
FT   CDS_pept        join(complement(1136245..1136288),
FT                   complement(1136126..1136180),complement(1135984..1136067),
FT                   complement(1135563..1135922),complement(1134935..1135503),
FT                   complement(1134676..1134868))
FT                   /codon_start=1
FT                   /gene_family="HOG000246417" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270564"
FT                   /orf_name="AFUA_5G04250"
FT                   /product="Homocysteine synthase CysD "
FT                   /EC_number="2.5.1.49"
FT                   /function="O-acetylhomoserine aminocarboxypropyltransferase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="EAL85880.1"
FT                   /db_xref="GO:0003961"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG380413"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051FECF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEU7"
FT                   /transl_table=1
FT                   /translation="MSQTPHFETLQLHAGHEPDSATNSRAVPIYATSSYTFNDSAHGAR
FT                   LFGLKEFGNIYSRIMNPTVDVFEKRIAALEGGVAAVAASSGQAAQFMAIAALAHAGDNI
FT                   VATSNLYGGTYNQLKVFLPRLGITTKFVQGDRPEDIAAAIDDRTKAVYVETIGNPRYNV
FT                   PDFEAIAKVAHEKGVPFVVDNTFGAGGYFFRPIDHGADIVVHSATKWIGGHGTTIGGVV
FT                   VDSGKFDWGKHADRFPQFTEPSEGYHGLNFWETFGSIAFAIRVRVEILRDLGSTLNPFA
FT                   AQQLLLGLETLSLRAERHASNAIALATWLQKNEHVSWVSYPGLESHPSHEIAKRYLKRG
FT                   FGGVLSFGVKGGAAAGAQVVDNFKLISNLANVGDSKTLAIHPWSTTHEQLTEQERLDSG
FT                   VTEDAIRISVGTEHIDDIIADFEQSFKASSAALTQ"
FT   CDS_pept        join(1140953..1141169,1141237..1142714)
FT                   /codon_start=1
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904723"
FT                   /orf_name="AFUA_5G04260"
FT                   /product="Arginine transporter, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85879.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051FEBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEU8"
FT                   /transl_table=1
FT                   /translation="MAFNEFEVTAAPKVAEGEGKMLTDELVQVNDNGSSPTSNDLDCEK
FT                   HGASRQSNPLPDLKRKLKSRHLQMIAIGGTIGTGLFISSGTAIAHAGPVGALIAYIFVG
FT                   SIVYSVMTSLGEVATYIPIPGAFTSYATRLIDPSLGFAMGWIYWFSWAMTYALELTATG
FT                   LIIQFWKSDIQIAIFIAVFWVMITFFNFLPVSFYGELEFWFSSVKVITVVGFMVFAICI
FT                   DAGAGGRGYLGFRHWVDPGPFSPYEGVHPDSTAKFVGFWAVLIQAGFSYQGTELVGIAA
FT                   GETENPRKTVPSAIRKTFFRILFFFVLTIFFIGLLVPYTNENLLTGGNDANSSPFVIAA
FT                   RLAGVKVLPDIINAVLLTVVLSAANSNVYSGSRILIGLAQEGFAPRLFKRTSKKGVPYY
FT                   SVAFTSAFGLLGFMNVSNAGSTVFNWFLNISGVAGFITWASLNACHIAFMRALKARNIS
FT                   RDLLPYKALWQPWYAYYGLFFNVLIILTQGFTAWIPTFSVTDFFVAYLSVILFVVLYLG
FT                   HKIIFRPAFVRPIEADIDTGRVALENEMWETVTPTKWYKKLGSAILG"
FT   CDS_pept        join(1144351..1144524,1144622..1144877,1144956..1146546,
FT                   1146616..1146721)
FT                   /codon_start=1
FT                   /gene_family="HOG000159459" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270565"
FT                   /orf_name="AFUA_5G04270"
FT                   /product="AMP-binding enzyme, putative "
FT                   /EC_number="6.2.1.3"
FT                   /function="long-chain fatty acid-CoA ligase activity "
FT                   /protein_id="EAL85878.1"
FT                   /db_xref="GO:0004467"
FT                   /db_xref="HOGENOM:HBG266050"
FT                   /db_xref="HOGENOM:HBG721674"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000051E935"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEU9"
FT                   /transl_table=1
FT                   /translation="MFFSQQPTHLSRAEELRQEPPKGTPYSVAIPGTERPGRSKIYRAW
FT                   NLQNELLKTLDPKILTAHDIFESTANRAPKAHCLGWRPYDPVTKTYGPYQWMDYETVRK
FT                   RRAAFGAGLVELHNKHGCGRSGSYGIGLWCQNRPEWQITDLACMSQSLYSVSIYDVLAS
FT                   DATEYIINHAELNCVVTSLPHIPTLLKLKPSLPNLKIIVSLDPLDAGEPAGHSKRALLE
FT                   SVAAGLDVAIYTMDQVEELGTASNRPCVPPSPSDIVTINYTSGTTGPPKGVVLTHENAV
FT                   AAASSALVNIRQAPGDTSLSYLPLAHIYARLAEHTAFWAGARIGYFHGNIVELVDDIKA
FT                   LKPTAFFSVPRLYSRFGNVIRGATVEQPGFKGALSRHIVAAKTANLKNPDPSKATVKHA
FT                   LYDRIWAKKVSAAIGLERCRFMVSGSAPLDPSLHNFLRVAFGVDFIQGYGLTETYAIAS
FT                   SQSAKDLTAGNCGRIAPSTEACLMSLPDMDYSVDDKPFPRGELLLRGTNIFREYFKNPE
FT                   ETSKAMTEDGWFRTGDVCTIDEMGRFIIIDRRKNVLKLAQGEYISPERLEGVYLSELSY
FT                   FAQGYVHGDSVQTFLVGIFGVQPDTFAPFASKVLGRTIDATDIEGLKSVLGDDKVRKAV
FT                   LRDLEKIAKKHKLAGYERVKNCALLIEPFSVENNLLTPTLKLKRPPTVKKYRQLLDQLY
FT                   EQALEEQSAPKAKL"
FT   CDS_pept        join(1147469..1147982,1148245..1148468)
FT                   /codon_start=1
FT                   /gene_family="HOG000159438" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057976"
FT                   /orf_name="AFUA_5G04280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85877.1"
FT                   /db_xref="HOGENOM:HBG055439"
FT                   /db_xref="HOGENOM:HBG334148"
FT                   /db_xref="InterPro:IPR019008"
FT                   /db_xref="UniParc:UPI000051E714"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEV0"
FT                   /transl_table=1
FT                   /translation="MSFLRSSLSALFLFVAATCTTVLSASLTITIPPSNLLPNPNTLPA
FT                   GTHATLTSLPSLKDREDASSHVPHPLTAPLTRSASFVFRNLKATKPESYLLDIRSAEYV
FT                   FAPYRVDVSADGTVLGVWETYRGNPWDNRGREKFVVDAAGGNGAKAAEVMVEAKILARR
FT                   GFYEERARLDPEMRAEFEKQSRTSPISGATRNAMAGGGGPGNFDLAGWMAGATPRQATG
FT                   TDSEAARGTATGRETGGTTRRRG"
FT   CDS_pept        join(complement(1149696..1149781),
FT                   complement(1148840..1149626))
FT                   /codon_start=1
FT                   /gene_family="HOG000159427" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270566"
FT                   /orf_name="AFUA_5G04290"
FT                   /product="WW domain protein, putative "
FT                   /protein_id="EAL85876.1"
FT                   /db_xref="HOGENOM:HBG055432"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000051F066"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEV1"
FT                   /transl_table=1
FT                   /translation="MSFAPPPGPPPPSVPEGWKSQYDDRYKQWFFVNLHTGKSQWERPE
FT                   GPAQKEEQHAPPSGPPPSYDDSGPANPSVQAAATDDKKTLGSNNPYNQADPSNDTLESD
FT                   ARLAAQLQAEEDARAQSRSPVHPGAAADYYSGSSRPLSSAGYQPSQGPAPAPEPKRSRG
FT                   FLSKLMGKSSSSSGSPHFGRPPIAQQQSYGYQQGGYYGGGYPPQPHPAGYGYPQYQPQG
FT                   GHYPGAVPPRRGGGMGTAGAAALGVGGGLLGGALLAEAFDDDHGDTIINNYGDNYSGDF
FT                   GGGDDFGDF"
FT   CDS_pept        complement(1150817..1154233)
FT                   /codon_start=1
FT                   /gene_family="HOG000216944" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904724"
FT                   /orf_name="AFUA_5G04300"
FT                   /product="WD repeat protein"
FT                   /protein_id="EAL85875.1"
FT                   /db_xref="HOGENOM:HBG055425"
FT                   /db_xref="HOGENOM:HBG334150"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000051EDED"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEV2"
FT                   /transl_table=1
FT                   /translation="MLHRAIPQKIAGIMNLCASNHKHLEPDDPALVEEHKLLLSKFMEP
FT                   SSRGTKEIERVSCNNFETVFHSQTSMSSASNTINDEFSAVTNPGVTSGGRKDCNAKVAL
FT                   GLPTSARKRSTSNLSSMDKQTFSSSASSVERDSSSPGPSSTRSLAPRTRRSTRSRNKQI
FT                   NYYPVISLSESDSGEGPSGSRDTKTVNTSSQARNRQSHKPSNQSSKRLHHLNSNTDPLS
FT                   DAEIRIIYSSRGVQIRKLSFTSLDHLKDLKHAPFCPEHNPAKYARRYRESMIVSSEILH
FT                   VDFDSHEMTAMLGLLSLHGCQYSPTTEISISDQVIAVLSSHDVHRDFAKKISLLRELAK
FT                   YISNEAVIDTSTWLWEVLTSKVRNKNQQSVRHCLTQLLTLKGMAGDGALSSSPAVIKQQ
FT                   LQIFLSCLPHASILYRRQPADIGAFIQAARNGHLSSSPSIIQAARVTDSNSGSSVFGPI
FT                   RALNNVNALLQNRELGGPVKRQLRTKVKSEFSLLKTWKGASNDVNVLAWSPDGTKFAAG
FT                   ATAQCDEGNMEYNRGNNLVIGDLTCNRLEEVPGHYIIRPPGRAASQRALSDNRLFMSVT
FT                   AMQWFDDTLFTASYDNTVKLWRFSGNQITNHKTLPHESKVLVMARSNFEENLLATGAQS
FT                   FRLWNIMESKDAPLIIESRRDLTPTCLAWGSTHDTKHLLLAGMSERDDGLPHTCPAPSG
FT                   FLTGWHVGEASIIPTPFQPNSQNIFDIKWHPTLPRFATASTVGQSQVSRGTRSVVRVYE
FT                   PLKWKSQTIEFECPALDINDITFCPMNSYYVTASCTNGVTYVWDYRKRDQVLLELSHGE
FT                   PLNQLDELLEREQDDVGVRMALWGDEINQFYTGASDGIVKQWNILRAQEDALTKNVFGI
FT                   EEEIMCGAFSSDKSNLLIGDAGGGIHILSTSNSSPHEGRDPNEDERKMQFRHAAQPPCD
FT                   DHASDSESGLVAARKLLNSGKLKRHPVFGVGQGPHYDGPYAGWARPGNPDKPHLASLRP
FT                   DVKMRQLDGPAPKDRIGLDEESRQLVEAHIQLARIRNQRRNEYKRKRTVDVIDLCSDEE
FT                   DNRSPERQAQSRHIYIGDFMGIANLQCEVIDLTGDTDTDSEENASIARARSPCFKFPKV
FT                   DSSLETLEAGLEDDFWWPDSGQVNPNFPQEA"
FT   CDS_pept        join(complement(1156379..1156503),
FT                   complement(1155587..1156320),complement(1155415..1155530))
FT                   /codon_start=1
FT                   /gene_family="HOG000159426" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752563"
FT                   /orf_name="AFUA_5G04310"
FT                   /product="Peroxisomal membrane protein Pmp47, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85874.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000F51CC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEV3"
FT                   /transl_table=1
FT                   /translation="MSQSRIQEQKRAVAASAAAQQSDNIAHALAGAGGGILSMVLTYPL
FT                   ITLSTRAQVESKRAQSTTMDAVRRIVQREGFSGLYSGLESALFGISVTNFVYYYWFEWT
FT                   RAAFEKAAVKAGRASKKLTTAESMIAGAIAGSATVLITNPIWVVNTRMTARKSDAEDQA
FT                   LPGAPEKKARASTIGTLMDLIRREGPTALFAGVLPALVLVINPILQYTIFEQLKNIVER
FT                   RRRMTPKDAFYLGALGKILATTITYPYITVKSQMHVASKDGPKESLNGSLKRIISEEGY
FT                   TGLYKGIVPKVTQSAITAAFLFAFKDVLYDMMVTARKRSRLSK"
FT   CDS_pept        join(complement(1159442..1159452),
FT                   complement(1159105..1159228),complement(1158985..1159032),
FT                   complement(1158694..1158921),complement(1158435..1158629))
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752564"
FT                   /orf_name="AFUA_5G04320"
FT                   /product="Secretion related GTPase SrgB/Ypt1 "
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="EAL85873.2"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI0000069593"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEV4"
FT                   /transl_table=1
FT                   /translation="MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDF
FT                   KIRTIELDGKTVKLQIWDTAGQERFRTITSSYYRGAHGICVVYDVTDMDSFNNVKQWLQ
FT                   EIDRYATEGVNKLLVGNKSDMEDKKVVEYTVAKEFADSLGIPFLETSAKNASNVEQAFL
FT                   TMARQIKERMGTATVNNKPTVQVGQGQGVQSGSAGGCC"
FT   CDS_pept        join(complement(1163766..1164058),
FT                   complement(1163529..1163698),complement(1163008..1163432),
FT                   complement(1162721..1162942),complement(1162545..1162662),
FT                   complement(1162366..1162482),complement(1162271..1162296),
FT                   complement(1162002..1162212),complement(1161876..1161946),
FT                   complement(1161378..1161820),complement(1161109..1161321),
FT                   complement(1160457..1161051))
FT                   /codon_start=1
FT                   /gene_family="HOG000106482" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270567"
FT                   /orf_name="AFUA_5G04330"
FT                   /product="Aminopeptidase, putative "
FT                   /EC_number="3.4.11.7"
FT                   /function="aminopeptidase activity"
FT                   /function="metallopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL85872.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG403372"
FT                   /db_xref="HOGENOM:HBG515894"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniParc:UPI0000520342"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEV5"
FT                   /transl_table=1
FT                   /translation="MWGRRCCITSTTRCAGVIPEATRCHHFVSYRPIRPVPLLRPSFPS
FT                   SGSSRGVSSSRFYLPCTFLRHLIKPNLSKSFVRHCSFDVRAMAMADRDTLPDAVKPVHY
FT                   HVSLYDLELGGAWGYKGTVKIDSTVTRPTKEVVLNCKEIEVHKAEILGKDGTESAKASK
FT                   ITYDKKSERVSFIFSQEISPSDIVLSIGFTGTMNNAMAGFYRSKYKPAVQPTADTPKEG
FT                   DFYYMLSTQFESCDARRAFPCFDEPNLKSTFDFEIEVPKGQTALSNMPIKSERDGSKPD
FT                   LKFVSFERTPVMSTYLLAWAVGDFEYVEAMTQRKYSGKSIPVRVYTTKGLKEQARFALE
FT                   CAHRTVDYFSEVFEIEYPLPKADLLAVHEFAMGAMENWGLVTYRTTAVLFEEGKSDTRY
FT                   KNRIAYVVAHELAHQWFGNLVTMDWWNELWLNEGFATWVGWLAVDHFYPEWNVWSQFVA
FT                   EGVQQAFQLDSLRASHPIEVPVRNALEVDQIFDHISYLKGSSVIRMLSDHLGQETFLRG
FT                   VADYLKKHAYGNATTNDLWSALSQASNQDVHKFMDPWIRKIGFPVLTVAEEPGQISIRQ
FT                   NRFLSTGDAKPEEDETTWWIPLGIKSGPRLADVNTRALVSKSDTIAGVGQDSFYKINKD
FT                   LSGFYRTNYPADRLAKLGQSLDLLSTEDKIGLIGDAAALAVSGEGTSAALLTLLEGFKR
FT                   EENYLVWSQISSSVANLRSVFSQNDSVAAGLKKFTLALASPAAEKIGWEFKADEDYLTV
FT                   QLRKLLIGMAGFAGHESIVTEAKQRFDLWASGKDKSAVHTNLRSAIFGITIAEGGRDKY
FT                   DSVKEEYIKTDSVDGKEICLAALGRVTDADLVYDYLDFVFSDKVAIQDVHNGAVALAAN
FT                   SKVRHLLWEYMKRNWDAVEARLSANNVVFERFVRMGLSKFADHNIGADIASFFKDKDTS
FT                   PYDRALVIVADSIRTNANYKERDERLVLEWLQSHGYA"
FT   CDS_pept        join(1164833..1165062,1165148..1165483,1165548..1166352)
FT                   /codon_start=1
FT                   /gene_family="HOG000159415" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270568"
FT                   /orf_name="AFUA_5G04333"
FT                   /product="RNA polymerase TFIIH complex subunit Ssl1,
FT                   putative"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27248.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG315004"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004595"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007198"
FT                   /db_xref="InterPro:IPR012170"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000F51C9A"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA11"
FT                   /transl_table=1
FT                   /translation="MADSDEEYVGEVSDEENDVNGIRYARETVPASRPKRRRQRGGAEW
FT                   EVSRTWETLVEGADGTISSTVEGLLEAGKRKRLLRDTTPLQRGIIRHLILILDLSQSMA
FT                   EKDLRPTRYLLSLRYAQEFVREFFEQNPISQLGVLGLRDGLAIRVSDMSGNPTEHISAI
FT                   QALRDHDPKGLPSLQNGLEMARGALFHTPSHGTREVFVIFGSILSSDPGDIHQTITTLI
FT                   NDKISVRIAGLAAQVAICRELCSRTNAGDDTTYGVALNEQHFRELMMDVTTPPVTYSQK
FT                   KATSSLLMMGFPSRTVETCPSLCACHSEPSCGGYLCSRCNSKVCGLPAECPSCGLTLIL
FT                   STHLARSYHHLFPLMNWIEVPWQRASRSLTCFACGIYFPTVPPKDQWQATESQAKGMSV
FT                   SSRYECTVCKNHFCIDCDLFAHEIVHNCPGCQSGISGLAIADRPRGQTGTEEMDTST"
FT   CDS_pept        join(1167017..1167237,1167329..1167707)
FT                   /codon_start=1
FT                   /gene_family="HOG000159394" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270569"
FT                   /orf_name="AFUA_5G04336"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27247.1"
FT                   /db_xref="HOGENOM:HBG324935"
FT                   /db_xref="UniParc:UPI0000F51C5E"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA10"
FT                   /transl_table=1
FT                   /translation="MAGNTPSQGSQFVDTQGPEIDLFRKLNSYPFTTDVEFAKGLSIIL
FT                   GHPNSPATEAEIGCEDDLVLQAKCFYFSRKEQLSPPLDFKRYKTWLGSTPTAEPSPDAE
FT                   IRDHDSQRASASETAVPPGGVHMNQQSPSIQEPAYPSSFARIVELITTGQQIPGIQQIP
FT                   DTVLTGHDTPSEKPRRRKPWEVEDEFARGLESPVEN"
FT   CDS_pept        join(complement(1169999..1171138),
FT                   complement(1169315..1169941),complement(1168888..1169167),
FT                   complement(1168530..1168831))
FT                   /codon_start=1
FT                   /gene_family="HOG000159383" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270570"
FT                   /orf_name="AFUA_5G04340"
FT                   /product="Pumilio-family RNA binding repeat domain protein "
FT                   /function="RNA binding"
FT                   /protein_id="EAL85871.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG055229"
FT                   /db_xref="HOGENOM:HBG334151"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051EDD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEV6"
FT                   /transl_table=1
FT                   /translation="MLEHLPTAYPSRSSEIKKLLAKLSPKPQSSPFKPVEDREILTKLS
FT                   EQQALLEQQNHLLASTSASIEDHVDRDKNSAVKPLTSTLKASHATGNIDNACLAPTNTE
FT                   MSEVLRLKKELLAANSKLALQEQELAQTRVIKHTLDQALGTPSEADFSGREVTEHTISH
FT                   LQSVFNAPSSNFTQSHEGWNTHDDSQSDVSEALSTGTYSGARGFWFPQTQQVFGMHMNA
FT                   QAGERAFGEHVSLSSNTFGPEANRFWTNPTASISMNGSFQPHRVLSGPSFGTCNSTTQY
FT                   TEGSARYSPNSAQRCSVPHVNRAGPCFSAQNPSWEASFNTASPSNQLPRAPTTRPCSTY
FT                   QQVGLYPIQPYQRPIGTSLSLTANEFTSSGASAVPWTTSPVGANTLQTYISPLEPLNYR
FT                   RLLDKNVSCDWKYIVDKIICNNDQQASIFLQQKLKVGTAEQKYDIIEAITHQAYPLMVN
FT                   RFGNFLVQRCFEHGTTEQVVAIANAIKGNTLSLSMDPFGCHVVQKAFDSVPEEHKAVMV
FT                   HELLCRIPETVIHRYACHVWQKLFELRWSGEPPQIMAKVNEALQGMWHEVALGETGSLV
FT                   VQNIFENCVEDEKRPAIEEVIAKIDVLAHGQFGNWCIQHICEHGAPQDKTRAIEHVLLW
FT                   SVDYSMDQFASKIVEKCLKIGGSEFLDRYLSRVCTGRTERPRMPLIDIAGDQYGNYLIQ
FT                   WILMNAAPHQRELVASHIRYCLASLYLYQYNDAHAMIIGSTWFLCEAPNLVHAWQCFAA
FT                   THPIPPVPDPGRACRSAVSAISTMTGIIW"
FT   CDS_pept        complement(1172280..1173434)
FT                   /codon_start=1
FT                   /gene_family="HOG000216943" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057977"
FT                   /orf_name="AFUA_5G04350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85870.1"
FT                   /db_xref="HOGENOM:HBG055166"
FT                   /db_xref="UniParc:UPI000051F7AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEV7"
FT                   /transl_table=1
FT                   /translation="MHELLGQTQWRSQYDELQGQNHWFDGVLTTPSLLAFYNQSATFPR
FT                   RPRLPLAFTITVPSSANIAKGGIYVDQLRSPDRNGVVQVIRDARSGIWYVNTTNIHRFH
FT                   LSPRVLNFTMPSALVLDGRDCFEMGYIRPERMWFLRDSRGRWTVSEREDWRQLNERYGR
FT                   QLGTVDAILRTKGPFNINICSAGLEHIAVQISRNFLQYFAADSQLSRQCGSLIYPDNNQ
FT                   NRVVDSGNVVTLALGNELPSSKLKLFPIRIQGQGLSLFQGCCWPRADTEASPQSSLNRE
FT                   CNEYEFPFERGMGALFLRPLENERLELVVWGADLSGLEQAARFVPTLTGVGQPDFLILG
FT                   DSCRWQGHAGAYAAGFFDRSWQISSGSYIRIDASVNEQRLRNGA"
FT   CDS_pept        join(1176628..1177023,1177077..1178339)
FT                   /codon_start=1
FT                   /gene_family="HOG000159361" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270571"
FT                   /orf_name="AFUA_5G04360"
FT                   /product="ER to Golgi transport protein (Sly41), putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85869.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG055946"
FT                   /db_xref="HOGENOM:HBG334152"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000051F2CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEV8"
FT                   /transl_table=1
FT                   /translation="MTTTTVTGIGRRSSVRQPEIEPPAKAPNSQSVTSPLDQFPPFDEG
FT                   LYQKTTESGEPKSNLTSKHEPSDHWQPRKAGYLPRDYTKGPIRPPKHKSRKSISEAIAT
FT                   IRTRNASVSANAHELAQALRAPVSYRLIALCLIWYTTSATTNTSSKSILNALPKPITLT
FT                   IVQFAFVSIWCLLLAYLSAVFPWLKSSVPALRNGIRYPSRDVIVTALPLAIFQLAGHIL
FT                   SSMATSQIPVSLVHTIKGLSPLFTVLAYRVFFRIRYAKATYLSLVPLTLGVMLACSTGF
FT                   STNFFGILCALLAALVFVSQNIFSKKLFNEASRAESEPQASGRKKLDKLNLLCYCSGLA
FT                   FILTLPIWFISEGYRLISDLMQDGVISLSEKDNSLDHGALFIEFVFNGISHFAQNILAF
FT                   VLLSMISPVSYSVASLVKRVFVIVVAIVWFGSSTTSLQAFGIALTFVGLYLYDRNSHDD
FT                   VADRRANADHFRTKETILPLSVQTKKTWDSNGYAFPPSRTGETHSMDNSAVLAANSKKE
FT                   DDAFDHVRPRGSSTSRTWLPPGTKQESTWQPGDAQ"
FT   CDS_pept        join(1179535..1179550,1179604..1181485,1181538..1181640)
FT                   /codon_start=1
FT                   /gene_family="HOG000031442" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270572"
FT                   /orf_name="AFUA_5G04370"
FT                   /product="NADH-ubiquinone oxidoreductase, subunit G,
FT                   putative"
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /function="electron carrier activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="ATP synthesis coupled electron
FT                   transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85868.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0042773"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG365180"
FT                   /db_xref="HOGENOM:HBG715033"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="UniParc:UPI000051FA27"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEV9"
FT                   /transl_table=1
FT                   /translation="MIAGNCRMCLVEVERAPKPVASCAWPVQPGMNVKTDSPLVHKARE
FT                   GVMEFLLANHPLDCPICDQGGECDLQDQSMRYGADRGRFHEVGGKRAVEDKNIGPLVKT
FT                   SMNRCIHCTRCVRFMNDVAGAPDLGTTGRGNDMQIGTYLEKNLDSELSGNIIDLCPVGA
FT                   LTSKPYAFRARPWELKHTESIDVHDAMGSNVRIDTRGMEVMRVLPRLNDDINEEWIDDK
FT                   SRFACDGLKTQRLTTPLIRRDGKFVPATWEQALTEISSAQQKLQLKENEFKAVAGHLVD
FT                   AESLVAMKDLANKLGSDNLALDQPRGDSPIAHGIDIRSNYLFNSKIYGIEEADVILLVA
FT                   TNPRHEAAVLNARIRKQYLRSDLQIGLVGEEFESTFEYEHLGSNISSLKAALSGKFGEK
FT                   LASAKRPMIIVGSAAAEHQDAKSVFETVGSFVEKHRNNFNTPEWQGYNVLQRAASRAAA
FT                   YEVGFTTPSSEVAQTKPKMIWLLGADEVSQSEIPSDAFVIYQGHHGDRGAQLADVVLPG
FT                   AAYTEKSGTYINTEGRVQVTRAATSLPGAARDDWKIIRAASEFLNKPLPYDDIEALRDR
FT                   MEEISPVMRRYDVVEPTSLSSLSKVQLVDQNKGVQPTNTPFKKVIEDFYFTNSIARSSP
FT                   TMARCSAAKATGNPETNFMAAGEMSPQALYG"
FT   CDS_pept        join(complement(1183332..1183491),
FT                   complement(1183017..1183234),complement(1182658..1182934),
FT                   complement(1182117..1182592))
FT                   /codon_start=1
FT                   /gene_family="HOG000159349" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270573"
FT                   /orf_name="AFUA_5G04380"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="double-strand break repair "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85867.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006302"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG055818"
FT                   /db_xref="HOGENOM:HBG334153"
FT                   /db_xref="InterPro:IPR014751"
FT                   /db_xref="UniParc:UPI0000520808"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEW0"
FT                   /transl_table=1
FT                   /translation="MPSSTLDLSQRILRISRSDDTQGYVLLQVSPISSSALDLDIVATE
FT                   GENPYTGTVRQTRLKTLCAKNYRGSDDEWAQIVSYVFGQLKESVPKSEILSGIESSASI
FT                   VESGDTSRDLVITIRKRVQSITDDEQAIQLFDWSGAAVARADVLEERLSTLTDRYRAAE
FT                   NTIQRLNQQLEEFMRAKTQHDELLMTNFVQLLNEKKLKIRNQQRLLASAKVDSEKASEI
FT                   RSAITGTLPLSSPSNSKTKRSAQEMLDSESDSEDRFERMEVDHSGRNDGRSDDQETEDE
FT                   ETSTPQPLEDDENTNTGESLVSPSIEHKREDNKQASDETPQNRTIVTNSAVPPPRRELP
FT                   FAKKPQMNHMSQRSNESVAAGEDAEETAGETDDDEL"
FT   CDS_pept        join(1185144..1187547,1187603..1188189)
FT                   /codon_start=1
FT                   /gene_family="HOG000159338" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19057978"
FT                   /orf_name="AFUA_5G04390"
FT                   /product="Cytokinesis regulator (Byr4), putative "
FT                   /protein_id="EAL85866.1"
FT                   /db_xref="HOGENOM:HBG055744"
FT                   /db_xref="HOGENOM:HBG334154"
FT                   /db_xref="UniParc:UPI0000520599"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEW1"
FT                   /transl_table=1
FT                   /translation="MESSTCQVPHGDEETIECWDDDGDLHCYEDIHIRTASTATSVTNV
FT                   STRRSGHRDSISSRRSTRSDLDSNAAEDEDLQVQLPDDDEDLSEDAIASAKNAGIPLPV
FT                   NVPKSALIGGTIKRLGRRKPRKNFIDDWSDDVELPGPDAALELKKFKDTVFPETLRQLS
FT                   SATNSPVKRSPSPLWEDDLSTRLQSALTNLSQFTDDSNHSLADIDKVPTIKVAKPRSPK
FT                   STKSITEHNVTKIDALVENVEDDFELPADDFPLHLSLRKDGTEATSTAADDFDLDWSEG
FT                   SIGIRFGGTKRDHRSIPSSAVSVVSPSASSCRTGESEDEGLDGLVIPEGPLDLESMLKK
FT                   RQSTCSTDKPRFSPSGQAEYELTSSDDFFAGLEIESGDAFDLKKLSLNPNVKYKVERPS
FT                   SPARRSTTSITFTNTAVSPRSRIPRLFGHDRHSTHLETVSESGAPLSKFPGLRSWARGH
FT                   VNHASISSLPSRPISTSPTPSTPARRSVTSRSPKTPLSSDRATSGTQPLRNKRSMPTIR
FT                   SVPQSAHLSYSQGSLSREDESARSSISHVRARMPGECAENDSRFLSRKGQTPFIPAGAS
FT                   ETQSHHVNVKGPRHFRRTNSDGSSEIFSSRVPVSRYSRSGRHSISNSVTDESQCKNLIT
FT                   AAKQTITRPTRRRNFGDGTELELFDDLPTSSLAESKFIKHPIGRGVPRSLRSRLGHNQT
FT                   RPSRTEVLKPPSTSSTVPTSCDLTPRFARDTNASRNAREQRIASKAFSLKSRESNPLGP
FT                   LSSNSKNPNIARAPSNPATLGRKTRGVTASGGKPFLIKSIGKGSQEPKCVNGMQYNPDS
FT                   FQWEGNETSVIGFDSLRSPKSPKPAPALITNVSAMQNVQVVGGMVFDPRRMCWLKLASS
FT                   QPGAQGMVAVQVEDDVFAGLDDLEEKSQRKPPGGPGSGSYDVVERTVSGDEPSCGDSSD
FT                   EWPMTEEFDVGPEFVRRQRVEEEKWRRKVEKWVHSERDRHGNCWRWAIRDIVGVNGSHQ
FT                   TQEVRRM"
FT   CDS_pept        1192085..1192336
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752565"
FT                   /orf_name="AFUA_5G04400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85865.1"
FT                   /db_xref="HOGENOM:HBG055669"
FT                   /db_xref="UniParc:UPI000051E949"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEW2"
FT                   /transl_table=1
FT                   /translation="MTSAAMARHHTISLSKRSVHTHLKLDPPTLKPAYLSESINHLRTP
FT                   FRSPQKMKLCSTNPHNVHGDRDICSRRGIFLFVKQTVR"
FT   CDS_pept        complement(1195796..1196515)
FT                   /codon_start=1
FT                   /gene_family="HOG000159316" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270574"
FT                   /orf_name="AFUA_5G04410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85864.1"
FT                   /db_xref="HOGENOM:HBG055595"
FT                   /db_xref="UniParc:UPI000051FC8B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEW3"
FT                   /transl_table=1
FT                   /translation="MPPTSVQIAAQSNDRSVPDSKLGRPENNPEPADAISSTTPQSGPR
FT                   AVCSSYGQTALPNISAGPKPSFNARGSMISLLSAPTRPRGNLNPKDFARSTRRGQVSIS
FT                   QAAPPTGPRNGHIPTGPSVDSDRQHIYRQNSFSGTSYPRQRPTNYLASLNIIVPGGRFL
FT                   THDLDTAVEKRLAQLEMDKERLYEQIADSQRLKHVVIRDWERLDRESSICALKSELAEG
FT                   HLLCITDGESMHTSTTF"
FT   CDS_pept        join(complement(1199895..1199951),
FT                   complement(1198234..1199841))
FT                   /codon_start=1
FT                   /gene_family="HOG000159304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209288"
FT                   /orf_name="AFUA_5G04420"
FT                   /product="Splicing factor 3b, subunit 2, 145kD "
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85863.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG192418"
FT                   /db_xref="HOGENOM:HBG318532"
FT                   /db_xref="InterPro:IPR006568"
FT                   /db_xref="InterPro:IPR007180"
FT                   /db_xref="UniParc:UPI0000520598"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEW4"
FT                   /transl_table=1
FT                   /translation="MKQSKNQLRRARKKALKTKAVEKYNDASDQGSETRSPRLVGHPDA
FT                   AHSSPWELDPDADDALWEMYKDIARKFEDNEDEVRPLVQPEKPEVYFDEDDEIPDEDNK
FT                   GPKLSKKKRKELTKLSVAELKAMVRKPEIVEWTDTSAPDPKLLVHIKAHRNVVPVPVHW
FT                   SLKREYLSSKRGVEKPPFALPKFIQETGISEMRDAALEKQEQATLKQKQRERVQPKMGR
FT                   LDIDYQKLYEAFFRFQTKPELTRYGEVYYEGKEYETNLRHLRPGELSAELKEALNMPPG
FT                   APPPWLINQQRYGPPPSYPALKIPGLNAPPPPGAMWGYHPGGYGKPPVDEHNRPLYGGD
FT                   IFGVLQPQQTVQQGEPVERDLWGELQESEPSDDESEENEDEPEDDVDTETGVQTPSGLE
FT                   TPGGIVSSVPSEFIGAENVTGEFDVRKSYRGTQTEEHVGRRSAFQVIPEKQAHVQGFFG
FT                   ADRVYDLKAPPEGLPVLGAEDPNRKRKKPGDVDVSVDPDALQASDGMSKENLRSLYESH
FT                   KHQETNPNWDFQEDLSDMIAYESRKRLKKEEDRRTKQ"
FT   CDS_pept        join(complement(1201166..1201514),
FT                   complement(1201090..1201118))
FT                   /codon_start=1
FT                   /gene_family="HOG000159261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270575"
FT                   /orf_name="AFUA_5G04430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85862.1"
FT                   /db_xref="HOGENOM:HBG055455"
FT                   /db_xref="InterPro:IPR013219"
FT                   /db_xref="UniParc:UPI000051F7B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEW5"
FT                   /transl_table=1
FT                   /translation="MALLLRYLADDLETQCRIFSLNFNPQRLRLGNKVLRQRLRGPALA
FT                   AWYPRKTVSFRDLQDAYRPLGLTVFDEYEDDREEAIQMYVIIHTKDKTLIADYASAKLR
FT                   GKGRPKKKRTAAESRSAKKKK"
FT   CDS_pept        1201733..1202854
FT                   /codon_start=1
FT                   /gene_family="HOG000216942" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16270576"
FT                   /orf_name="AFUA_5G04440"
FT                   /product="Nucleolar RNAse III, putative "
FT                   /EC_number="3.1.26.3"
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="EAL85861.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG055165"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniParc:UPI000051EDCC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WEW6"
FT                   /transl_table=1
FT                   /translation="MVLKRKSVFDPPVDGSSRKTKSRAASKDPSQEADQSSLACCIGRD
FT                   AQEAPFDGERSLTRDRRSRLRLLKSLTQELVDSIDLLRDHAGHDVTDAIIELDKAFRCA
FT                   KAPLSPISRPDNNSVEFARTQENGNSLSLPELPPILDSSLELAVFTHPGLSKDSKLTYD
FT                   RLEILGDAYIELIATRFIWGRYEGFSSGQISQIRELLVKNETLSEFATLYGLDNRASVP
FT                   RDLLSQPRRWTKTKGDIFESYVAAVILSRPSDGYHVAERWLTQLWLPRLTDAVIPRTAL
FT                   DAKETLAKRIMGKGVKLKYVDERSPAQSRGGMQTFYVGVYLTGWGWQNKHLGSGHGPSK
FT                   AVAGDAAARQALLNEPLISSISQKKKNHESTKT"
FT   gap             1204157..1263256
FT                   /estimated_length="59100"
FT   CDS_pept        join(complement(1266394..1266407),
FT                   complement(1266223..1266307),complement(1266149..1266174),
FT                   complement(1265565..1266066),complement(1265371..1265514))
FT                   /codon_start=1
FT                   /gene_family="HOG000105220" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19057979"
FT                   /gene_name="rps1"
FT                   /orf_name="AFUA_5G05450"
FT                   /product="40S ribosomal protein S1 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL92047.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG211272"
FT                   /db_xref="HOGENOM:HBG402643"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="UniParc:UPI00003E6149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WTM9"
FT                   /transl_table=1
FT                   /translation="MAVGKNKRLSKGKKGVKKRTVDPFSRKDEYSVKAPSTFQIRDVGK
FT                   TLVNRTSGLKNANDSLKGRIFEVSLADLQNDEDHAFRKVKLRVDEVQGKNCLTNFHGLD
FT                   FTTDKLRSLVRKWQSLIEANVTVKTTDDYLLRLFAIAFTKRRPNQIKKTTYARSSQIRA
FT                   IRKKMIEIMQREAASCSLAQLTHKLIPEVIGREIEKATQGIYPLQNVHIRKVKLLKAPK
FT                   FDLGALLNLHGESTTDDKGHKVEREFKEQVLESV"
FT   mat_peptide     join(complement(1266394..1266404),
FT                   complement(1266223..1266307),complement(1266149..1266174),
FT                   complement(1265565..1266066),complement(1265374..1265514))
FT                   /product="40S ribosomal protein S1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WTM9 "
FT   CDS_pept        join(complement(1268836..1268981),
FT                   complement(1268388..1268746),complement(1268157..1268328),
FT                   complement(1268053..1268104))
FT                   /codon_start=1
FT                   /gene_family="HOG000262755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752566"
FT                   /orf_name="AFUA_5G05460"
FT                   /product="Cytosine deaminase-uracil
FT                   phosphoribosyltransferase fusion protein "
FT                   /EC_number="2.4.2.9"
FT                   /function="uracil phosphoribosyltransferase activity "
FT                   /protein_id="EAL92046.1"
FT                   /db_xref="GO:0004845"
FT                   /db_xref="HOGENOM:HBG020849"
FT                   /db_xref="HOGENOM:HBG326432"
FT                   /db_xref="UniParc:UPI000051FC07"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTN0"
FT                   /transl_table=1
FT                   /translation="MNAAPSPAQGVGPIYRPEGEKPTATVSKDISYENVHVLPQTPQLI
FT                   ALLTMIRDKNTSRADFIFYSNRIIRLLVEEGLNHLPVVERSVTTPVGREYLGVRFEGKI
FT                   CGVSIMRAGEAMEQGLRDCCRSVRIGKILIQRDEETCKPKLFYEKLPLDIANRWVLLLD
FT                   PMFATGGSATLAVETLKAKGVPEDRILFLNLIASPSGVADFAERFPNLRVVTAFIDQGL
FT                   NEKKYIIPGLGDFGDRYYTM"
FT   CDS_pept        join(1270187..1272385,1272994..1273008)
FT                   /codon_start=1
FT                   /gene_family="HOG000159305" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209289"
FT                   /orf_name="AFUA_5G05470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL92045.1"
FT                   /db_xref="HOGENOM:HBG055418"
FT                   /db_xref="InterPro:IPR022771"
FT                   /db_xref="UniParc:UPI000051FE53"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTN1"
FT                   /transl_table=1
FT                   /translation="MKEDTEQPSDLVKSATARHRKGNHATPIVQIESNEPSKSANPTTK
FT                   ASAKQSPGLKHEHFPSKDEPPVPEPVDKMLCRFQGQRGKEYHSAQNKRRKLDVSQKKQG
FT                   LDQDVSHLLQDSSSRIAPRDKRDLSAVTDMSYTDEKRFVDQSDLKLQIGGQNLQQAKSY
FT                   GSSGRNKVSTAMPYLQSTHMEQTKSKNKTLSIAADFATSRSQFQSNSKAETSTQVTARR
FT                   RLVDSLGPLEPTVEDAVRASRTNDDTEVDPLPRHSPRRDSSSNSQPQTSSRPVKLVTDS
FT                   ANKGTAETSGPVSSRVGGCKVTYARQRSFLDDTSIVDSRRPSETLASTADSFVQGHRKY
FT                   GPQILSNHASHLGDGETSDSGPVRGIHELRQAGDNSRFRSAIELIFEDIEDAYNTTSGR
FT                   CSSFVQICEKLLDRQFVRRFLEHGFHERLVGCIDDRLDVVSASFALCACGLINLCDKLS
FT                   HISLISHWSNVLVLSPVLLPVKRDLLSLSQSPATGLSRSVQMSIKQVLPRLSSSISGDE
FT                   PAFELSPQFVALSSIQSCLVSLNNKGGSIEPIPATLSDHIVKLLLPERGKTIKLPVSRE
FT                   RFKTLALIFSILESYAIVFSAADHDQNYLSLRTLSRLHEILNLSQCNQGRQLRMYYIRA
FT                   ILNLTNNDPNLCNEYATPELVMGLVNIVMSDIRDASDNSSTGDDSSLNTLILVLGVLIN
FT                   MTEKSESARDLFLRLTLDSTPLIQSLLERFYEMVNSVSELGML"
FT   CDS_pept        join(1273290..1273344,1273445..1273584,1273636..1273764,
FT                   1273823..1274062)
FT                   /codon_start=1
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209290"
FT                   /gene_name="Rheb"
FT                   /orf_name="AFUA_5G05480"
FT                   /product="Ras homolog enriched in brain "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL92044.1"
FT                   /db_xref="EMBL:AAN17787.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:1P2T"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015602"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI000006C99A"
FT                   /db_xref="UniProtKB/TrEMBL:Q8J2P6"
FT                   /transl_table=1
FT                   /translation="MPAAPKQRKIAIVGSRSVGKSSLTVRFVEHHFVESYYPTIENTFS
FT                   RIIKYNGQDFATEIVDTAGQDEYSILNSKHFIGIHGYIIVYSVASRQSFDMVRVIRDKI
FT                   LNHLGADHVPLVVVGNKSDLKSEQRQVSLDEGRQLGEEFQCAFTEASARLDYNVTKAFD
FT                   LMIGEIEKSQNPSQPAGGSKCILM"
FT   CDS_pept        join(1274938..1275070,1275128..1275198,1275312..1275473,
FT                   1275528..1275949,1275999..1276089,1276146..1276514,
FT                   1276569..1276745)
FT                   /codon_start=1
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18209291"
FT                   /orf_name="AFUA_5G05490"
FT                   /product="Seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /function="ATP binding"
FT                   /function="serine-tRNA ligase activity"
FT                   /biological_process="seryl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL92043.1"
FT                   /db_xref="GO:0004828"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006434"
FT                   /db_xref="HOGENOM:HBG053760"
FT                   /db_xref="HOGENOM:HBG629391"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniParc:UPI000051F723"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTN3"
FT                   /transl_table=1
FT                   /translation="MLDLADFVSDRGGNPNKIKESQRKRFAPENVVDEVIALYEEARRA
FT                   RYEVMQIGSELNALQKEIGKRKKNKEDAGVLMEQKAALEKRKKEAEEHASEQESRRDRK
FT                   IRTIGNYVHESVPVSNNEDDNVVVRTWAPENVLVEKRNCLSHHEVLTRLDGYDSERGVK
FT                   IVGHRGYCLTGYGLFLNLALINYGLEFLWRKGYKPNQPPQFMLKELMAKTAQLEQFDEE
FT                   LYKVTESDDKSTDKYLIATSEQPLSALHDGEWIQDKDLPIKYAGYSTCYRKEAGAHGKD
FT                   AWGIFRVHQFEKVEQFVLTKPENSWQVFEEMMATSEEFYQSLGLPYQVVAIVSGALNNA
FT                   ASKKYDLEAWFPFQGEYKELVSCSNCTDYQARALEIRYGTKKATDVKKSYVHALNATLC
FT                   ATERTLCCILENYQTDDGFNVPEPLRKYIPGAPEFLPYTKDLPKDTTSHKSKSRQDIKT
FT                   AAGTGEATKKLQDLQV"
FT   CDS_pept        join(1277444..1277751,1277813..1278120,1278171..1278760,
FT                   1278819..1278861,1278916..1278974,1279031..1279112,
FT                   1279172..1279200)
FT                   /codon_start=1
FT                   /gene_family="HOG000136696" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904725"
FT                   /orf_name="AFUA_5G05500"
FT                   /product="D-3-phosphoglycerate dehydrogenase "
FT                   /EC_number="1.1.1.95"
FT                   /function="NAD or NADH binding"
FT                   /function="phosphoglycerate dehydrogenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL92042.1"
FT                   /db_xref="GO:0004617"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG453194"
FT                   /db_xref="HOGENOM:HBG731446"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000052052E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTN4"
FT                   /transl_table=1
FT                   /translation="MATSAREINIRRDLNVSQNPNLSTSPTASFQSAPSSHGGSAFAGR
FT                   AIPLANAKHLKPFATEDIKVLLLENVNQTGRDILTGQGYQVEFLKSSLPEDQLIEKIRD
FT                   VHVIGIRSKTKLTSRVLKEARNLIVIGCFCIGTNQVDLQYAAEHGIAVFNSPFSNSRSV
FT                   AELVIAEIIALARQLGDRSMEMHGGTWNKVSAKCWEIRGKTLGIVGYGHIGAQLSVLAE
FT                   AMGMSVIFYDVLNLMALGTAQQVPTLEALLSKSDFVTLHVPELPETKDMISSQQFEQMK
FT                   HGAYLINASRGSVVDIPALIHAMRSGKIAGAALDVYPNEPAGNGDYFNDDLNTWASDLR
FT                   GLKNVILTPHIGGSTEEAQSAIGIEVGQALVRYVNEGTTLGAVNFPEVTLRSITMEEPN
FT                   HARVIYIHHNVPGVLRKVNEILGDHNVDKQMTDSRGDVAYLMADISNVDNATIKELYER
FT                   LESLSSRIMTRILY"
FT   CDS_pept        join(complement(1281819..1281928),
FT                   complement(1281682..1281763),complement(1281530..1281626),
FT                   complement(1281324..1281478),complement(1281242..1281269),
FT                   complement(1280969..1281182),complement(1280724..1280918),
FT                   complement(1280415..1280638),complement(1279734..1280371))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752567"
FT                   /gene_name="bur1"
FT                   /orf_name="AFUA_5G05510"
FT                   /product="Serine/threonine-protein kinase bur1 "
FT                   /EC_number="2.7.11.22"
FT                   /EC_number="2.7.11.23"
FT                   /function="ATP binding"
FT                   /function="RNA polymerase II carboxy-terminal domain kinase
FT                   activity"
FT                   /function="cyclin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL92041.1"
FT                   /db_xref="GO:0004693"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0008353"
FT                   /db_xref="HOGENOM:HBG055417"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000052006A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WTN5"
FT                   /transl_table=1
FT                   /translation="MAIASLERDDHGNPRFRGCTSIRDFEFLGKLGEGTFGEVYKARSK
FT                   KDGSIVALKKILMHNEKDGFPITALREIKLLKMLSHRNILQLKEMAVERSKGDGRKKPS
FT                   MYMVTPYMEHDLSGLLENPAVNFTEPQIKCYMLQLLEGLKYLHGNRILHRDMKAANLLI
FT                   SNNGVLQIADFGLARPYDEPPPEPGKGGGEAKRDYTTLVVTRWYRPPELLLQLRRYTTA
FT                   IDMWGVGCVFGEMFKGKPILAGSSDLNQTQLIFNLVGTPTEENMPGWSSLPGCEGVKSF
FT                   GYKPGSLREVFKDQNPMAISLLEELLKLDWRKRINAIDAINHPYFSSPPFPARPGELPS
FT                   FEDSHEFDRRRFRGQRGAIPPAPAGGSVDQQQTTEIAVFPVLHALAGSLHTGFKTILQS
FT                   ALLKTGMLYHMDLQTRGSRFQASLVQKIAACLLNLLCLLIHHGAWVIQIGRHVREVNAI
FT                   ISEDGPMGNWIHTSRLTVTLVDILEKGKAIVRVPLLIGVIWNSNTLMKGINRVILGTDV
FT                   LQEREAGVLTFERLEQRIEHCTDDDKLVLVSTDAERLRQMNPVTLLVLNDSKFITHLLL
FT                   SMTY"
FT   CDS_pept        join(complement(1287963..1288063),
FT                   complement(1287868..1287907),complement(1287273..1287806),
FT                   complement(1286880..1287221),complement(1286690..1286824),
FT                   complement(1286567..1286633),complement(1286375..1286506),
FT                   complement(1285965..1286314),complement(1285770..1285915),
FT                   complement(1285627..1285717),complement(1285239..1285469),
FT                   complement(1285015..1285165),complement(1284595..1284941),
FT                   complement(1284295..1284429),complement(1283991..1284223),
FT                   complement(1283812..1283935),complement(1283716..1283761),
FT                   complement(1283508..1283658),complement(1283304..1283452),
FT                   complement(1282969..1283255))
FT                   /codon_start=1
FT                   /gene_family="HOG000171813" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16270577"
FT                   /orf_name="AFUA_5G05520"
FT                   /product="P-type ATPase, putative "
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /biological_process="cation transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL92040.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0006812"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG483910"
FT                   /db_xref="HOGENOM:HBG735026"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006069"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051F997"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTN6"
FT                   /transl_table=1
FT                   /translation="MRLGEDESARSMPETSSVEGVPGARHRRDSMKSSYSIVSDVEMAR
FT                   TEVFDGPISESIPSSVVSFAHRRGRKDSIVSFTYFQEEDGFIEWPREEVIDAESDSDGL
FT                   SMGEASEADESIISSRRSKRLSYSRPSAEDPLLPRRPSSAFCTGERTIDSRLTQKVYIV
FT                   SEDLTIVIAGFSTSSTGLALYSLLCVITLGFAYILLRWLPRWRVRLIGKPTPLRLCQWV
FT                   AVEDQWNQFNICEVLSIPYGRALSTVFAESESCTQDEDNDPTVSYLRYIDYRCLRFFYH
FT                   PFEDKFSLISGWKDPLWTNIKRMRVGLDADDHDSRAQIFGANVIDIQQKSVFQLLIDEA
FT                   FHPFYMFQIASLVLWSLDEYYYYAVCIFLISVFSICATIFETRTTMKRLREISLFECDT
FT                   RVLRNGFWRTVPSRELVPGDVFEFSDPSLNQVPCDCILLSGDCIVNESMLTGESVPVSK
FT                   IPLTDDALKYLNLSTPSVHPNVAKHFLFSGTKVIRARRPHSVDDGEAIALAVVVRTGFS
FT                   TTKGALVRSMLFPKPSGFKFYKDSFRYITVMGVIAAFGFIASFVNFVRLGLSWHLIIVR
FT                   ALDLITIVVPPALPATLTIGTNLALSRLKGHKIFCISPQRVNVAGKLDIVCFDKTGTLT
FT                   EDGLDVLGVRTNIVHAMATCHSLRVVDGELMGDPLDVKMFQFTGWSYEENGSESIEPHG
FT                   PKYETIMPPIARPPNQISDLSGQIGTSQTVPIELGVLRNFEFVSELRRASVVVRQFGDG
FT                   GATFFVKGAPESLKTICLPDIPHDFDDLLSFYTHKGYRVIACAGRYEPKLSWMRAQKLT
FT                   RELVERDLEFIGFIIFENKLKSSTTGTIAELSNAGIRNVMCTGDNILTAVSVARECGLI
FT                   RADEQCFIPRFAEGESTAPSLTSTNVDLSVPAIACNINKYTLAVSGDVFRWVVDFGSDV
FT                   VLKRMLVRGNVFARMSPDEKHELVERLQSLDYCCGFCGDGANDCGALKAADVGISLSDA
FT                   EASVAAPFTSRQFDISCVPQLIKEGRAALVTSFCCFKYMSLYSAIQFSSVSFLYTSASN
FT                   LGDFQFLFIDLALILPIAIFMGWTGPHPVLSRKRPTANLVSRKVLTPLLGQISICILTQ
FT                   FVAFKTVQSQPWFQPPRIDLNNSNIENSENTALFLISIFQYIFTSIVLSVGPPFRMPMR
FT                   ANKPLIVTIVVDTIVSSYMLFDPPEWIIETMQLTFISRGFAFWLFALATSTFLLSWVTE
FT                   RKFFPLLSRAIGHLKTRLRPGNRKQRRQYKVLLDEMET"
FT   CDS_pept        join(1289638..1289684,1289789..1289868,1289922..1290638,
FT                   1290685..1291112)
FT                   /codon_start=1
FT                   /gene_family="HOG000171827" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19904726"
FT                   /orf_name="AFUA_5G05540"
FT                   /product="Nucleosome assembly protein Nap1, putative "
FT                   /function="binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL92039.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG390350"
FT                   /db_xref="HOGENOM:HBG619916"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000051ED43"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTN7"
FT                   /transl_table=1
FT                   /translation="MSEPIRNKKADFPVAPTPQNTPANNAPISSHAQQPGVASIKEESL
FT                   DHATAASLFARNPGLVSMIQGKLGSLVGRSSGYIESLPAPVRRRVAGLKGIQKEHAKLE
FT                   AQFQEEVLELEKKYFAKFTPLYQRRATIVNGAAEPTDDEVQAGKEEEEEEEVDVKAEDE
FT                   RKQEEKDITTPGIPEFWLSAMKNQISLAEMITDRDEEALKHLTDVRMEYLDRPGFRLIF
FT                   EFAENEFFTNKTISKTYYYKEESGYGGDFIYDHAEGCKIDWKADKDLTVRVESKKQRNK
FT                   NTKQTRVVKVTVPTESFFNFFSPPQPPTDDDDTIATDIEERLELDYQLGEDIKEKLIPR
FT                   AIDWFTGEALQFEELGDDMDADEFDDEDDEDEEEDEDDDDDRRSDRDVDDESEEEVRFF
FT                   SLYASKYIFASTPFFTTMTALPQS"
FT   CDS_pept        join(1292269..1292403,1292724..1296767,1296825..1296898,
FT                   1296952..1297288)
FT                   /codon_start=1
FT                   /gene_family="HOG000171839" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904727"
FT                   /orf_name="AFUA_5G05550"
FT                   /product="Class V myosin (Myo4), putative "
FT                   /function="ATP binding"
FT                   /function="actin filament binding"
FT                   /function="motor activity"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="EAL92038.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="GO:0051015"
FT                   /db_xref="HOGENOM:HBG501769"
FT                   /db_xref="HOGENOM:HBG717149"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR018444"
FT                   /db_xref="UniParc:UPI000052051D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTN8"
FT                   /transl_table=1
FT                   /translation="MAHNYEVGTRAWQPDPTEGWIASEVKEKVVDGDKVQLVFLLENGE
FT                   FLLQQTPSLGLTRSMYHKWYRCTLESTVPRKHPICSPSRRRRLRKPPLRPLLNFYLRAL
FT                   LSDMLRDGKNQTIVVSGESGAGKTVSAKYIMRYFATRESSDQPGKYTTSRADAISETEE
FT                   QILATNPVMEAFGNAKTTRNDNSSRFGKYIEIMFDDRNNIIGAKIRTYLLERSRLVFQP
FT                   LKERNYHVFYQLVAGATDQEKEDLGLTSVEDFEYLNQGGTPTIEGVDDQSEFNATRKSL
FT                   TTIGVPERTQAEIFRILAALLHLGNVKITATRTDSTLSPSEPSLVRACDMLGIDVNEFA
FT                   KWIVKKQLITRGEKITSNLTQQQATVVKDSVAKFIYSSLFDWLVDKINRRLASDEVLNS
FT                   YRSFIGVLDIYGFEHFAKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVREKIDWTFI
FT                   EFSDNQPCIDLIEAKLGILSLLDEESRLPMGSDEQFVTKLHHNFAADKQKFYKKPRFGK
FT                   SAFTICHYAVDVTYESDGFIEKNRDTVPDEHMDVLRNSSNEFVKEILDTAAAVREKDSA
FT                   SISSKPVAAPGRRIGVAVNRKPTLGGIFKSSLIELMNTINSTDVHYIRCIKPNEAKEPW
FT                   KFEGPMVLSQLRACGVLETVRISTAGYPTRWTYEEFAIRYYMLCHSSQWTSEIKEMCHA
FT                   ILQKALGDASHQKQDKYQLGLTKIFFRAGMLAFLENLRTSRLNECAIMIQKNLRCKYYR
FT                   RRYLEARSSILTTQALIRGFLARQRAAEVRQVKAATTIQRIWRGQKERKFYNEIRGNFI
FT                   LFQSVAKGFLCRRNIMDTIHGNAAKIIQRAFRSWRQIRAWRQYRRKVIIVQNLWRGKQA
FT                   RRQYKKLREEARDLKQISYKLENKVVELTQYLESLKRENKSLNSQLENYETQLKSWRTR
FT                   HNALENRTRELQAEANQAGITAARLAAMEDEMSKLQQNYAEAQTIVKRLQEEEKVSRES
FT                   IRSANLELDQLRQLNIEAENDRASLRQQVAELEEQLELAKRSISLNGLNGDAQNSGPIQ
FT                   PPAGGLINLVSSKKSKPKRRSAGAEKIDTDRFSGAYNPRPVSMAIPSSTFGRQNFSGHT
FT                   FSPGLDTVEVELENLLSEEDELNEEVTMGLIRNLKIPLPSSTPPPTEKEVLFPAYLINL
FT                   VTSEMWNNGFVKESERFLANVMQSIQQEVMQHDGDDAINPGAFWLSNVHEMLSFVFLAE
FT                   DWYEAQKTDNYEYDRLLEIVKHDLESLEFNIYHTWMKVLKKKLYKMIVPAIIESQSLPG
FT                   FVTSETNRFLGKLLPSNNNPAYSMDNLLSLLNNVYKAMKAFYLEDSIITQTVTELLRLV
FT                   GVTAFNDLLMRRNFLSWKRGLQINYNITRIEEWCKSHDMPEGTLQLEHLMQATKLLQLK
FT                   KATLNDIEIIQDICWMLSPNQIQKLLNQYLVADYEQPINGEIMKAVASRVTEKSDVLLL
FT                   TPVDMEDSGPYEIAEPRVITALETYTPSCECFNEMVSRILMISRAPNSAFETSCRNSLS
FT                   TGNGPARET"
FT   CDS_pept        join(1298104..1298277,1298349..1298422,1298483..1298627,
FT                   1298681..1298717,1298769..1298830,1298956..1299027)
FT                   /codon_start=1
FT                   /gene_family="HOG000293320" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20752817"
FT                   /orf_name="AFUA_5G05560"
FT                   /product="Non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL92037.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG340523"
FT                   /db_xref="HOGENOM:HBG697237"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniParc:UPI000051F4C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTN9"
FT                   /transl_table=1
FT                   /translation="MIPTVKLNFITSNKNKLAEVKAILGNVVEIDSQAIEVPEIQGSIE
FT                   EIAKEKARRAAEEIGGPVLTEDTALGFRALKGLPGAYIKHFLSALGHDGLNKMLDSFED
FT                   RSAEAVCTFAFCRGPGEEPILFQGRTEGIIVRPRGPLNFGWDPIFEHNGMTYAEMDKEE
FT                   KNRVSHRYKALAKLKQWLEDGTLP"
FT   CDS_pept        join(complement(1299627..1299809),
FT                   complement(1299371..1299519),complement(1299090..1299291))
FT                   /codon_start=1
FT                   /gene_family="HOG000224472" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752818"
FT                   /orf_name="AFUA_5G05570"
FT                   /product="Hemoglobin and proliferation regulated protein "
FT                   /EC_number="2.7.4.9"
FT                   /function="thymidylate kinase activity"
FT                   /protein_id="EAL92036.2"
FT                   /db_xref="GO:0004798"
FT                   /db_xref="HOGENOM:HBG055416"
FT                   /db_xref="HOGENOM:HBG646389"
FT                   /db_xref="UniParc:UPI0000F51B8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTP0"
FT                   /transl_table=1
FT                   /translation="MRKSPNVIITGTPGVGKTVHCEKLAQEVGLRHLSINQVAKDRGCF
FT                   ESYDQDLETWIVDEDKLLDAIEDEVLQGGYLIDWHACDLFPKSWIDLVVVLRCPSTSIL
FT                   YDRLSARKYKEAKLQENLDSEIFGILSEEAREAFDEQIVVELNSEEDDDVETNCARISA
FT                   WIESWKESRPENRE"
FT   CDS_pept        join(complement(1300963..1302017),
FT                   complement(1300675..1300829),complement(1300407..1300618))
FT                   /codon_start=1
FT                   /gene_family="HOG000171840" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752819"
FT                   /orf_name="AFUA_5G05580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL92035.1"
FT                   /db_xref="HOGENOM:HBG055415"
FT                   /db_xref="InterPro:IPR012462"
FT                   /db_xref="UniParc:UPI000051F241"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTP1"
FT                   /transl_table=1
FT                   /translation="MGQDDVHHPACPFCPFSDLDDTFVAQHIEYCHPEAVGQTEPTSGE
FT                   NGDEDRSTPIYQQPQMPGGENVYIKCSQSNGEILPSAEIPYHLDIHAAEDFAVDNAPSI
FT                   YSKRSVTVSKVQNPILPRSHNRTGDDKVPEDPCNVSAQPRVRRGSPDSSSTGNEVTSPL
FT                   LANVSHPGSVKRLGVLYPDWKYLGIALTGAQRAELGPYAHEKRMPTWLRRLLEQGAKKT
FT                   QSNIIGPDGKLSRLDTTDNEASNVIPVLSQLCEQDKSVQRAVFCSPNVRQISKMPREGG
FT                   FCGYRNIQMLISYIQGSHISGHERFTETLPTILQLQDMIEHAWDMGFNSVGRAETGGIR
FT                   GTRKYIGTPEVICEASSIGESRDSHAHDALYAAVAAYFRCACSLDGDEKVFLTNLPPIY
FT                   LQHHGHSLTIVGFEIRDDGGANLLVFDPMFKIPRPMRRLNGPSTLVSLDPTKILKAYRR
FT                   GTAYLQKYKVFELLK"
FT   CDS_pept        join(1302716..1302909,1302985..1303065,1303190..1304471)
FT                   /codon_start=1
FT                   /gene_family="HOG000293094" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16271540"
FT                   /orf_name="AFUA_5G05590"
FT                   /product="Aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /function="amino acid binding"
FT                   /function="aspartate kinase activity"
FT                   /biological_process="cellular amino acid biosynthetic
FT                   process"
FT                   /protein_id="EAL92034.1"
FT                   /db_xref="GO:0004072"
FT                   /db_xref="GO:0008652"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="HOGENOM:HBG236672"
FT                   /db_xref="HOGENOM:HBG724395"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniParc:UPI000051FE56"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTP2"
FT                   /transl_table=1
FT                   /translation="MLNSCICKAACSCHTRPSSMGDQVQSDSSPYTLSMTNGSSNWVVQ
FT                   KFGGTSVGKFALNIIDHVVLPSLRENKVAVVCSARSSSTKAEGTTNRLLRAARDAEDAQ
FT                   SHEYVSLVEAVRLEHVQVVEIQIKSEPLRTQLISEINGECERVLKVLEAAQTLGEISAR
FT                   CVDKVISTGEKLSCRLMAAFLQDRGVDSQYVDLAEVIDFPIGSQGLDQDFYNNLATVLG
FT                   RKIRDCEGRVPVVTGFFGTVPGGLLDQVGRGYTDLCAALVAVGVHAKELQVWKEVDGIF
FT                   TADPRKVPTARLLPAITPAEAAELTFYGSEVIHPFTMEQVIRARIPIRIKNVMNPKGDG
FT                   TVIFPDSTYELERTTPGHDPRLFRTRSPSLMQRPKRPTAVTIKHKILVINVHSNKRSLS
FT                   HGFFAGIFSVLDRWRLSIDLISTSEVHVSMALHSEMPLLNGVGRDEYQIIDEDLKGALN
FT                   DLQKYGTVDIIPEMAILSLVGKQMKNMIGVAGRMFTTLGENNVNIEMISQGRCPYLVLL
FT                   D"
FT   CDS_pept        1307733..1309907
FT                   /codon_start=1
FT                   /gene_family="HOG000171851" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18209539"
FT                   /orf_name="AFUA_5G05600"
FT                   /product="Forkhead transcription factor (Sep1), putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL92033.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG055414"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI000051E685"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTP3"
FT                   /transl_table=1
FT                   /translation="MDPTRSGSFVPPLPEPAAEYDKKGSLSHSQHLSSSCSSSLSLQPP
FT                   ENVHSGQECILDPPLSSALRPSPMKTPRGLKTSLSGRRELGFIPITAPAPPKFTTDSPA
FT                   KRTPSTTYSCNTSSSSAMPQSALFTTFPSANNGKQSSKEKRQLAESCNDNFADFPEPSF
FT                   ASKPLKRTLMDAAPLKERTIKKQKREDVDVTRLPNPEEMSPIEDDGTKPPYSYATLIGM
FT                   SILRAPNRRLTLAQIYKWISDTFSYYKHSDPGWQNSIRHNLSLNKAFIKQERPKDDPGK
FT                   GNYWAIEPGMEAQFLKDKPLRRATMSSLPLPVTSQREPAHTQSSSTTTWAIPPPNHTFV
FT                   PKSSKNVDLSSDATIPASDPALQDDMSDEGVNAATSQAPLRSSPPQPIRSSPPIAPPRF
FT                   IRQGTPPTPSHPTPSATVPHSRQRESTTINDSGYFSSLESSAMRPKKTGHILTSDLDID
FT                   PPRIKRGRAEEEIARIRSSSHDISPRRPGMLTDAGVVTGSSPARGEYVSMLPPPLTPVI
FT                   KFKKPVKPPPSVSPNTNLRNHRKKIQQMVNSPLKNLGLTDEDLPWSPAFRIQDETYTPS
FT                   DHLHATFDVFAESAEEGISTLANGSPEKRPGKRARTDTEDQTGTILADITSESVNSKIG
FT                   MQALSPAKSKSPLFPESPSKVPEYGRFGDATHDDFFSFHLFDESPVEVDGVDLLQGFQK
FT                   IGSSSKEEPARSKSHASRPQLNIRSNTALF"
FT   CDS_pept        join(complement(1311114..1311285),
FT                   complement(1310930..1311060),complement(1310666..1310809))
FT                   /codon_start=1
FT                   /gene_family="HOG000235066" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16271541"
FT                   /orf_name="AFUA_5G05610"
FT                   /product="Cell cycle control protein Cwf14/Bud31, putative "
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL92032.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG020790"
FT                   /db_xref="HOGENOM:HBG328980"
FT                   /db_xref="InterPro:IPR001748"
FT                   /db_xref="InterPro:IPR018230"
FT                   /db_xref="UniParc:UPI000051FC06"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTP4"
FT                   /transl_table=1
FT                   /translation="MPPLRTSRNRKPPPAGFDDIEDTLLEFSNKMKDAENAPHDGKKKH
FT                   EMLWPIFQISHQRSRYIYDLYYEKEAISRQLYEWLLKNNYADANLIAKWKKQGYEKLCC
FT                   LRCIQTKETNFNATCICRVPKAQLKEDQMIQCVSCGCRGCASSD"
FT   CDS_pept        join(complement(1313144..1313157),
FT                   complement(1313053..1313098),complement(1312696..1312982),
FT                   complement(1312542..1312629))
FT                   /codon_start=1
FT                   /gene_family="HOG000231365" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20752820"
FT                   /orf_name="AFUA_5G05630"
FT                   /product="60S ribosomal protein L23 "
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL92031.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG439330"
FT                   /db_xref="HOGENOM:HBG532383"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniParc:UPI000051E425"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTP5"
FT                   /transl_table=1
FT                   /translation="MVYHHDRAGAAAKAVLKGTGAHKSRKIRTSTTFHRPKTLQLSRSP
FT                   KYPRKSIPHEPRLDAHKVVLYPLNTESAMKKIEEHNTLVFIVDVKANKRQIKLALKKLY
FT                   DVDTVKVNTLVRPDGSKKAFARLTPDVDALDIAATKLAIV"
FT   CDS_pept        join(complement(1315812..1316091),
FT                   complement(1315190..1315749))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904970"
FT                   /orf_name="AFUA_5G05640"
FT                   /product="RTA1 domain protein, putative "
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL92030.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG055413"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI000051F4A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTP6"
FT                   /transl_table=1
FT                   /translation="MEKTPDCLPYSLNIPTPFGYRPSLVAGIIFMILFLGVTIVHVWQA
FT                   FRHRNIWLGLAFSLGTFGELVGWLGRTVAYRCLYSVKLLEMQLAALIMAPAFTTAGIYG
FT                   VLGLMIPIIGQDKSPLQPNLYLIIFMMVDFFSLLLQAVGGGLAGAAFSQNSSPWPGTYT
FT                   MVAGIIWQLVSTCVFATLVEYVPWPRTDCAESSPAADLAVVDDCGYVYGGAGRVSEHGV
FT                   DEWVARVSVYARGVCNYSRCGIDVHCKFGAVCLEPSSFGPGCEGECKKDASWGGIEM"
FT   CDS_pept        join(complement(1316788..1317003),
FT                   complement(1316508..1316663))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19904971"
FT                   /orf_name="AFUA_5G05650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL92029.1"
FT                   /db_xref="HOGENOM:HBG055412"
FT                   /db_xref="UniParc:UPI00005202CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WTP7"
FT                   /transl_table=1
FT                   /translation="MTAIMYDRGSIRRAEASQQIALLVERISLSSNMQYGDVNPQRHRA
FT                   RIIPLEYGEIMLLLAATCPLFGGWVTWRVGFAGFVSWFPFHGGERKFMALLSLQMQGMK
FT                   QTLWRSICRDSDNPKRRST"
FT   CDS_pept        1318646..1319506
FT                   /codon_start=1
FT                   /gene_family="HOG000171862" [ FAMILY /