(data stored in ACNUC8465 zone)

HOGENOMDNA: ASFUM1_6

ID   ASFUM1_6; SV 1; linear; genomic DNA; GRV; FUN; 3778736 BP.
XX
AC   CM000174_GR;
XX
DT   28-JUL-2009 (Rel. 109, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 19)
XX
DE   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293) chromosome
DE   6, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; Neosartorya.
XX
RN   [1]
RX   PUBMED; 16372009.
RA   Nierman W.C., Pain A., Anderson M.J., Wortman J.R., Kim H.S., Arroyo J.,
RA   Berriman M., Abe K., Archer D.B., Bermejo C., Bennett J.W., Bowyer P.,
RA   Chen D., Collins M., Coulsen R., Davies R., Dyer P.S., Farman M.L.,
RA   Fedorova N., Fedorova N.D., Feldblyum T.V., Fischer R., Fosker N., Fraser
RA   A., Garcia J.L., Garcia M.J., Goble A., Goldman G.H., Gomi K., Griffith-
RA   Jones S., Gwilliam R., Haas B.J., Haas H., Harris D.E., Horiuchi H.,
RA   Huang J., Humphray S., Jimenez J., Keller N., Khouri H., Kitamoto K.,
RA   Kobayashi T., Konzack S., Kulkarni R., Kumagai T., Lafton A., Latge J.-
RA   P., Li W., Lord A., Lu C., Majoros W.H., May G.S., Miller B.L., Mohamoud
RA   Y., Molina M., Monod M., Mouyna I., Mulligan S., Murphy L.D., O'Neil S.,
RA   Paulsen I., Penalva M.A., Pertea M., Price C., Pritchard B.L., Quail M.
RA   A., Rabbinowitsch E., Rawlins N., Rajandream M.A., Reichard U., Renauld
RA   H., Robson G.D., Rodriguez de Cordoba S., Rodriguez-Pena J.M., Ronning C.
RA   M., Rutter S., Salzberg S.L., Sanchez M., Sanchez-Ferrero J.C., Saunders
RA   D., Seeger K., Squares R., Squares S., Takeuchi M., Tekaia F., Turner G.,
RA   Vazquez de Aldana C.R., Weidman J., White O., Woodward J.R., Yu J.-H.,
RA   Fraser C.M., Galagan J.E., Asai K., Machida M., Hall N., Barrell B.G.,
RA   Denning D.W.
RT   "Genomic sequence of the pathogenic and allergenic filamentous fungus
RT   Aspergillus fumigatus.";
RL   Nature 438:1151-1156(2005).
XX
CC   This Genome Reviews entry was created from entry CM000174.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3778736
FT                   /organism="Aspergillus fumigatus"
FT                   /strain="FGSC A1100 = CBS 101355 = Af293"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 6"
FT                   /db_xref="taxon:330879"
FT   mobile_element  complement(16590..17297)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(17706..19106)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(25150..26166)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  28131..29126
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  29129..29671
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        32555..33661
FT                   /codon_start=1
FT                   /gene_family="HOG000114319" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262203"
FT                   /orf_name="AFUA_6G00110"
FT                   /product="Dihydrodipicolinate synthetase family protein "
FT                   /EC_number="4.2.1.-"
FT                   /function="lyase activity"
FT                   /protein_id="EAL84256.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG345237"
FT                   /db_xref="HOGENOM:HBG370502"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000520792"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8W3"
FT                   /transl_table=1
FT                   /translation="MLCACPTYFRESESNSTFCKHVRRYSTEIKRQLPQECNAQKYHTS
FT                   SQHSLEVRTFLVNMVGFDMCGLTPAPVTPFTQDGAVDYEAIQRLGSWLGSIDGVKGLVV
FT                   LGHAGEGTFLTAEEQVSVIKAFVKSVDGKVPIIAGITGEGTEVAALEAKRAKEAGAAAG
FT                   LLYPSHGWLRFGYQRGAPQHRYRRVYEVSGLPLILFQYPDNTKATYDLQTMLDIAAQPG
FT                   CFAMKNGVRNMRRWDTEIPIIRAQRPDLQILSCHDEYLLHTAFDVDGFLVGYGNIAPEP
FT                   LIELIKAGKAKDYKKAREIHDRLLPVTKSVYHRGSHMEGTVALKHGLVARGILEHATVR
FT                   SPLLPLEPGAEQEIHAAINAASLSKVVV"
FT   CDS_pept        join(34609..35939,35995..36790)
FT                   /codon_start=1
FT                   /gene_family="HOG000234843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262204"
FT                   /orf_name="AFUA_6G00120"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84255.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056571"
FT                   /db_xref="HOGENOM:HBG326056"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051EB23"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8W4"
FT                   /transl_table=1
FT                   /translation="MSRRSLGTTTPPSHPPASLPRSESPRASVTKRPLNTTNKSGDDEN
FT                   RRKDPKVSRACDTCKKKKIRCDGTIPCTNCTKRKVSCAYDMKYGRGRPPTPPSSAAIRE
FT                   HQNRLRSNYSYDLSNWQPPVSVAPEISSPLVHSRASPTGEIEGQYFDPTSGLNFLHRAW
FT                   KKLLTTQNDQPASYRLSVSEQNQLLTSAGDRPFHIESDALDSFIPDASTARKLQQFYFE
FT                   TCVVTYRMFHRPSVEGWMEIFLKDGQGAGPTARSLGKAKTATLLTIMAIANLRLHRVSG
FT                   ETSTEAESLALKRSDHLFCAGMRMTEEEIGFPRLESAQARLVQVLYLLQTSRINKAWYT
FT                   FGNAFQITLSLGMHRRRDQKRDYPFTSRRQDYITSECYKRTFWVAYTVDRYLSVVLGRP
FT                   RLYQDEDIDQNFPDTVNDEDMTPDGFSISDDPADCYIDALIYHAKIAQIIGKISREVYS
FT                   VSELYSQNRLAAAHRLGRELHEWRESLPPHLGTVKPTTLIPSFRRQAIALQLAYFHAII
FT                   HAYRPFLLSDAASEIVSECILATKACLELINKVARDSMLFHSFWWTHYVIFCALAVVYV
FT                   WEIQRTTRSLVETVDTSLGKIFELAEKCHGHLKRASTGLSQNQRYSVILDELRSEAQRC
FT                   RSLTTNPPKIDQEGACGGEASANANNGFRLLQDPNMFGTGLEAILPEGVMLNMPDSFLF
FT                   NDWQTLDSSVCISV"
FT   CDS_pept        join(37152..37274,37464..37607,37669..37820,37875..38979)
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750568"
FT                   /orf_name="AFUA_6G00130"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84254.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG328895"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051F73D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8W5"
FT                   /transl_table=1
FT                   /translation="MADKDAAVMHLEDQTSQGITADDAEFLENFTDEAKKKVLRKCNSL
FT                   NPMRPPSHLEQEMQRSKASFQAYTWTAYSTISPCPSFSFLMSLLVPSNIILNRLKRPSR
FT                   YLGFLIFCWGVIMLCTGFVENFAGLVVIRFLLGLFEAGFLPGAVLVISKWYLPNETQTR
FT                   IAILYTSAASGGAFSGLLAFAIAKMDGTAGYEGWRWVSSSWLSFVPSSNSHSRQIFIIE
FT                   GLVTVGMSVACYLLLLDSPSLSPGWLTPDEIRFLEVRQLASSSHSAHDGAFSKRVIFSV
FT                   LTDWKIYLLILANWSNAVPNYALKFSMPEIVKSMGYKSAKAQLLTIPPYAIGAASAYGF
FT                   SVFADRSSWRMPFIVVPQMSLIVAFSILFSKAADIENNIALCYFGICLACFGMYPILPG
FT                   VNSWNICNIPNPQKRAVAIGYLICTGNAGGIIGSYIYKADEKPRYPTGYGTSFAFAAAG
FT                   IMACLVLEFSLWTANKKKGRMSRAEVEEIYNEDQLREMGEKSPHFNYTL"
FT   CDS_pept        41091..42758
FT                   /codon_start=1
FT                   /gene_family="HOG000048664" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902571"
FT                   /orf_name="AFUA_6G00140"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84253.1"
FT                   /db_xref="HOGENOM:HBG056562"
FT                   /db_xref="UniParc:UPI00005202D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8W6"
FT                   /transl_table=1
FT                   /translation="MPEKKRVRQTTTALFTQFPTNGRIPFKQVVQATWVATFALFIGIC
FT                   FVLAVAFSADGKPTSSNKWYEYTPTFVALGAVILRGSVAALLGIALYQNLWQNVAAPAK
FT                   ANEEGGIPLKRIESLHLASRLAVGMLASPLFRAGWIIGFLGLAVTSAVQPVLQSAITVR
FT                   QERQVIPMSLPIYHPQFNGSLAQSDSAAMLAGGPMTISRRSAVAALMGDKSGLRYTDVN
FT                   VTGLANFGPVKYLDVTCDIEAVPGIKSNKGGWDLYNFTYRYPDAEGDLAKFRDVFNTSV
FT                   LYDGVEILLAAKSKVEVQAVMFNNTHYLRHLCMVQTAIGSCATPITAGIGSMGDLACLR
FT                   DQFINVDSDLDTPGSFYGPAGGVISLFSSFLEVFAGKALLDIRGRLNPGKSMFMMGTIV
FT                   AETDKTLVMPSDLLSHMQRVLWVTPLLAKSGTPEQEALNVTMSVLDGRNVIVYQVDKPR
FT                   IIVTVAVLLIIGLVCLVYLTLSSSGACGRLTKDSLVHSLTVAGPNGPAIKGACLASLEE
FT                   ILDKAGDERLKVWCTSSGNGICKRTSWICRTASRSGIS"
FT   CDS_pept        join(49283..49595,49676..51363)
FT                   /codon_start=1
FT                   /gene_family="HOG000217780" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262205"
FT                   /orf_name="AFUA_6G00160"
FT                   /product="Ser/Thr protein phosphatase family protein "
FT                   /function="hydrolase activity"
FT                   /biological_process="nucleotide catabolic process "
FT                   /protein_id="EAL84250.1"
FT                   /db_xref="GO:0009166"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG056538"
FT                   /db_xref="HOGENOM:HBG326797"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR014485"
FT                   /db_xref="UniParc:UPI000051EFE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8W9"
FT                   /transl_table=1
FT                   /translation="MMRSHTALSIAALLALARVPCTVFGDNIIYPQQQKEAFNATEIPR
FT                   APLPWGRVNFLHTTDTHGWLDGHANVPSWGADWGDFVSFVMHMKDKALRKKVDLLLIES
FT                   GDFHDGGGLSDSTSPKGAVSDSIFENIDYDLVTIGNHGVRTWAEALNIHYNLSRVFGDR
FT                   FLTSNVDVEEDKKLKSIGNRYRAFQTRNGLRIVAFGVTVNDPILRDLNHTEVHNASWIF
FT                   EQEWFAEAMKKEADLYVIVGHIPTYASCLDPTKDNPMVCLRDRIRNSTDKPIQLFGGHA
FT                   HHRNFTCYDDRSSGIESGKYCDTVGWVALNNVLSPTWSGTKELLGDDLHPNKSCAVGRQ
FT                   GDTHDAPYLLDRRYLDWNRVTFAYHTVNLEGNTDNPSVPASFDMPLGRKVTDDISKARQ
FT                   LLNLTHFLGCAKEEYCFNCKKVGQDGNIYELLKVALADTVVNKERAHLARVVISNDGTI
FT                   RDNIYQGPFTTGDAYAVVPFPNHFLYIANMPCHHFKKMTSSLQAKQNVSCIDDDDYDEP
FT                   YVIKKEGHRSQYQAHLELRNIFDYHSDHQARERKEYSPGYTTHDALGNDGDDTLHSPVI
FT                   EDERYMKLFWANASFPNLPQYPPSFDVVFTDYLAPRILGALKRIGAPYTQKDVIDYLPR
FT                   TYTSRDVLVDYTARNWDQDRDNCHIQKPGDR"
FT   CDS_pept        join(complement(55906..56057),complement(53457..53545),
FT                   complement(53313..53401))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207153"
FT                   /orf_name="AFUA_6G00180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84249.1"
FT                   /db_xref="HOGENOM:HBG056529"
FT                   /db_xref="UniParc:UPI000051ED58"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X0"
FT                   /transl_table=1
FT                   /translation="MAGYKVNCKNGYSLEVGADGGQAWYGTPHGNFRWTQGYDRSDNFI
FT                   VWDNWRGIMNFMLAFVTPIAMVPNYEKRVRMIFQSGSSAEGGSGCCNHSVDVFSASNLK
FT                   VRSNC"
FT   CDS_pept        complement(57953..58330)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055868"
FT                   /orf_name="AFUA_6G00190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84248.1"
FT                   /db_xref="HOGENOM:HBG056521"
FT                   /db_xref="UniParc:UPI0000520791"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X1"
FT                   /transl_table=1
FT                   /translation="MTYTDTSLVYTSLFVCPEVWSTSSYYYEHGNNSTTSCQNKNLAQA
FT                   IKDLSHNFTYSLLSLNGGNTTVDMTDLTCRNYYSYGSTALLGVYLSALAVMIACVVVGF
FT                   LALRRNGVSYNNSFSGVLLTT"
FT   CDS_pept        join(complement(60771..60842),complement(60424..60659),
FT                   complement(59907..60156))
FT                   /codon_start=1
FT                   /gene_family="HOG000048663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902572"
FT                   /orf_name="AFUA_6G00193"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /function="metal ion binding"
FT                   /protein_id="EAL84247.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG056513"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniParc:UPI00005202D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X2"
FT                   /transl_table=1
FT                   /translation="MIYACTFPNCWGRCTLRSSFTATCQTISTSEYCRTRITSIIVWDT
FT                   LSLSALSQIVSKEPRCYFFSQIAEEPCCNTLRTKEQLGYIANSAVVVYVMAGTWRILLP
FT                   CTLTNSIDQISTVYHDVEHIEPFTKKDIHEFPNQDIHPTSPVAQSCLYILLHGHLLELL
FT                   EETELQLKKILTLQCWMKIKTD"
FT   CDS_pept        join(complement(63892..63951),complement(63549..63743),
FT                   complement(63453..63464))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262206"
FT                   /orf_name="AFUA_6G00196"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84246.1"
FT                   /db_xref="HOGENOM:HBG056505"
FT                   /db_xref="UniParc:UPI000051F9AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X3"
FT                   /transl_table=1
FT                   /translation="MLGLAVCPFLPSFQLKRLCCCLFHQTIVPTAPQILQDFHSRDRIH
FT                   QTLLVTIWELGEGIGPFFIAPLSERFGRLPVLHLGKGGGWTFY"
FT   CDS_pept        join(complement(66332..66958),complement(64585..66261),
FT                   complement(64415..64510))
FT                   /codon_start=1
FT                   /gene_family="HOG000217679" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262207"
FT                   /orf_name="AFUA_6G00200"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84245.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056496"
FT                   /db_xref="HOGENOM:HBG327554"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051E68F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X4"
FT                   /transl_table=1
FT                   /translation="MAQDQDNFPRTTSPPRKRRRPPKSCDPCRRRKVRCDREVPCGPCQ
FT                   RARTSLHCFYRPAVTARSPSTDEDCRLTASCGPEGHTPPPQAVDLQTKIRPAAPTAQSQ
FT                   PQGPNYDQTKIIQDLQNRVRRLEEQLCDLPLSKGAIGPNPSVSPSQALRHLHDRVRGAE
FT                   QQLSDASRPSPSVNGWTIPTTLPRLRIAPNKTKLFGPSHWLHTAEKFQVIGKFDAKEVE
FT                   PSLQDVDTRSEFASIFKDCRQLRQAIKDQESVRLNHPVPDLLGTLPTQAVCDVLVNAYL
FT                   RTFELIYRVIHIPSFWKEYRQLWTQPQSTATSFLMKLVLILALGTTFHPDRNNRVHLRR
FT                   LAHTWIYAAQWWLVGPSEKSTVNLDGLQVGCLLLLARQTNSLPATSWLSAGSVLRMAMA
FT                   MGLHRSPDHFPALSGYQSEMRARLWATVLELTLLSSLDASMPLPFSLEDFDCTAPSNAN
FT                   DEQFDPEAETLPTPQSNEHFTDSSIQILLLKCLQSRVEAVQLLNNQHGRELSYETALRL
FT                   GNELRSACRDIAALFHTSQNQPKQGGRTPGMTDFHLRFLDMYLRRYILFLHRPFMMKAR
FT                   TDPRFYLSRKVCLESCIVIASYAEHLNLPSDTLDDISHLTIVGRGSFKGALSFDVITSL
FT                   GLEIITQLEEEASTRSVGTPAPIIADPLDKMAKAHREPLIRSLEHIQKQLLQIIALGQP
FT                   SLKRYNFLSAILSQIRAMESGQPIQPAIYETVKESLRKSYSLLQASHAARRAQDSVESL
FT                   NMGTDSPLGFDLDALDPALGLEIPSLLFFPGIMNTLSTDVSNQCYN"
FT   CDS_pept        join(67495..67777,67856..68143,68239..68249)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262208"
FT                   /orf_name="AFUA_6G00210"
FT                   /product="Monocarboxylate transporter, putative "
FT                   /protein_id="EAL84244.1"
FT                   /db_xref="HOGENOM:HBG056487"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051E8D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X5"
FT                   /transl_table=1
FT                   /translation="MYLESHPWNVCHCAMYLRSALGQLTIPVFFMPFTSPLAGKWFDCY
FT                   GPHLPIAIGSGLHVFGLLMASLSHKYYQFTLSQSVMSGIGSSLIFIPAMNLVPSEGAIV
FT                   GGLAVAGSSLGEVIFPLMVQHLLPQVSFGWTMRIIAFLIMGLLVIASLTISSQFRHAPR
FT                   PFSVMHYRGPLWKLNLDLLCVASFFMYYRR"
FT   CDS_pept        join(complement(70686..70894),complement(69772..70540),
FT                   complement(68506..69723))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262209"
FT                   /orf_name="AFUA_6G00220"
FT                   /product="Fungal specific transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84243.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056480"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051FC1C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X6"
FT                   /transl_table=1
FT                   /translation="MSSCSKGSRHRYIVLGHISSHLKSKRTLPPLLRCVQSNDTAEVWC
FT                   VLWRHPPPSSVLRSACSAFPTPHVFYCVHTRIRCVYPPTEAGKRSAAQENRDLQDRIVN
FT                   LEQRLSVLEQAVPTTRNLLQTPSDQPDSDSPHIDDGSLVGMGNHGESQNVQLPILFSSK
FT                   GHDDSPPESASQPTPPRVRLALPVLREVDQRPLNSTMHEPTMTIRLWQTYLEFVDPLLR
FT                   IFHTPTVQRYVVDSMVNEGTLDVSRRCLLFAIYYSAIVVVPAKSCHSIFGTHKTFLLER
FT                   YVGPISACNMTDLARYRHQVEKAFAEANILRCQDLTLLQAFVLYLTTGRRDERGPDVSV
FT                   FIGPVIDIAYTIGLHRDGADDKLPPFDVEMRRRLWWHIVTLDVRIAEDSSTEPRTSLLS
FT                   FSTKMPSNTHDICLDPDMGSTPVCQFGKTEMTFSLIRFTVTEFALRSLFGKQSWKVADC
FT                   APLDRQRRINELDQLKERLEVRYLSCCDETIPFDFVVAESTRLVLAKIGMYLRRPPLTE
FT                   HNTAQPFEPTYWKECVDILGHAYSLRRYEKGAKWLWLFQTYVEWDALAYLLVCLCFDRC
FT                   AAGAELAWKTAKDVYKYWREDPDVRRDRRWKQVEDLWQEAQFGRMRDHMVSRHSQPTAP
FT                   GQNPGLTNALNNLSCSDQPTYTRRLNHASLTTNGGPQDFRCEQNYQPSDSPLVNTPPTG
FT                   DTADVPTSGTHCEWSAVIFERYFNVLDKNSDVVSGLI"
FT   CDS_pept        join(70944..70973,71030..71440,71494..71946)
FT                   /codon_start=1
FT                   /gene_family="HOG000158905" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902573"
FT                   /orf_name="AFUA_6G00230"
FT                   /product="NmrA-like family protein "
FT                   /EC_number="1.3.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84242.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG050941"
FT                   /db_xref="HOGENOM:HBG329511"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EB22"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X7"
FT                   /transl_table=1
FT                   /translation="MAYKNVVLVGAGNIGRIILRGLEDSSQFNITVLSRKESSAVFPDS
FT                   VNVWKTDYSKSDLEAAFTGQDVVISALGALGFTEQRKLVDAAVQSGVKRFLPSEFSCNS
FT                   QNGTVIELLPLFQQKADIIQYLKSKESTGLTWTSLVTSLLFDWGLENGFLGYDISSRTA
FT                   TIWDDGNKKFTLTNEGHLSKAVVSVLQRPNETKNQILYIASVETSQNEILNAFETVTGC
FT                   KWSIIRTTTEEQVTEARMKLSKGDFDGALTLVRATSYSNLPGLKSNYAKGFKVANDILG
FT                   LEWANVEDTVRTVVSK"
FT   CDS_pept        join(73095..73219,73330..74290,74613..74693)
FT                   /codon_start=1
FT                   /gene_family="HOG000225393" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902574"
FT                   /orf_name="AFUA_6G00240"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase, putative "
FT                   /EC_number="4.2.1.-"
FT                   /function="lyase activity"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /protein_id="EAL84241.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG053492"
FT                   /db_xref="HOGENOM:HBG333932"
FT                   /db_xref="InterPro:IPR012307"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniParc:UPI000051F251"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X8"
FT                   /transl_table=1
FT                   /translation="MIRKTLPRSSHLQALWWQKIICPAENRIRTHSAIAPCSIYRILSL
FT                   GQHPSHHLDHKIQAAAEAGYKGIEIVYFELEAFSQAQHISILEGAEKIRLICQKLNLDI
FT                   LSLAPFENYEGDRSPLSDRLQNARHWISVARVLNASYLQVPSNYKLDAIGDKDVVISEL
FT                   KQLADIGSAEQPVVSIAYEYLSWGTHCSTWEVALQYVNGVDRPNFGLCLDTFHEATKLW
FT                   ADPFASSGRFPDSDRSLRESLNRFVSTCPVEKIFFIQLSDGERFDPPFSKGHPWYVQGE
FT                   APQFTWSKHARLFPLEHDHGAYLPITEIAEAWIHGVGFKGWVSMEIFDRRMRDRRTQPE
FT                   TAAMRGLRSWRTLRRELEPVSKCATAIGNTCSKHLTKSKGPFYRNSPQ"
FT   CDS_pept        join(75194..75326,75386..75616,75768..76288)
FT                   /codon_start=1
FT                   /gene_family="HOG000048662" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262210"
FT                   /orf_name="AFUA_6G00250"
FT                   /product="GPI anchored protein, putative "
FT                   /protein_id="EAL84240.1"
FT                   /db_xref="HOGENOM:HBG056457"
FT                   /db_xref="UniParc:UPI000051ED5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X9"
FT                   /transl_table=1
FT                   /translation="MHAVATVTWGAAVGLALGQLTELKTMELELNAYDTILLYVPRVMN
FT                   VQANSLPYKRDEEEGDDESYGSGNSEDRQEQRLQAVFSEDYFQQIIRLLTALARLPALK
FT                   SLSLRDYYSQPVRHEYVTRSILNMVFHTPEVFGKRLGDVQYRNPLPHMSIEAVCIALLT
FT                   HAKFSLRHLDIELLENGSMCGCRHEPFLEPYRPYLSINPTAPPTTNWRWNEFTQLERLT
FT                   LDIHLFSNLEGNGWLPFAQTLPASIQDVVILAPRCPPGADMLDFQNMFHDFNPQNFSIF
FT                   RPINAVATSTLGL"
FT   CDS_pept        77546..78754
FT                   /codon_start=1
FT                   /gene_family="HOG000268409" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750569"
FT                   /orf_name="AFUA_6G00260"
FT                   /product="Phosphatidylserine decarboxylase family protein "
FT                   /EC_number="4.1.1.-"
FT                   /function="phosphatidylserine decarboxylase activity "
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="EAL84239.1"
FT                   /db_xref="GO:0004609"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="HOGENOM:HBG007377"
FT                   /db_xref="HOGENOM:HBG298423"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="InterPro:IPR022237"
FT                   /db_xref="UniParc:UPI0000520793"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y0"
FT                   /transl_table=1
FT                   /translation="MLAHSMFDEVPEKAPYDRDPTTLKKQVRNYKTMLYLFNTLLTEVP
FT                   EYFLVNDPDVPSGLIGFPFNVIVDWPMGTQSGRQFFLDPRVNGCLKAILNKWNDFLSDP
FT                   TGGTGQEGGGNQALIDAGWSSDIAVQQLEKKANDATPGSKRKFTELFIHSEGGTQENFF
FT                   KYACWDDFFTRKFRPGVRPVGDGAVVNACESFPLSFDTDVSGRTTFWLKGMPYSLHDML
FT                   GATQDDRVSQYVDKFVGGTVYQAFLSADSYHCWNAPVSGTVVYQSRIDGTYFAETPASG
FT                   FGGSSGPDPAGPDMSQRYITHVAARGVLIVNTNVPNGSQVGFVGFIPVGMSEVSTCRWE
FT                   DKIVEGCTITKGEDIGAFHSGGSTHCLIFERAYARRLKFDPRAQYPEIATANLAVNSTL
FT                   ATL"
FT   CDS_pept        join(complement(79772..79886),complement(79542..79720))
FT                   /codon_start=1
FT                   /gene_family="HOG000166136" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262211"
FT                   /orf_name="AFUA_6G00270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84238.1"
FT                   /db_xref="HOGENOM:HBG050846"
FT                   /db_xref="HOGENOM:HBG331784"
FT                   /db_xref="UniParc:UPI000051FE61"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y1"
FT                   /transl_table=1
FT                   /translation="MVKIAILPLAVLAALAPFAAADNCKTGLNYCGYNLLNIGNYAAQV
FT                   NGALEAAGQPTDDAHIRESLFHCNGGSNGDISFITYCGGGCTDGGSGRSDYC"
FT   CDS_pept        82982..83917
FT                   /codon_start=1
FT                   /gene_family="HOG000254185" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262212"
FT                   /orf_name="AFUA_6G00280"
FT                   /product="NmrA-like family protein "
FT                   /EC_number="1.3.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84237.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056438"
FT                   /db_xref="HOGENOM:HBG334425"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E42D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y2"
FT                   /transl_table=1
FT                   /translation="MAGCAKILVIGAGELGNQVLHALAQHPNRGGATIAVLLRPSSIAS
FT                   THPDKVKELEELRNLNVQLIPGDIAKDSEEQLSDIFGEYGTIIGCTGFAAGSGTQLKLT
FT                   RAVLAAQVPRYVPWQFGVDYDIIGRGSAQDLFDEQLDVRDLLRSQNRTKWAIISTGMFT
FT                   SFLFEPWFGVVNFKGDTVTALGSLDTKVTVTAPEDIGRITAEAVLGSRADSVFGDKPIY
FT                   VAGDTLTYEQLGQLVERITGRKFTRHVRTVEAARADLARDPGNTLFKYQIVFGEGRGVA
FT                   WDLSETWNCQVGIRALTAEEWARRNLQNIM"
FT   CDS_pept        join(84596..84927,84989..85706)
FT                   /codon_start=1
FT                   /gene_family="HOG000214639" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902575"
FT                   /orf_name="AFUA_6G00290"
FT                   /product="Aminotransferase, putative "
FT                   /EC_number="2.6.1.1"
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="L-aspartate:2-oxoglutarate aminotransferase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="EAL84236.1"
FT                   /db_xref="GO:0004069"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG416157"
FT                   /db_xref="HOGENOM:HBG685856"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051E68E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y3"
FT                   /transl_table=1
FT                   /translation="MNYGPSFTGLETLRMNIAALYGSESEAVISPSNIITTPGASLANF
FT                   IVFFALVGPGDHVIVQNPTYPQLYSLPSGLGAEVSLWQASESNHWQLDLDELERLIQPN
FT                   TKMIVLNNPQNPTGAIITKSALGKIVDLARRHSITIFSDEIYRALFHSIPPTDPEYPPS
FT                   LLAFGYEKTVVTCSLSKTFSLAGIRVGWIASHSSSIIDLCLNARSYTVITVSQIDEQVA
FT                   AMALEPVRLRELTKRNLGLATHNIEIVQSFIDRHAAVCEWVRPAAGPVGFVKFSRNGVT
FT                   VDDLELCILLLEKKGVLLVPGQKCFGEEFKGYVRLGFGQSTQALEAALEALTTFISEDY
FT                   EMVPLAERK"
FT   CDS_pept        complement(85851..87692)
FT                   /codon_start=1
FT                   /gene_family="HOG000206826" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262213"
FT                   /orf_name="AFUA_6G00300"
FT                   /product="Serine palmitoyltransferase 1, putative "
FT                   /EC_number="2.3.1.50"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="serine C-palmitoyltransferase activity "
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL84235.1"
FT                   /db_xref="GO:0004758"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG344231"
FT                   /db_xref="HOGENOM:HBG591819"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051F9AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y4"
FT                   /transl_table=1
FT                   /translation="MPRWKRKGKPLTSANDSQPLLTTTTTGEDGRSPSESHSIALSSLR
FT                   AVSSETCNATEAQRLAKQHAEFGPLGHPSHLYVSKHSGGEIADPVLDEPPYFTAFTTYI
FT                   SFLILIFLGHFHDFCDKYFRSHTYKHLRPQNGYASLYSDFESFYTRRMKRRINDCFERP
FT                   TTGVPGRYITLLDQQSNDNLHFRLTGTTTDTLNLSSYNYLGFAQSEGPCSDLAEETIRQ
FT                   NGITMAGSVAEPGTPQLHAEVEQLVARFVGKEDAIVFSMGFVTNATIFPALMEKGCLIL
FT                   SDEFNHASIRFGARLSGAAIQVFSHNNMADLERRLREAISQGQPRTHRPWKKILVSVEG
FT                   LYSMEGTMCNLPRILELKKRYKFYLFVDEAHSIGAIGPRGRGVCDFFKVDPAEVDILMG
FT                   TFTKSFGANGGYIAADKALIKKLRATNAGQVFGEAPAPAVLAQISSSLRLIADEDPQHP
FT                   GQGLERVQRLGFNSRYLRLGLKRLGFIVYGHDDSPIVPLMLYNPAKMPAFSHEMLRRKI
FT                   SVVVVTYPATPLELSRARLCVSAAHTKDDLDHILRVCDEIGNTLGLKYSTGVAGGLREP
FT                   LPPGLSAREARKLISPPRWNVEEVIERGVRDVHNPLY"
FT   CDS_pept        join(88642..88816,88866..89011,89063..89483,89542..90283,
FT                   90318..90381)
FT                   /codon_start=1
FT                   /gene_family="HOG000183569" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207154"
FT                   /orf_name="AFUA_6G00310"
FT                   /product="Serine carboxypeptidase (CpdS), putative "
FT                   /EC_number="3.4.16.-"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL84234.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG052604"
FT                   /db_xref="HOGENOM:HBG327432"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI000051EFE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y5"
FT                   /transl_table=1
FT                   /translation="MHFAVIVITLLVASSAVALENPHRKAVRPIKLDHGHLKPRAVTVA
FT                   DDGGYKYLNKQTQRFLVNGTGIPEVDFDVGESYAGTLPNTPAGNSSLFFWFFPSQNPKA
FT                   HDEITIWLNGGPGCSSLDGLLQENGPFLWQSGTYKPIRNPYSWTNLTNMVYVDQPAGTG
FT                   FSPGPSTVNNEEDVARQFKSWFKHFVDTFNLHGRKVYITGESYAGQYIPYIASAMLDEK
FT                   DKKYFNVKGIQINDPSINDDSVMIYAPAVSHLNQYLNVFSLNDTFVKHINKRAEECGYN
FT                   KFLDEAITYPPPKEFPVAPDPSKNNCALWDDIVEAAYYVNPCFNFYHLTDFCPYLWDEM
FT                   GFPSLAGGPNNYFNRSDVQKALHVPPTDYSVCGETTIFAKGDQSVPSALGPLPSVIERT
FT                   NNVLIGHGWLDYLLFVNGSLATIQNMTWNGAQGFQHPPVEPLYVPYHYGLAELVTSTAP
FT                   NPYTLNAGAGYLGTAHTERGLTFSTVYMAGHGKENHLNPAVHAWSSLPSIGIPARPY"
FT   CDS_pept        90749..92137
FT                   /codon_start=1
FT                   /gene_family="HOG000181279" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902576"
FT                   /orf_name="AFUA_6G00320"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL84233.1"
FT                   /db_xref="HOGENOM:HBG056413"
FT                   /db_xref="UniParc:UPI000051E42B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y6"
FT                   /transl_table=1
FT                   /translation="MSTRDPLFIAQEAVCFYPISTIYDSCPRYLFYALLLASCVTRWTG
FT                   WLADVFLGAAATYAGVAAIQAFILVSSPSSPADPGPVTIPYLPKNTSLWDRFPQLITGR
FT                   ENVIVRPAAVELDADAVSAIVITGYLVFLPLQCWSRVLSQERIRVILFYLWNILMFAGS
FT                   ICALIYSSTAKNTPTQSMFCYPDLPPFDESSSDGWQASWRTSTWNNSVWSIFSNVTLWG
FT                   QLGDICFNPCFNSSQILRQQTSLEVWVATSRSELDHPHSFWNKFIYSRRYIYSLLGVTV
FT                   ILNIILLVSRFFPYRSRIPSVQMVVVWRERKAIWTSFREGFCLLKELACQNDIPSRKIS
FT                   TWHRCRSILSRRFAKECLRLLADSLILIGLLLSIIISPLTLVAFVVWIEWYIHNDGPSQ
FT                   ENPQQVGQWSSLVSIGLLLISALILRWKYRVASSQELDEEIYALRERLADVEGRRLLRA
FT                   EASH"
FT   CDS_pept        join(complement(92724..93029),complement(92194..92688))
FT                   /codon_start=1
FT                   /gene_family="HOG000048661" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207155"
FT                   /orf_name="AFUA_6G00330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84232.2"
FT                   /db_xref="HOGENOM:HBG056403"
FT                   /db_xref="UniParc:UPI0000F51881"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y7"
FT                   /transl_table=1
FT                   /translation="MLQQPNNDLQKCLSYKGKLNTETQGQVQESMLRNSRVLTWLNCLE
FT                   SDLILVDANIDDPGMPKTTPLSVLCATLVTSMVTAHPEDVVVFHSVASTSCLKTPGTLL
FT                   VRLLDMKRCDLGFIDDWGFVEGLENYDLSSLCDSLYHLIAQFSAQTAVYCVIDTISLFD
FT                   NPRTLPDLKTVMDCFHDIVRDTSLSPAVKILCTNPMRSKRTMKQLPIFQGDPTRLVNLI
FT                   TATAAFTTAAPISDRVVGRAISRQSPNSRSRIRGRYGTDLDNTW"
FT   CDS_pept        complement(93202..93798)
FT                   /codon_start=1
FT                   /gene_family="HOG000048660" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750570"
FT                   /orf_name="AFUA_6G00340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84231.2"
FT                   /db_xref="HOGENOM:HBG056393"
FT                   /db_xref="UniParc:UPI0000F51882"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y8"
FT                   /transl_table=1
FT                   /translation="MAIREALTRADPAKRSFRSNQEICVSADHLIRSIVECIEDMILLT
FT                   SKEKTSWRQKLATAPRFRHRTPPPDPDMILGKLEEALEEFERVIDQVRNNVIEGTGLLT
FT                   QSMAMRLPVMNRSILETNESLRVFDEKQDERDKDYKRGYDALYNLLHQIRADIQNIAAR
FT                   ENNRQNMQGDDQVITRNEVLQILLESKSRAEFTLF"
FT   CDS_pept        join(complement(94234..94388),complement(94037..94154))
FT                   /codon_start=1
FT                   /gene_family="HOG000048658" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902577"
FT                   /orf_name="AFUA_6G00350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84230.1"
FT                   /db_xref="HOGENOM:HBG056388"
FT                   /db_xref="UniParc:UPI0000520530"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y9"
FT                   /transl_table=1
FT                   /translation="MTPRAGAPVGSRLAAHAAAFVSTEGHDMHIAMAGTSRYDDDERQF
FT                   VPPNFHKSLEELLKRYLPENLGLQFQADANQLEELANEVANTEAR"
FT   CDS_pept        96107..97339
FT                   /codon_start=1
FT                   /gene_family="HOG000220029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262214"
FT                   /orf_name="AFUA_6G00360"
FT                   /product="DUF453 domain protein"
FT                   /protein_id="EAL84229.2"
FT                   /db_xref="HOGENOM:HBG224006"
FT                   /db_xref="HOGENOM:HBG321890"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniParc:UPI0000F5187A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Z0"
FT                   /transl_table=1
FT                   /translation="MMVSRPLRWLLHPSPLRSQNVRVHRQFISSTAPFSKKQNSIPAAY
FT                   YRGGTSRAIFFRKEDLPSEQQQWDDIFRGTIGSPDPYGRQLDGMGGGISSLSKVCVVSK
FT                   SDRPDADVEYTFVSLGVKNMDVDYSSNCGNMISAVGPYAVDTGLFPVADDADVVSVRIF
FT                   NTNTGKIIRSTFPVVDGEAAAAGGFAIDGVASTGARIRLDFIDPAGSRTGKLLPTGKSV
FT                   DCFDDIPASCVDVGNPCVFVRASDLGVPGNLAPDKIDAHPTLLSQLDSIRRQAGVKMGL
FT                   AGTTKEVPGSVPKICLVSSPSDAYTSGMMQTPKDVDLVVRALSVGQPHKAVPITVALAL
FT                   ATAARVSGTVVADVVSDKPVDPAGITLGHASGKLLVGADFDPTGHVSCATVYRTARRIM
FT                   EGRVFWKGVST"
FT   CDS_pept        join(complement(99439..99903),complement(99000..99391),
FT                   complement(98479..98938))
FT                   /codon_start=1
FT                   /gene_family="HOG000223058" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262215"
FT                   /orf_name="AFUA_6G00370"
FT                   /product="Aminotransferase, putative "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL84228.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG051090"
FT                   /db_xref="HOGENOM:HBG398622"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051FE60"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Z1"
FT                   /transl_table=1
FT                   /translation="MSSTPCINLLKGSPATALLPVQRLSDAAVSALSKPEVTVTGLDYG
FT                   PDEGHFPLRTHLAEWLTAYYKPSQPIQADRICVTGGASQNLSNILQVFTDPSQTRCIWM
FT                   PQATYHLAFRIFEDAGFHGRLRAVPEDEEGMDVKFLEHALANDEAIADRVQRAKYKRDE
FT                   RYRKIFNHVIYCVPNFSNPTGVTMSLRRREALVRLARRLNGLVICDDVYDFLHWPAPHS
FT                   SNNESTWSSMLPRVLDLDRTLDGGPRDSFGNVVSNGTFSKIVAPGCRVGWAEGEPQLVY
FT                   GLSQVGSTVSGGPPSQLMSTFIDEMLQDGSVTKHIREVLIPAYSRRHSIMVSAVKETLS
FT                   PLGVEIHANPSDPLHAGGVFVWVRLPWPLTAHNVTERALREENLIVGNGDIFVVPGGQY
FT                   SFQHECLRLCFAWEDETDLTEGVRRLERVLIRMVNEVKS"
FT   CDS_pept        join(100296..100774,100841..101558)
FT                   /codon_start=1
FT                   /gene_family="HOG000214639" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262216"
FT                   /orf_name="AFUA_6G00390"
FT                   /product="Aminotransferase, putative "
FT                   /EC_number="2.6.1.-"
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="EAL84226.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG416157"
FT                   /db_xref="HOGENOM:HBG685856"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051F4D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Z3"
FT                   /transl_table=1
FT                   /translation="MADFSQWMDAHETWATHNLAETCCASISLDDLLAFAGNKDRATLV
FT                   DFSQKQTYGPIRGSDALRSNIAHLYRSDRCEPLSKDNILVTNGAIHANFLALYANVARG
FT                   DHVICHYPTYQQLYSVPESFGAEVSLWRADGQNGWQVSLNDLRSLIRPNTKVIIINNPQ
FT                   NPTGAVLSREVLQEIVDIARQHGIIIHSDEVYRPLFHSLENGQDEPPSILSFNYEKTVA
FT                   TSSVTKAFSLAGIRVGWIASRSREIIEQCATARDYTLISVSQVDDRIATCALSEPTVSN
FT                   ILKRNLDLARGNLDLLDGFVREFAWATRWNRPHGGTTAFIKFVNKDNLAIDDVEFCTRL
FT                   QKEFGVMFVPGSRCFGEDTNFKGYVRIGYVCERQVLIDGLEALRKFMADAYHSLPVAV"
FT   CDS_pept        complement(101721..102860)
FT                   /codon_start=1
FT                   /gene_family="HOG000217782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750571"
FT                   /orf_name="AFUA_6G00400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84225.1"
FT                   /db_xref="HOGENOM:HBG056353"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI000051E42A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Z4"
FT                   /transl_table=1
FT                   /translation="MHHFVTQTIRVLFPLAPPVFGQTLVATAMETPHLLHALLAASCSH
FT                   YARLVQKPSAHQLTVLKFTNLAVAGLRAALADPTETLRPETAMTAMVLCTNDVCNGNAR
FT                   TWKVHLSGVTQLLTALLARHKTADGDPDPFFLCLLKWFAALDILAGLSGTHEGCVNDGQ
FT                   YWNLTRNPNCGNGHVDEICGYSTQLMPLLARIGQLARRNVHEQSIFETYTEPSSALSEE
FT                   LTHDAQDLETRILSIANQVPSAATLAFHDQVLASELHNTHLAFIHSALLHLYRRVELLP
FT                   KSHPKVRAQVTAILYNVQAIKPFSPANALILWPIFSAGCETDDLQERQAIQTRMANMQT
FT                   MGLGNFTRARDALARYWESGASSRWDVYFAQSGLELVLF"
FT   CDS_pept        join(complement(105343..105465),complement(105225..105295),
FT                   complement(105051..105164),complement(104534..104997),
FT                   complement(104446..104469),complement(104057..104382),
FT                   complement(103791..104006))
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262217"
FT                   /orf_name="AFUA_6G00412"
FT                   /product="Amino acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EBA27170.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG325555"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000F5187F"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA92"
FT                   /transl_table=1
FT                   /translation="MLVKIKSVVNTTAHEDGMSTKMGTAQDRKDMRRVGRQQELNRNFR
FT                   FLSVLGFTAVLMCTWEAVLFGASNGLINGGKGGMIYTYLGGVAGFTFVILSMAEMASMA
FT                   PTSGGQYHWVSEFAPPSCQCILSYITGWFCVLGWHTGIAGCCYTVANMMVGVVAINYPD
FT                   TYVYKPWHVTLLVIAVALVALLFNTLLAQKLPLIEGIILVIHCFGFFGILIPLWVLSPR
FT                   PTASEVFGPIQDRGGWGNNGLACLVGLVGSIYALIGPDSAVHMSEEIRDASRVLPLGMI
FT                   WTLILNGSTGFVMIITLAFCVGDIDHVLESQTGFAFIQVFLNSTGSVRAATGMTVVIMA
FT                   MQFCAAISNVATTSRQVYAFARDKGLPFSNFLSTVNPTFIVPLNALCMSLAIVSLLSLI
FT                   NIGSSVAFNAIMSLARQLSIPHTSSPSPAFACVDGAISLCLPPAGA"
FT   CDS_pept        join(108808..109065,109122..109466)
FT                   /codon_start=1
FT                   /gene_family="HOG000201761" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902578"
FT                   /orf_name="AFUA_6G00430"
FT                   /product="IgE-binding protein"
FT                   /protein_id="EAL84222.1"
FT                   /db_xref="HOGENOM:HBG051349"
FT                   /db_xref="HOGENOM:HBG325733"
FT                   /db_xref="UniParc:UPI000051E68B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Z7"
FT                   /transl_table=1
FT                   /translation="MKLSTIASVGSLVVGTHSLPAAPASDNGPFQVMALRSASPIHFLG
FT                   MTASRNSFWLGGETATYCPDVVKQQGACPEGTQTVLYTNALDVMVPGGQQIYVDPSGAV
FT                   KFTTAHSASMPPGSTVEGFSYTSGDPLGHWNFSGQGATGFMACPTEGDAPAPYQVFAAI
FT                   SSATVPTGNVADCLGFDAAAIAWTPSQGQTAAAWQYT"
FT   CDS_pept        join(109906..110210,110263..110313,110369..111629)
FT                   /codon_start=1
FT                   /gene_family="HOG000202872" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207156"
FT                   /orf_name="AFUA_6G00440"
FT                   /product="Cation diffusion facilitator, putative "
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84221.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG056324"
FT                   /db_xref="HOGENOM:HBG398082"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI000051ED5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Z8"
FT                   /transl_table=1
FT                   /translation="MIHNVYNAASPLSPSQSPTTSEAWTPARRPSLEPEREILSTRGHS
FT                   LPKLLRERSLSLPPATARDEYVIEHGDGAPFRNRRESLPVSLRGMVLIGASNPMYQWHR
FT                   YYKSPEELKSMKKHLRKYYQRTNELVSQYLYIDQLLDSSLPHQLIDEYSHDHDIVAHLW
FT                   TRGREQNGEGPPADTSSRKIKRTPRNLYRIPNERSPLLQPTIEEDTPFPEIPSPHAAEH
FT                   VHSGDRIVTVAIYINLLANVFLLGAKIAVMSLTSSMSVLASLVDGALDFLSTVIVWTTT
FT                   KLAQRQDRYRYPISRRRLEPLSILVFAVVMATSFVQVAITSLGRLLGPDHKLVQLSLPA
FT                   IFMMASTVVVKLLCWFWCRLIKNTGVQALAQDAMTDVIFNFFSILFPLGESYISRCGRR
FT                   ELTDKSVGFFANWWFLDPLGGLLLSVYIIWNWSGTAATHIRHLTGAAASPTDHSVLLYM
FT                   TMRFSKIITKIQDLKAYYAGDHLNVEVDIVVDERTSLRDAHDVGESLQYMLESVPTVDR
FT                   AFVHLDYDPWNIPSHMNQLEA"
FT   mobile_element  112072..113397
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(complement(116980..117328),complement(115693..116930))
FT                   /codon_start=1
FT                   /gene_family="HOG000220605" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902579"
FT                   /gene_name="faeB-1"
FT                   /orf_name="AFUA_6G00450"
FT                   /product="Probable feruloyl esterase B-1 "
FT                   /EC_number="3.1.1.73"
FT                   /function="feruloyl esterase activity"
FT                   /biological_process="xylan catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL84220.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0030600"
FT                   /db_xref="GO:0045493"
FT                   /db_xref="HOGENOM:HBG056316"
FT                   /db_xref="HOGENOM:HBG327158"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="UniParc:UPI000051EB25"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W8Z9"
FT                   /transl_table=1
FT                   /translation="MMWWFLLIGLASAAATASSASSASFESRCQHFHKEIHLQNVHVLS
FT                   TTYVPIGSNIPMVYNPPICGGTASSSISTIQFCQVALNVTTSDKSQFFMEAWLPSNYTG
FT                   RFLSTGNGGLNGCVSYADMVYATQYGFATIGTNNGHFGDTGQYFLNNPEVIEDFAYRAL
FT                   HTGTVVGKALTKLFYPQGYKNSYYLGCSTGGRQGWKSIQRFPDDFDGVVAGAPAINFVN
FT                   LCSWGSRFLKITGPPGSETFVTSAQWSAVHNEILRQCDALDGAVDGIIEDTDLCQPVFE
FT                   TLLCNSTAVDKTSCLTGVQANTVNEVFSAMYGLDGKWLYPRMQPGSELAASFIYYSGNG
FT                   FKYSDDWYKYVVYNDSNWGHSTWTLADAAAAAAQDPFQISSFDGNISGFQKAGGKVLHY
FT                   HGLEDAIITSDSSKAYYKHVADTMGLSPSELDHFYRLFPISGMGHCSPGTGAASIGQGS
FT                   STYAGDDPQDNVLMAIVQWVEKGIAPEYVRGSKMSRDGTIDYRRKHCKYPKRNRYVGPG
FT                   KYTDENAWKCV"
FT   mat_peptide     join(complement(116980..117271),complement(115696..116930))
FT                   /product="Probable feruloyl esterase B-1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W8Z9 "
FT   sig_peptide     complement(117272..117328)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W8Z9 "
FT   CDS_pept        join(complement(118487..118698),complement(118095..118439),
FT                   complement(117859..118051))
FT                   /codon_start=1
FT                   /gene_family="HOG000202856" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262218"
FT                   /orf_name="AFUA_6G00460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84219.1"
FT                   /db_xref="HOGENOM:HBG056311"
FT                   /db_xref="HOGENOM:HBG329537"
FT                   /db_xref="UniParc:UPI000051EFEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W900"
FT                   /transl_table=1
FT                   /translation="MPHFELAHKVRHLIVQPADQRQNPPESYLFVQDGLIISCGVLYAL
FT                   CYIFCIIRVYSDRTYPGARWGSIQFLCLTMAYEIFYAFTTTSTRFEMLAFLAWFELDLS
FT                   FAIVALRKAHAPAERRFLRRNMVLGCLTGIAFLWTLTRRYPDEREQVTAYWTGIILQLP
FT                   IGWICLYQLWEDHSTQGHSLEIWLTRYLGCFTAYGVFLWRYFNVPQNWRYVWTPWSIGI
FT                   IIATLIPETVYPIVYLWVHKTQKDKRA"
FT   CDS_pept        join(complement(120616..120868),complement(120367..120486),
FT                   complement(119446..120312),complement(119296..119395),
FT                   complement(118982..119240))
FT                   /codon_start=1
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750572"
FT                   /orf_name="AFUA_6G00470"
FT                   /product="Plasma membrane zinc ion transporter, putative "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84218.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG056304"
FT                   /db_xref="HOGENOM:HBG325661"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI000051E68A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W901"
FT                   /transl_table=1
FT                   /translation="MNCPSRTDDTLLHCDWNQNPPFLAPDLTTRQDFNGITNARVYRSG
FT                   PGLDAVSSTSWEDSQAMPEQRDTPIGSKSDLRGASLTPSVDKVKSWAWWLLSVLFTSAL
FT                   ISHESLGRYFGSTISVSDTTAVKPEANLIKRSTCVAGGVKSSEYNTSLHIGALFIILSV
FT                   STLACAFPVLATWFPRLRIPPSVLFTFSHFGTGVLIATAFVHLLPTAFTSLNNPCLSGF
FT                   WTTDYPAMPGAIALAGIFLVTLVEMVFSPARHVCRGGLKVSEQETSLSESGVCNSHVPV
FT                   ARDSKTRDEVKRPGCTRVESQSHLRDLGPLVGRQTSVSRTINRMGEECDRIMRIASAPE
FT                   GMRPVQESKAPPIEDVERSDDLALTPEQKHKKAVMQVFLLEMGILFHSVFIGMSLSVSV
FT                   GSEFVILLIAIVFHQTFEGLALGSRIAALDWPEKAVQPWLMSLAYGCTTPIGQAIGLAT
FT                   HTLYSPDSEVGLLLVGTMNAISSGLLIFASLVELMSEDFLSDESWRVLRGRKRVIACIL
FT                   VFMGAFCMSLVGAWA"
FT   CDS_pept        join(complement(121539..121669),complement(121114..121306))
FT                   /codon_start=1
FT                   /gene_family="HOG000048657" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055869"
FT                   /orf_name="AFUA_6G00480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84217.1"
FT                   /db_xref="HOGENOM:HBG056297"
FT                   /db_xref="UniParc:UPI000051EFE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W902"
FT                   /transl_table=1
FT                   /translation="MILWSWTGIYVALVWMESGKWGGLKMPDVMILNASQQPFLSKAFT
FT                   RTVGKSSESERPLMGGTGVGRQGPRDEAVKEQMADRQHTVSGMMEMSRLQLSDIVQGIL
FT                   AES"
FT   CDS_pept        join(121680..123395,123508..123618)
FT                   /codon_start=1
FT                   /gene_family="HOG000149415" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262219"
FT                   /orf_name="AFUA_6G00490"
FT                   /product="DUF521 domain protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /biological_process="phosphorylation"
FT                   /protein_id="EAL84216.1"
FT                   /db_xref="GO:0016310"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="HOGENOM:HBG402504"
FT                   /db_xref="HOGENOM:HBG410537"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR012047"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="UniParc:UPI000051E42C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W903"
FT                   /transl_table=1
FT                   /translation="MQYHGHCLVDSAATGKLLYANVGLSFWAGVDSQTGEIIDRHHPLH
FT                   GQSVNGRILAIPCSRGSCTGSIVLIELLLNQCAPAGLIFQQPEQIITLGVVVAKTLLGL
FT                   SIPVLVLKPAEFHSLKDYRYAAITGPTLQTGEDPLPPPTYEAPSCAPSGTIDLSETDEA
FT                   ILHGARGAAAQKAMEILLSFAQIQGATRLIDISRAHIDACIYTGPASLRIPQTFLSLGA
FT                   RVAIPTTLNSISIDRRRWRELGVKEELAVPADQLVETYLAMGARPVFTCAPYLLESAPA
FT                   AGQDIGWSESNAVVFANSVLGARTQKYPDLIDVCIALTGRAPLAGGHADEGRTPSVVVE
FT                   VADFPKMDDAVWPLLGYHIGQLAGGDIPLVVGLEQTKPRMADLKAFGAAFATTASASMF
FT                   HVRGVTPEATKFEGVRHTAKRMAVHESDLVRTWEDLNTAQDSSVGLVSLGNPHFSLEEF
FT                   ESFSRLCADRKKDPSVQMMITTGRETYELAASKGYIQTLEAFGATIITDTCWCMIREPV
FT                   IPPQTINLMTNSAKYAHYAPGMVQRGVHFGSLAQCVVASCTGYFDGEPSWKQDCTLPCE
FT                   AEVYTLMTEGLPPHPNSHRFATNLGDENRCIA"
FT   CDS_pept        123693..124652
FT                   /codon_start=1
FT                   /gene_family="HOG000170085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207157"
FT                   /orf_name="AFUA_6G00500"
FT                   /product="Chitosanase, putative"
FT                   /EC_number="3.2.1.132"
FT                   /function="chitosanase activity"
FT                   /protein_id="EAL84215.1"
FT                   /db_xref="GO:0016977"
FT                   /db_xref="HOGENOM:HBG056283"
FT                   /db_xref="HOGENOM:HBG324436"
FT                   /db_xref="InterPro:IPR009939"
FT                   /db_xref="UniParc:UPI000051F9AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W904"
FT                   /transl_table=1
FT                   /translation="MRHRPVLVAITATLFASQITTKQAPSALRAFYNKARSGGDCTGAD
FT                   ALQTGFYNTEWSGGHTTYCTKYLPTGKGFYLKGPGSDLANMDIDCDGEQSRGDGRCKSS
FT                   TDTQGQTRWGLKHLEKHGVRDLNANLHPYVVLGNEGGYSPTFDPRTVGVEPLSIVAVVC
FT                   ADELVYGVWGDTNGDDNEHPMVGEASLALATACYGPSISGNSGHDEADVLYIAFAGKEA
FT                   VPARAKWDADSYEAFEESITAQGDQLVSQLFGDRSTATGGSDPHHTSAAPIDSDSDSDS
FT                   DDDDDGSSKHSDKSDGARRSTIPRLCHTILVALIALVC"
FT   CDS_pept        125045..126049
FT                   /codon_start=1
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750573"
FT                   /orf_name="AFUA_6G00510"
FT                   /product="NADP-dependent alcohol dehydrogenase "
FT                   /EC_number="1.1.1.1"
FT                   /function="alcohol dehydrogenase (NAD) activity "
FT                   /function="cofactor binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84214.1"
FT                   /db_xref="GO:0004022"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG736195"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FE5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W905"
FT                   /transl_table=1
FT                   /translation="MGFDFTVYKGSSDGSIKKATTHRDDLQGDSVLVRITHSGVCFTDV
FT                   HYMKADMALGHEGAGVVGATGPGAQHLKKGDRVGWGYEHDSCGSCKQCLTGWETFCPER
FT                   KFYGYADLDQGSFATHAVWREAFLFKIPDALSNQDAAPLMCGGSTVWNAIVVGEVKPVS
FT                   RVGIVGIGGLGHLAIQFAAKMGCEVVVFSGSDNKKEEAMKLGASEFYATKGATELKVGK
FT                   PLDNLIITTSAQPDWKLYLPILAPGAVISPLTVDEKDLQIPYMPLLVGGIRIQGGIVAA
FT                   RQSHRDMLDFAAHHGIKPIIMTYPMSVEGIQECLKTLQDGKMRYRGVLVSDKQ"
FT   tRNA            126214..126287
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        join(127197..128204,128259..128567)
FT                   /codon_start=1
FT                   /gene_family="HOG000194703" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207158"
FT                   /orf_name="AFUA_6G00520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84213.1"
FT                   /db_xref="HOGENOM:HBG053848"
FT                   /db_xref="HOGENOM:HBG327140"
FT                   /db_xref="UniParc:UPI000051ED59"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W906"
FT                   /transl_table=1
FT                   /translation="MPLFQSWTRPPSRRIYLILVSPVIGLLLVYLFFAFDTDAFTPKVV
FT                   VTPISPQQKQATCPQLGGIEDVLVILKTGVTEALEKVPVHFQTTLRCIPNYVLFSDFEE
FT                   EINGTRVIDVLGNVNETIKRTSPDFDLYNRIHEHGRSGLTPADLSRVPNTAFGMPDNPG
FT                   WKLDKWKFLPMIDETLRVRDDAKWYVFMEADTYYIWSNLLQWLAQLDPTKPYYLGNPTQ
FT                   IGSDIFGHGGSGFILSREAMRRASDLRAKDLDGWDRYTGEQWAGDCVLGKLLHDAGVPL
FT                   LWSWPMLQSNTPAEFDHFSEAYSKKPWCFPAVSYHHVGPEDIQELMKFDQMFMQNNSVI
FT                   LHSDVFRHLVHPQLKSPQPDWDNLSDEEHLIDAASCQEMCASEPDCLQYSYEAGKCRTS
FT                   KMAKIGVPKTGVSSGWMTDRIDAIVKELGSCTKPQWVLP"
FT   CDS_pept        join(complement(133495..133762),complement(133238..133324),
FT                   complement(130789..131499),complement(130400..130711),
FT                   complement(130204..130349))
FT                   /codon_start=1
FT                   /gene_family="HOG000048656" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262220"
FT                   /orf_name="AFUA_6G00530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84212.1"
FT                   /db_xref="HOGENOM:HBG056260"
FT                   /db_xref="UniParc:UPI0000520531"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W907"
FT                   /transl_table=1
FT                   /translation="MIQLSDEPLPTRTECDDDLANRITYLLGRVINRCLLCDAVPLDQC
FT                   EWNGLRDQLEDWRTSLPSSFDPILTPDLLPNSAFPGMWTTSGWHGHHATIVCALALSSR
FT                   SAPVWVNSFGPIAFSHTSINRQYYKNPVFQHYFLARDIHPTTSTTPTTTTTTTTTTTTT
FT                   NNMTIRHVSFNDMTLEDMLINDLLNSNIILRNKIADDLTSLDIAIEDTAINDFADSSID
FT                   VKSIVIDELSTMNMILTELASTIRPLKKWSGMTSSAATSSTATSTSPAWSLITPTETPP
FT                   SENDEEDPDWPFVARKGTLPPSPPLRQRVPTPDEVTEEFLSHTLYPLFGLSRHPNPRGV
FT                   WTLEQNEKAPIPISLDKKDPQLLDHETSCKRIRAILNHCYVEELGYRKQNPAKRSSAVL
FT                   SIPRCGGFEQEVESLGVRFPIEGKLDFVVNNATEPGNGIGVVICVNLCPSANLWQCISF
FT                   MALCHNVRKIENKRLTSVYGVATNGKEFYFLEIDDNDMVRHRFPAHQHE"
FT   tRNA            131664..131737
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        join(135632..135995,136210..136304)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262221"
FT                   /orf_name="AFUA_6G00540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84211.1"
FT                   /db_xref="HOGENOM:HBG056256"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI00005202D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W908"
FT                   /transl_table=1
FT                   /translation="MPPTADCPPTSQPVHSDADFDHPTHPFAYVINIPLIEMTPENGST
FT                   EIWLGTHIDSGLHIQEGMHGDRASGRIKLDELEKRRAVRPPCQPVVPKGAIVLRDLRLW
FT                   HAGVGNQTDQVRVMLAMINGLEGEHFQTLTKHATKHSNGANGQHGDCC"
FT   CDS_pept        137231..138358
FT                   /codon_start=1
FT                   /gene_family="HOG000202734" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207159"
FT                   /orf_name="AFUA_6G00550"
FT                   /product="Glycosyl transferase family 8 family, putative "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="EAL84210.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG056252"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="UniParc:UPI000051EB21"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W909"
FT                   /transl_table=1
FT                   /translation="MAVSFRWRPSPRATKALLISAFAILSLCTLWTLWYHVSSTFSAVS
FT                   TPIGLHDSEGKLSDEQRERPSPSGPETVPEKGPPRQHRYAFATILTGEDATETDIKDPY
FT                   FTAVRLLAYQLLRSPHTKSSSDIPFLVLVTEEVPQQQRDILSRDGAIVVPVEGFSRDWI
FT                   HPKWERWKSVLAKLNLWKLTEYEKITFLDADSVIFEPIDGIFTERATMTQITRPSSAAL
FT                   NTPGPVPDSYMMAGMHDRWVEVALPPVPGSEFYAKDNYMNAGFFVLAPSEAMFKYYSFL
FT                   LDQPGLFDPAYPEQNLLNYAHRVDGQMPWQDIGPLWSQKGSSFEHYDPRLKSLHQKWWK
FT                   TSYDQTFDERIANAMAELKDYLGKQEEDTVQPRSP"
FT   CDS_pept        complement(138701..139120)
FT                   /codon_start=1
FT                   /gene_family="HOG000217784" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055870"
FT                   /orf_name="AFUA_6G00555"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27169.1"
FT                   /db_xref="UniParc:UPI0000F5187C"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA94"
FT                   /transl_table=1
FT                   /translation="MAPHKVVEGSPTQQIISDHVWKRKRPETDYERWQREQDESYEPGG
FT                   RPQYGPPNEFRKDDYVADGTEELLHGQHYSVEHRAPSHGYFVSSTAPAKPITSEGSFIS
FT                   TARKALHLGDETFMGSLLFFAVLLMISFVVSKSIK"
FT   CDS_pept        join(140318..140657,140709..141079)
FT                   /codon_start=1
FT                   /gene_family="HOG000189036" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262222"
FT                   /orf_name="AFUA_6G00560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84209.1"
FT                   /db_xref="HOGENOM:HBG056246"
FT                   /db_xref="UniParc:UPI000051F741"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W910"
FT                   /transl_table=1
FT                   /translation="MPEGYASRRNVSCNTDVELDCGKTWGAFHACCPLDTYCPPNQSST
FT                   KCWKTPTEPQEKRCANSTWNLYYASDFFCCDQKLRAFKWASNGFVGCADPSYALDDELV
FT                   QLSVVASGTVTPTSSIPSTSTPGSSMSTSASESRQTTEPTPSVKSPPSSGTNVGAIAGG
FT                   VVGGVAGVAIIAGLIWFFLLRRYRTSQNNESATPLHELHVSHQDGPKWEPYPQEIGNNS
FT                   NEHHVVELPAHPSR"
FT   CDS_pept        join(complement(142729..143403),complement(142206..142724))
FT                   /codon_start=1
FT                   /gene_family="HOG000161922" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262223"
FT                   /orf_name="AFUA_6G00570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84208.2"
FT                   /db_xref="HOGENOM:HBG056239"
FT                   /db_xref="UniParc:UPI0000F51883"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W911"
FT                   /transl_table=1
FT                   /translation="MAGNAIAFLLTALTAVPLANDLFPQSRGSSTVVRVAAGLSLPRDG
FT                   DYARTGGNTPSIALFDESGERIGFKSGARHGKIGDGKFKDIVVEPINKDNSRAPAYLSV
FT                   PSSGNDALCIADIYITPPSKEFWAFFGDVPKECGVAWYRSNLPVQRQNGDPFKPRCFWI
FT                   DSPDTGKTTSSFPQGAGIHLTDFTANQGRVQQYQISRDTMCASAPRFSLYSSLTEMNCL
FT                   PIFPPLTYNEDGTDTSFAALKTPGQVMCSPGPNEKPTAKQILQLQKWTGGRVSTPTYGV
FT                   KTRSVKARQNDRVCFADHQVVVVSEHREHTASELCKSTSAAGPDFVSTKEGLFCDMCTG
FT                   ELWPLCSKNVPTGCFDVDLKVMRASDGAVTRTGLHARDVITGRDIPEKEYKKVAHWK"
FT   CDS_pept        146623..147741
FT                   /codon_start=1
FT                   /gene_family="HOG000162927" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055871"
FT                   /orf_name="AFUA_6G00580"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL84207.1"
FT                   /db_xref="HOGENOM:HBG056232"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051F73F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W912"
FT                   /transl_table=1
FT                   /translation="MEAYSFCALPLELIVMVADYLGPLDLLNLIQGLPHIAPLLNSWHI
FT                   QAHDENGHTILHHIVEQRLEYLIKPLAKWIPRSSIADNEGWTPLFQAVRNSDESMTKAL
FT                   VYAGADVSAKDHTGKTALHLACYEDAVGIVQILLDHGANPSAADCNGRTPLHDAFGRNT
FT                   VILQKLIKAGADLNPRRMPRGLAPLYLEAWLGREDAVRILLEAGADPSIQTETGETILQ
FT                   KAIEGSHTKVVQLLLDAGVDINVREFHHGVNAILTAAYWGADDCIRLLQRAGADVFSVD
FT                   YRGCNALHRAALGGRLSTVKLLLKEGVDSSAEDNRGYTPQRYAVEGVYTHGGSSDIDWE
FT                   ELIRILEDVHTKSPFLRFLNWMRAKCYFTKKS"
FT   CDS_pept        149233..149496
FT                   /codon_start=1
FT                   /gene_family="HOG000217785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262224"
FT                   /orf_name="AFUA_6G00590"
FT                   /product="Secreted peptide, putative "
FT                   /protein_id="EBA27168.1"
FT                   /db_xref="UniParc:UPI0000F51880"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA93"
FT                   /transl_table=1
FT                   /translation="MKFSIIALTFIGSALAAPGASIPTPSTPAAPSCAASSSHIASSTA
FT                   SPSASPIFQPGCDIEHVGNNGKHLGWCKKARHYGMYNNGTSI"
FT   CDS_pept        join(complement(150897..151038),complement(150490..150842))
FT                   /codon_start=1
FT                   /gene_family="HOG000202745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750574"
FT                   /orf_name="AFUA_6G00600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84206.1"
FT                   /db_xref="HOGENOM:HBG056225"
FT                   /db_xref="UniParc:UPI000051F9AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W913"
FT                   /transl_table=1
FT                   /translation="MLRNTVIRSVQLSRNMSSFTQPTPIVACGRSTATGKLVSQHLLPE
FT                   YEVIHFIQSVEAAEAELPHLLAGRDPQSRYSNELGTHDYSRPPRAVIFGRGYEPQQVEE
FT                   LKEKFAGVAKEPVAWVRGNPADVPAGGPGPDYAQKVAADMKQVLKKWRDAGAKDEETLV
FT                   Y"
FT   CDS_pept        join(complement(154065..154197),complement(153852..154015))
FT                   /codon_start=1
FT                   /gene_family="HOG000217786" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207160"
FT                   /orf_name="AFUA_6G00610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84205.1"
FT                   /db_xref="HOGENOM:HBG056216"
FT                   /db_xref="InterPro:IPR015308"
FT                   /db_xref="UniParc:UPI000051F253"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W914"
FT                   /transl_table=1
FT                   /translation="MKFTALLCTLIAATAVSASTVPRDEFQIQDTCGSGYGGDQRRTNR
FT                   LVWYVNPSQLEDETSFAHGYSFKKVECRNGRWTEIQDCHASTCHGTNDGAARC"
FT   CDS_pept        complement(160929..161618)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262225"
FT                   /orf_name="AFUA_6G00620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84204.1"
FT                   /db_xref="HOGENOM:HBG056208"
FT                   /db_xref="UniParc:UPI000051ED5B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W915"
FT                   /transl_table=1
FT                   /translation="MSLSVQGPGASPEIIHKADYLSTVLLLYSSRFSISTVVRSHPFRS
FT                   LSIYTATMQFKALATLLFAALAVANPAPAPQAGDLNALMGSIPTSVLGVLMTAIPPSVV
FT                   SALANPTQAASMFQQIEQGQIPDWYNNLPDSVKAWATSAAIAELGGDVATATPAGSAST
FT                   PAVTTSSASSSSETASGNSQTTSSGSSGAAPTSTSTPTSTPNAAPTGAVAVSFAGAAGL
FT                   LALALAL"
FT   CDS_pept        join(complement(163614..163823),complement(163452..163560),
FT                   complement(162153..163393))
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902580"
FT                   /orf_name="AFUA_6G00630"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84203.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E68D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W916"
FT                   /transl_table=1
FT                   /translation="MAEKRSDVDIDAHPVHERRDDALDYLDEHANVQDEATVDLAALRR
FT                   KIDYRIIPFMFCCYVLQFLDKVMLNYAAVMGIRKDLKLVGNDFSNAATWFFIAYLIAEA
FT                   PLVILLQKTPPAKWLGANVFLWGVAAAAGAGTRDYPTLLVARIFLGIFEATVGPSLMLL
FT                   SSQYYTKSEAAPRFTLWYVGLGVAQILGGLISFGFQHVKNPSFQGWRVMFLVLGLITSI
FT                   TGALTFFFLPDTPMKAKWLTDREKVALLNHVSVNQTGVWSSDFNIKQIWEAVCDIQLWF
FT                   ITIITMLVCMLACPIGPANFPITDTSIAQISVSSGVVTSYSATLIAGFGFSGPHAALLN
FT                   MPSGIVSIFFTLLVGFGIRRVSHRWAWLIASTLPGILGGGLLSFLPKHNKAGVLIGIYL
FT                   VNAIVATLPILYQWTAANCAGHTKRAFASALVAGSFSVGNIIGPQTFQARDAPEYRPAK
FT                   IAVLATQAAAAVLSFVLFLYYVWENKRRDRAAQGQQEDQAPDDTKWAGLTDRQNKAFRY
FT                   VY"
FT   CDS_pept        join(164566..164779,164886..164941,164966..165157,
FT                   165219..165857)
FT                   /codon_start=1
FT                   /gene_family="HOG000202768" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207161"
FT                   /orf_name="AFUA_6G00640"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL84202.1"
FT                   /db_xref="HOGENOM:HBG056196"
FT                   /db_xref="HOGENOM:HBG329040"
FT                   /db_xref="UniParc:UPI000051EFEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W917"
FT                   /transl_table=1
FT                   /translation="MGWVFGASPEIDAQSRYPVLLGVCISLTLLMVATVCLRLFVRIKL
FT                   GRFDASDYVMVFGMIFSIIYNALCIAPRPPHVHKGTTRPLTVDELLNYAGRPFYQLGIA
FT                   GFKAALCINYLHLLAKTSKRFYRMLVWGVILLTTLGHVAGTLVLILNCKPIERAWNQTI
FT                   PGKCLPVGPTFYGLAAFTIISDVSVIFLPIPLLLQLNVKPAQKAGVVCLFLLGLFTTIC
FT                   SILRLTQINRVVAIDGDSTMLVLWGTIEFNVGVSWTSSAKIERDLTDVQNIVTSLPFLM
FT                   PLLKVWVRDFQSRSGGEHRKNTGYTLQSYSKNRRSQLRSENSKEPVLAQRTPGEELILD
FT                   ADDSSARANAEIHVTVEYRVSHENHK"
FT   CDS_pept        complement(169037..169831)
FT                   /codon_start=1
FT                   /gene_family="HOG000048655" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262226"
FT                   /orf_name="AFUA_6G00650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84201.1"
FT                   /db_xref="HOGENOM:HBG056190"
FT                   /db_xref="UniParc:UPI000051E68C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W918"
FT                   /transl_table=1
FT                   /translation="MIERWSNSARKSHHRYNPMPPIIRTAAKALANRNIPVVEYGQQIQ
FT                   WRHGEPVVLLVSNKKDIRPSSCWALLTAESQLVEWAVPDALLSLSSQILSDCGFSCVAP
FT                   STNVTDRYGQWERAAIVHKLEGGNPIYLYPLSFVEFTLQDTVKVTSTFDRTLSILTPEP
FT                   RMYMQSLICHLLDHPVGDTFRLRVQSDLLSFISFYVLGDKPLNTKDGECDDDESEEDFQ
FT                   KRVENAVRRMKTWDWGADENNYLCIAESVVRDCRSIYELSNC"
FT   CDS_pept        join(170160..170531,170578..170863,170910..171220)
FT                   /codon_start=1
FT                   /gene_family="HOG000202779" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262227"
FT                   /orf_name="AFUA_6G00660"
FT                   /product="FAD binding domain protein "
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84200.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056187"
FT                   /db_xref="HOGENOM:HBG329041"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000051F252"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W919"
FT                   /transl_table=1
FT                   /translation="MPNLPILIVGAGISGLTLAQYLQKSGVPFLIFERDSSIDIRSGGW
FT                   GLTLHWGLPILRDMLPDHIVARLPECSVNKEASENGDVGRFPFFDLSSGSALFEVPAAE
FT                   RVRVNRGRLRELLASGIDVKWSKTVVDVTSTEENVTAHFEDGTSYTGSLLVACDGANSR
FT                   IRKMTYPDSYQMNPLPVQLLGVTVRYSPEQAACFRAMDPYILQGAHPESNVFLFFSFLD
FT                   TPNNFDDSTDAYLCQIIVSWSDSKNIPLPSDNAGRIALMKELTANWVEPFRSLVHNLPD
FT                   DSEARSIRIQDWIFTPGERPHPRVVMMGDSAHTMTMCKMAH"
FT   CDS_pept        join(172246..172587,172630..172665,172720..172788,
FT                   172834..173376)
FT                   /codon_start=1
FT                   /gene_family="HOG000202790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055872"
FT                   /orf_name="AFUA_6G00670"
FT                   /product="Extracellular serine-rich protein "
FT                   /protein_id="EAL84199.2"
FT                   /db_xref="HOGENOM:HBG056180"
FT                   /db_xref="HOGENOM:HBG325025"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniParc:UPI0000F5187D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W920"
FT                   /transl_table=1
FT                   /translation="MLKLSIMSMTVLLFFQSRTTHATGAVPTAMTPSSTAPHATHTVKV
FT                   GPKENPHQYSPHNITAAVGDVIVFEFYPRNHSVVKADFMAPCVPAAGEIFYSGQFNTFK
FT                   ENNHGQLEGEPPTWSLVVNDTEPTFFYCTAVDSCLFNGMVGVINPNETMTWEAQYAQAQ
FT                   QYPYMLVPGQSPPAEGTGYLSSGSNAHKKSSFGGGAIAGTVVGGVAFVAILVVVAITLC
FT                   RNRERQGSSSQVGRMERTAHWARFGGHGEEKSEQGFAASSSVGGHGTLSLSSGASPPAV
FT                   SPPLQNVGSSNWESAMKQQPPQEIRQPSELEATNVVGGTPGGMYYGWR"
FT   CDS_pept        join(complement(174370..174601),complement(174187..174318),
FT                   complement(174010..174140),complement(173864..173963),
FT                   complement(173570..173811))
FT                   /codon_start=1
FT                   /gene_family="HOG000202801" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262228"
FT                   /orf_name="AFUA_6G00680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84198.2"
FT                   /db_xref="HOGENOM:HBG056147"
FT                   /db_xref="InterPro:IPR021765"
FT                   /db_xref="UniParc:UPI0000F5187E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W921"
FT                   /transl_table=1
FT                   /translation="MARSESDKDIDANYGLLNNEEAQNWSHDEKPRTRSHGQWLKALLY
FT                   IATVIVSCLVGLFIGRQVQDLDRACARHVSHYSPVTSDVDITFQPQRFNGSLLKENIYR
FT                   QDASPEVDAAWEALGVNYRSLRVPAEVAEKSGLARDQVKINQKYGGGYPANVEGFHHLH
FT                   CLNLLRQTLYYNYDYYHKLGQGAFKNDDFIVRRHVSHCLDILRQQLMCTIDTGVLGQVW
FT                   IHPDHPEAYVDFNTEHQCKNFEAIRQYAEKNQLPAQIPKDFLEPPKPGDRVYDEIP"
FT   CDS_pept        175566..176207
FT                   /codon_start=1
FT                   /gene_family="HOG000202812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750575"
FT                   /orf_name="AFUA_6G00690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84197.1"
FT                   /db_xref="HOGENOM:HBG056077"
FT                   /db_xref="UniParc:UPI000051EFE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W922"
FT                   /transl_table=1
FT                   /translation="MHLLSKAAVLLLALNVSARPIEEPPAQTTAPAGYGDYKDYGSYGK
FT                   YGDYGHYKRDEEPSPTTTCTETETPTPANYGDYGDYGNYGQYGDYGHYKRGEEPTTTTT
FT                   TTTETPSPSPANYGNYGQYGDYGHYKRDEEPTATTTETPTPSPTPADYGNYGDYGNYGK
FT                   YGDYGQYKVKRDDEPRTTTTETPTPSPTPADYGDYGNYGNYGNYGTYENY"
FT   CDS_pept        join(179804..180010,180060..180108,180162..181390)
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262229"
FT                   /orf_name="AFUA_6G00710"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84195.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG328895"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51884"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W924"
FT                   /transl_table=1
FT                   /translation="MTDQKSFCDHVEDPEAKKEVADEEVVLDEETLKLDRQTLLRLDLL
FT                   LMPMTLMLYLLAWLDRANVGNARVAGLEKDLHLTDLQYKTAITVTYVPYVLSELPSNLL
FT                   LKIIGPRILLPTLCTLWGLVTTLQSQVHNYSGLLACRFFLGLLEGGLFPGIVLFLSNFY
FT                   RRHELQVRIALFFSAASLSGAFSGLLAAAIQQMSGLRGMKGWQWIFLLEGLFTVCFGIF
FT                   SFLVLPNGPENVITFRPKHSQRCIARLQQDSNNFETETKVTFKGVVSVLKDLHVWIACL
FT                   ILFCNGACLFGLAYFSPSIVQALGYSPTKTQLMTVPPYAAGFFVTMLTAYISDRRQQRG
FT                   AGAFITSGIALIGAALAINGRSVGIRYAALMLLVTGVYACAPCLISWVPNNTAGHLRRA
FT                   TAVAMAFIATNMGGIMSTWIYPRESAPYFHLGIRFNLSLLVIAMVLVVVQVLLLRFLNR
FT                   RKERIPLELLRGTEDLPYEEQFAKLGDRHPRYKYTY"
FT   CDS_pept        join(complement(181888..181926),complement(181629..181832))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902581"
FT                   /orf_name="AFUA_6G00720"
FT                   /product="LysM domain protein, putative "
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="EAL84194.2"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="HOGENOM:HBG056653"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI0000F5187B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W925"
FT                   /transl_table=1
FT                   /translation="MTTECTNLGLDYYPTSSGLEPQMPGIVSNYAKFYQVKSGDSCWSI
FT                   ENAAGITLAQFRSWNTQIDESCTNLWVDYYVCIGV"
FT   CDS_pept        join(complement(183676..183912),complement(182792..183121))
FT                   /codon_start=1
FT                   /gene_family="HOG000048654" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055873"
FT                   /orf_name="AFUA_6G00730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84193.1"
FT                   /db_xref="HOGENOM:HBG056578"
FT                   /db_xref="UniParc:UPI000051EB24"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W926"
FT                   /transl_table=1
FT                   /translation="MVVFRYDVVVVVVVVLLLRFPLLLSLGVRRPWDGGRAGGLEGNAN
FT                   ADIQRAFIYSHRRHIGPSDSSGISGPKTHDSARGHHPSQTPKLPDRISNDINNVLNTDV
FT                   EVNVAVCPLGLNPKGTRAKLHRLVLTADRLLNLPFAISIRIFFTTCMQSDTLEDASLVW
FT                   STTSQVSAAVGRLVRDAWVIDHVGV"
FT   CDS_pept        184025..184768
FT                   /codon_start=1
FT                   /gene_family="HOG000202823" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055874"
FT                   /orf_name="AFUA_6G00740"
FT                   /product="Putative uncharacterized protein "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="EAL84192.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056504"
FT                   /db_xref="HOGENOM:HBG350046"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000051F9AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W927"
FT                   /transl_table=1
FT                   /translation="MPHLKVRDVDRKPYRQMLPRVLFNQCFILLPSMMLVQAMGYCFVG
FT                   PTHLHPLRFLLSLLAMAVGHDVVQYVTHRYLLHNPNLRLMRLLQHSLHHSTGASRGISA
FT                   CYMSAPDFFLEIVLPYLVPLALVGGGGADLLFHSLVAGSGALGGVYEHSGYDFSALFSP
FT                   ENCMGGKGPWPSWTAKVAALIRGFVANRAHGEHHSRANVSFSDGFGSPGICDTYFGTRW
FT                   DLVAARRAAAEKEWQAQRSSHMNAK"
FT   CDS_pept        join(185331..185529,185580..187108)
FT                   /codon_start=1
FT                   /gene_family="HOG000061334" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055875"
FT                   /orf_name="AFUA_6G00750"
FT                   /product="Pyruvate decarboxylase, putative "
FT                   /EC_number="4.1.1.1"
FT                   /function="magnesium ion binding"
FT                   /function="pyruvate decarboxylase activity"
FT                   /function="thiamine pyrophosphate binding"
FT                   /protein_id="EAL84191.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004737"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="HOGENOM:HBG055646"
FT                   /db_xref="HOGENOM:HBG479104"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="UniParc:UPI000051FC1E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W928"
FT                   /transl_table=1
FT                   /translation="MDSDTLPLAQYLFKRLRQLGVDSIFGVPGDYNLTLLDHVVPSGLK
FT                   WVGNCNELNAGYAADGYSRIKGIGALVTTFGVGELSAVNAIAGAYAERAPVVHIVGTPM
FT                   RASQESRAMIHHTFIDGEYQRFDRMQEHVTVAQVSLSDHRTAPAEIDRILLQCLLHSRP
FT                   VRITIPVDMVPVLVPTAGLASKIEIPPPVRQPQVEEAALTAVLERIYNAKKPMILVDGE
FT                   TRAFGTVNEVNQFVTTTGWPTFTSGFGKGLVDETLPNVYGVYRPAHKEFVDSCDLVLAF
FT                   GPHFSNTNTYIFMVRPQDETSVLFNPTSVQVNKDIYRDLPAKYFIQQLTQRLDPSKIPV
FT                   HQHNLVHPSAQVLPEVPPTDLVTQTAGFWRRLSPFFRSGDIVLGETGTPGYGANDFVLP
FT                   PQTRLFKPVTWLSIGYMLPATLGASYAQRDLIARNEYHNLSAARTILFIGDGSFQMTVQ
FT                   ELSTIIHHKLDVIVFLINNDGYTIERCIHGRNQAYNDVARWRYLKAPELFGADQEGEYA
FT                   SRTWEIRTWADCDAVLKDEQLVNGKGLRMVEVFMDKFDAPDVLMNLLNAQIARDNAKK"
FT   CDS_pept        join(complement(188593..188640),complement(188438..188567),
FT                   complement(188284..188387),complement(187925..188227))
FT                   /codon_start=1
FT                   /gene_family="HOG000125746" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902582"
FT                   /orf_name="AFUA_6G00760"
FT                   /product="Glutathione S-transferase, putative "
FT                   /EC_number="2.5.1.18"
FT                   /function="glutathione transferase activity"
FT                   /protein_id="EAL84190.1"
FT                   /db_xref="GO:0004364"
FT                   /db_xref="HOGENOM:HBG416344"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000051FC1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W929"
FT                   /transl_table=1
FT                   /translation="MVLKLHGSPWSTCTARGVDAEVVNVDLAKGEHLAESYLEMQPFGK
FT                   VPVLQDTETGVQVFESRAIAQYIIAKYRGQGAELAPPESDLKAYALYQQAMSIEQSYFD
FT                   PPIAQLAYEKVWKSMKGEGETDDERVKALLAQLDQTLQGYERVLSKQKYLAGDEVTFAD
FT                   LSHLPYGVFVEQFGFADLIAKYPRSKSTGRT"
FT   CDS_pept        join(complement(190646..190922),complement(190294..190565),
FT                   complement(189765..190244),complement(189619..189704),
FT                   complement(189433..189568))
FT                   /codon_start=1
FT                   /gene_family="HOG000292006" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750576"
FT                   /gene_name="abnC"
FT                   /orf_name="AFUA_6G00770"
FT                   /product="Probable arabinan endo-1,5-alpha-L-arabinosidase
FT                   C"
FT                   /EC_number="3.2.1.99"
FT                   /function="arabinan endo-1,5-alpha-L-arabinosidase activity"
FT                   /biological_process="xylan catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL84189.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0045493"
FT                   /db_xref="GO:0046558"
FT                   /db_xref="HOGENOM:HBG083225"
FT                   /db_xref="HOGENOM:HBG346382"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016840"
FT                   /db_xref="UniParc:UPI000051F73E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4W930"
FT                   /transl_table=1
FT                   /translation="MLYSTPALALRLASSSLGRIATLPAVGLRFGPLCMASPNPTDSAP
FT                   RSSAAPRGRLDEGDLGLREVAVTAAMAAFSPKAERIWGNLREIPLAPIFVMYLYTLILL
FT                   FLASANVNAYANPGACSGNCWTHDPGLYQRKSDGKYFRFATGGGIHIASADSLEGPWTD
FT                   DGYVLPSGSIIDLDGKTNLWAPDLHYHDGTYYLYYAVSSLGSQNSATGVATSKTMEAGS
FT                   WTDHGTTGIESTPSSPYNTIDANWIAVGGTQYVNFGSYWNNLFQVEMENGLKVKSGATP
FT                   HQIAYNASGIHRQEAAFMFERNNYFYLTFSGGIALGYNDTWPAPGEEYFIAVCRSTSAT
FT                   GGFVDKNGVSCLNSGGSLLLSSHDFVYGPGGQGILQDSSKGFVLYYHYADTRIGKAVED
FT                   YQFGWNQLKWENDWPSV"
FT   mobile_element  complement(194459..194695)
FT                   /mobile_element_type="transposon:TY1_Copia transposon
FT                   family"
FT   mobile_element  complement(195276..198815)
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   mobile_element  203166..205643
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  209630..212122
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(213906..214544)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(215191..217794)
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   mobile_element  complement(217904..218731)
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   mobile_element  222148..223536
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  223942..224670
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  228643..232182
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   gap             232724..237923
FT                   /estimated_length="5200"
FT   mobile_element  239409..240020
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  240807..241442
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   CDS_pept        join(244292..244792,244860..245249,245300..245407)
FT                   /codon_start=1
FT                   /gene_family="HOG000202723" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262230"
FT                   /orf_name="AFUA_6G01790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85860.1"
FT                   /db_xref="HOGENOM:HBG056383"
FT                   /db_xref="HOGENOM:HBG510404"
FT                   /db_xref="UniParc:UPI000051EA6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCM8"
FT                   /transl_table=1
FT                   /translation="MPLTEEQKQHWLEHGFIKIPQCFTKQDADNWTASIWARLGISPTD
FT                   KSTWNTERVNMPGHTVVDVKDFAPKAWDAICELVGGEERVTDWCKGWRDSWIINLGKPE
FT                   YKPDDPLDFRTLDNWHNDGDFFTHFLDSGEQALLVIPLFSDIRSKGGGTVLCTDGIGLV
FT                   AKHLYNHPEGTWPSLASRSGPNPPPPEGGKQWRDWVRDPQLTRAESFHEATGQAGDVYL
FT                   LHPFMLHSASRNLLREVRIITNPPVSLKEPFNYNRPDGKYSLVEQKTLKELGRPEGLPE
FT                   WRITGEREMLTPARVQIQEDMRQKELERLKEVGAPVTKLGTAKPLQSQYPA"
FT   CDS_pept        246621..248003
FT                   /codon_start=1
FT                   /gene_family="HOG000182210" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750577"
FT                   /orf_name="AFUA_6G01800"
FT                   /product="Endoglucanase, putative "
FT                   /EC_number="3.2.1.4"
FT                   /function="cellulase activity"
FT                   /function="cellulose binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL85859.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008810"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="HOGENOM:HBG056382"
FT                   /db_xref="HOGENOM:HBG325134"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR001722"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI00005206C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCM9"
FT                   /transl_table=1
FT                   /translation="MDSKRGVVAAVLALLPLVSAQQPAASSAGNPKLTTYKCTTAGGCV
FT                   AQDTSVVLDWGYHWIHTVDGYTSCTTSSGVDSTLCPDAATCAKNCVIEPANYTSAGVTT
FT                   SGDSLTMYQYVQSNGVYTNASPRLYLLGPDKNYVMLKLLGQELTFDVDLSTLPCGENGA
FT                   LYLSEMSATGGRNEYNTGGAEYGSGYCDAQCPVIAWKNGTLNTSGASYCCNEMDILEAN
FT                   SRANSYTPHPCSATDCDKGGCGFNPYALGQKSYWGPGGTVDTSKPFTITTQFITNDGTT
FT                   TGTLSEIRRQYMQNGKVIANAVSSTGVNSITEDWCTSVDGSAATFGGLTTMGKALGRGM
FT                   VLIFSIWNDASGFMNWLDSGNAGPCSSTEGNPDLIKAQNPTTHVVFSNIRWGDIGSTFK
FT                   GSDGSVTTTTSTTSTKTTTSTAPGPTQTHYGQCGGQGWTGPTACASPYTCQVLNPWYSQ
FT                   CL"
FT   tRNA            248352..248435
FT                   /gene_name="tRNA-Gln"
FT   CDS_pept        join(249478..249650,249694..250131,250176..251091)
FT                   /codon_start=1
FT                   /gene_family="HOG000202668" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750578"
FT                   /orf_name="AFUA_6G01810"
FT                   /product="Cytochrome P450 oxidoreductase, putative "
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="EAL85858.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG056381"
FT                   /db_xref="HOGENOM:HBG332080"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="UniParc:UPI000051EF19"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN0"
FT                   /transl_table=1
FT                   /translation="MDNLSLVVGTLILIAGSALMLRLRHDPREPPVVHNGIPFIGHMIG
FT                   FVRHGIDYYALQSAKHGLEAFTMDVLFTKIYVITTPTLVMATRRHHRAMSFEPAITGAA
FT                   RRVTGLKGRGFELLSEKRPGGENLHGAVVNAMRPALEGAGLDRMNEKVIGYLLRSVDDL
FT                   PTAAPFDFHAWCRAALTLSSTDAVYGPLNPYRSKELQDAFWDFEENLALLLMDVVQRVT
FT                   ARTAWKARRRLVAAFLDYYRAGGHLDSSQLTYARWETQQKGGATLEDIARLETAAALGT
FT                   LSNTVPAMFWFMFNIFSRPELLNEVRDEVARRAVQVDAQGVHTVDLAEIKEKCPLLMSA
FT                   FQETLRLRSNTVPIRVIFEDMILDDRYLLKKGGILQMPAHAINRDRTIWGSDADDYDPR
FT                   RFVKINQSDSRKKANGFLSFGTSPHVCPGRHFATGEILALIAMLVLRYDIVPAGGVWKE
FT                   PRTSKSAITSSTGPPAEEFKVLATARKEYEGVEWAFRVTEGKGKYGLIIG"
FT   CDS_pept        join(251902..252391,252470..252884,252933..253560)
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055876"
FT                   /orf_name="AFUA_6G01820"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL85857.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG735353"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051F191"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN1"
FT                   /transl_table=1
FT                   /translation="MIQVPSATGDPERLRADGELFDKDAALAVVSDVAMEIDPEVEKRV
FT                   LRKIDLFFMPAMLVGYGLVYWDKAILGSATLFGMTNDLHLVVIDSSTTPPSKDTSRLSW
FT                   ATSIFYFGMLAGLYPMTFFLQRFKIQHVFGPIVMLWAVTCAATAGVTTWQGLFAQRFFL
FT                   GFVESVVPTGFMTIVSGYYTQKEQSLRQAWWFSGTGWFTIIGGAMNYGFGQITSGSLKR
FT                   WQYIYIFAGVLTFLFGIWCCVMPNSPVSAWFLTPEERVVAVERLRRGQTGVRCQKIKLS
FT                   QIKEAALDIKLYLIAIMMAAAYTINGAISGFGPLIVSTFGYDTLDSILFQFPVGGICVI
FT                   FIPLCGYVASRVPHTRIPMLIACCLPVIAGCALIWKSPWGYQPAAPVVGYALTGFFGPV
FT                   VSLIITLGASNVAGATKKTVMAATVFVAYTVGNIIGPQLVKTQTVRQHYPELWTGLIIC
FT                   YGVTIAAAGVLYGILRRENRRREAMELDESQRDKMAFNDLTDKENPFFRYVL"
FT   CDS_pept        join(complement(253866..254352),complement(253595..253803))
FT                   /codon_start=1
FT                   /gene_family="HOG000016840" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262231"
FT                   /orf_name="AFUA_6G01830"
FT                   /product="O-methyltransferase, putative "
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="EAL85856.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="HOGENOM:HBG236958"
FT                   /db_xref="HOGENOM:HBG735968"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="UniParc:UPI000051FB61"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN2"
FT                   /transl_table=1
FT                   /translation="MSNPLQSHPPHILAVLDRLHAESAAQESSIPRTVYTTSSTDSFHT
FT                   LMRNKFIALEQDKCHFIYQLARTLNATSIVEAGTSYGVSTIYLALAVADNLVSASASGP
FT                   SKGTVIATEYEPAKAAQARKHWAECGEAVSSVIDLREGDLRETLKTNLPDRIDMLLLDI
FT                   WTPMALPTLKLVQPKLRYGAVVVSDNTLSAAEGYKDLLEYLRAPGSGFSTLTLPYKGGL
FT                   EMSVYVPQQ"
FT   CDS_pept        join(complement(257601..257750),complement(256952..257533),
FT                   complement(256715..256875),complement(256500..256661),
FT                   complement(256097..256447),complement(255434..256019))
FT                   /codon_start=1
FT                   /gene_family="HOG000174895" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207162"
FT                   /orf_name="AFUA_6G01840"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85855.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055982"
FT                   /db_xref="HOGENOM:HBG326933"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051EF18"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN3"
FT                   /transl_table=1
FT                   /translation="MSDSHYQSSSRPLAPAPGRLLKRNASSDELVPARKHKTTACKACK
FT                   RKKLKCRGDPPCQHCVSHGVKCEVEAMSDMRRKNAMDRKVAKLEKVADTLTRLINALRD
FT                   SESRRVSQLLNLIRSNASFDELQLFLEQQFSHYELESTPELRDIQSQLSQTTDLAPLGW
FT                   RYLRVDRLADDPVYKVPAKPWTAVTDDSELVSHLVSLWLTWTYPWFNWLDADCLIKHMQ
FT                   EGKLNSRFCSPFLVNAILAEACYYSDYEEVFTVPGDLLTRGDQFFDEARRLFEAGEDEG
FT                   DSPSLPTIQGLMILFVRTSMMGKDRMGWVYLDLAARGAQEYAASHPPHAMEDAEERRAI
FT                   DRTLWGIFSMASTASVSLMKHFESHPPQQSPITRIIHQRHKDDVWQPYPRSTDAGVPSH
FT                   ISCVFNRWCAIACIAVEISRAIYCEEDRIPRAEMLPFINVIYQKLQDWYADMPECLLVE
FT                   NITVPHALSLHLFYHTTVMQIFGLLKANHEHLDPASIQRARNICIESALRIAGLIGIHR
FT                   DKWGIGRMAPSTIQWLSIGMFTLLDALDSPDTRNRAAFIEMCIVARAFARRFPLAKGIL
FT                   RMIQLSANQMQVVLPAETDALFTDFETRSWEGKDRQTFSTFYPNFARVVRQGAAREEDV
FT                   SMDRFLEKWDSLAISDPKEETPPDEGGS"
FT   CDS_pept        join(259325..259768,260537..261274)
FT                   /codon_start=1
FT                   /gene_family="HOG000048653" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902583"
FT                   /orf_name="AFUA_6G01850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85854.1"
FT                   /db_xref="HOGENOM:HBG056380"
FT                   /db_xref="UniParc:UPI000051FB5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN4"
FT                   /transl_table=1
FT                   /translation="MRATTHGQRTEDHDDQDPAKICSLTHVQVWTFRQRRFSGPHVTRP
FT                   DPSILLLQDSKQTFTWLSSTVDYSHMTFLASQRIHRIHVIDHLLLTISPSRTRVCPHQT
FT                   RQQEYPGPNPRQESVFDLIQDIEHDQRDQHVPSSGRSAPPCDGKQPRHPLPEPNCPSTE
FT                   DVRYPQLPSRMRTSPAPQSTNTMRTMRSYDDFTRDADDADTAIADPTATTTDDDDRRKR
FT                   TKTTHAASRICYDWMIVLGNCHYARDRASFTHYRAMPRRTLVKNNIFNPHEELEVAGVG
FT                   TVELRVCRTVRDGGASSHVLVLEDVLHIPEAVCNGFNPLLYGSSMSCNMEYWEGADRRG
FT                   EPVWFAVPYAGGTRLVLAGNPKGASELIQGRYYTLSLSITPQERREIFDAMAC"
FT   CDS_pept        join(262424..262564,262621..262834,262890..263239,
FT                   263311..263533,263628..264364)
FT                   /codon_start=1
FT                   /gene_family="HOG000178887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207405"
FT                   /orf_name="AFUA_6G01860"
FT                   /product="MFS lactose permease, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85853.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG190581"
FT                   /db_xref="HOGENOM:HBG327082"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E5C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN5"
FT                   /transl_table=1
FT                   /translation="MERLNSYDSPQGLYYPDDAHIRGISNAALAMATFQQKPRLWSKNM
FT                   FKLYWAIAVATLNSCINGYDGSLMGSINSYRQYREYFGFDPEAGTPSTGIVYAIYTIGN
FT                   IVGSFCAGPFTDFRGRRVGMALGAAFIILGTIVQATCTNLAGFMAGRFLLGFGVATSAT
FT                   AGPAYVSEIAHPSWRGSLTGLYNVLWFAGGIPGTFIPWRTSQIEGTMSWRIPIWVQMVF
FT                   AGLVLVLCWTIPESPRWLVSRDKHEEAIRVLATYHGDGDRNAPLVQLEYREMVEDISNT
FT                   GADKRWWDYRELFNSRETRYRSMLVILMAFFGQWSGNGPVSYYYPQMLAGAGITSNTTR
FT                   LLLQGLQNVCQFVGAIFGALLTDRIGRRAQLLTSTALMVLLFSIITALNATNVDPPDDE
FT                   TGGVVVVAKSAVVARAQIAMIFIFGFVFSAGWTPNQAMYPVECLRYESRAKGMGMNNFF
FT                   INVANFYNTFVTGIAFTRAGWRYYLLFIFWDVLELAVIWFLFVETSRRTLEELTAIFQS
FT                   RNPVKASLARDEVLIPQVEQEVEMRRKDYDRRKVDLT"
FT   CDS_pept        join(complement(265716..265856),complement(265215..265657),
FT                   complement(265075..265169),complement(264914..265014),
FT                   complement(264445..264864))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750821"
FT                   /orf_name="AFUA_6G01870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85852.1"
FT                   /db_xref="HOGENOM:HBG056379"
FT                   /db_xref="UniParc:UPI000051F419"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN6"
FT                   /transl_table=1
FT                   /translation="MGDSFTNEAFTLLSLAIVVIILRIVARIMTVGLHNFQLDDYLMPL
FT                   AGVVYGLETGAAYCVGAWWKGLANNHMTDDQRAALSPDSEEFRLRVGGSKTQVLGWSLY
FT                   TTLLWLLKACMAIFYSRLTYVSPRLEVVTDTDTDADTDADADGQGRSDQHAYPRACGLR
FT                   GHRGDLSDCDSVDPVWLPSDAQELADLSKSWPTLPTRHRAARCLHDRHAECRDGYLSHY
FT                   HSHTARLPWREKLELFILFSGGIFVMAAGILRCVLIVTAGANGASQAGSWACRETFVAV
FT                   VIGNAPMIYPLFRRAARRAGWYISSRGHSQSYPAYPLSEGERGENSTHHSKKRRFRHPL
FT                   SIPDTHWHTINDEAMILPTSRQQPPTCTASPPRDWDALSQPSADGIKVVHEMIIERNER
FT                   "
FT   CDS_pept        complement(266924..267151)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263224"
FT                   /orf_name="AFUA_6G01880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85851.1"
FT                   /db_xref="HOGENOM:HBG056378"
FT                   /db_xref="UniParc:UPI000051F670"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN7"
FT                   /transl_table=1
FT                   /translation="MSAWWAYTTARAGEERDKQRERDKQSASAQMDLWTEEIAWQHSVL
FT                   MLLYVRMPKTILTGLKISVLLVFLAAALAW"
FT   CDS_pept        join(267598..267631,267670..269438)
FT                   /codon_start=1
FT                   /gene_family="HOG000202646" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056118"
FT                   /orf_name="AFUA_6G01900"
FT                   /product="Flavin-binding monooxygenase-like protein "
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85850.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056377"
FT                   /db_xref="HOGENOM:HBG326881"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000052093B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN8"
FT                   /transl_table=1
FT                   /translation="METVDLTVIGADIDRSGWSGLAAIKTYLQVNPSSKVMLLEAASSI
FT                   GGVWAKHRLYKGLKSNNMLGTYEFSDFPMDPATFGVQPGQHIPGHVIQQYLERFAEHFQ
FT                   FRDRIRLNTRVRSAEHRPDGTWLLRTEHHGAAQEVVTRKLIVATGITSQAYLPDFPGQE
FT                   AFDAPLFHCRDLLQYEAELLQHGRRITVFGGTKSAWDAVYAAATAGAQVDWVIRQNGHG
FT                   PVWMAPPYVTPLKKWLEKLVTTRLLTFFSPCIWGAADGYPRIRRFLHGTGLGRKIVDAF
FT                   WRILANDVVQLNRYDAHPETAKLKPWISPFWIASGLSILNYPTDFFELVRSGAVRVHVA
FT                   NITRLAQGTVHLSSGTDLPSDALICSTGWKATPNLDFLPPGLETDCGFPWAADPIPADL
FT                   LAAADEEILRRFPRLRNQPAPPKDYAPLAPDAPATAAHPFRLARFMVPCSLARERSLAF
FT                   MGIAMTINTTLLAQVQALWITAFFGGSPVLRTTERCPRALRAVDENDDHADADAEKLDE
FT                   KREQMDLVWETALHTQFGKWRYPGGFGKRNPDFVFDAIPYVDLLLNDLGVSSVRKSGIF
FT                   GRVLSPYGMEDYRGLVEEWMAARQ"
FT   CDS_pept        join(complement(270570..270667),complement(270093..270472),
FT                   complement(269632..269963))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207406"
FT                   /orf_name="AFUA_6G01905"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85849.1"
FT                   /db_xref="HOGENOM:HBG056376"
FT                   /db_xref="UniParc:UPI000051FDAC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN9"
FT                   /transl_table=1
FT                   /translation="MEHHHCVGDKTSAFTDDRDVPTSKILSLINLTILERSPRPPPVSR
FT                   LSKPKVHPINTTVFDWWHFDAVSASNPNASGVITLFTSTPTAFPFLPGKSKSKSNTDSV
FT                   LAGLPLDLISKWDRDHLRTLSRYIPSDSRRSPRRYPRDLARERRFLCWIRARGVSVWGV
FT                   DVDARGLQLICPPYGLEQNWSDGPFETAVRTWYWGRERVGPFSVVWFDMLPAGHGTEVV
FT                   SGYVAVGMEVVVSVRPWKDGWQLLIRQCVRMCRMGFRVFIGLGWRWM"
FT   CDS_pept        join(complement(271104..272258),complement(270945..271049))
FT                   /codon_start=1
FT                   /gene_family="HOG000202632" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056119"
FT                   /orf_name="AFUA_6G01910"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85848.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056375"
FT                   /db_xref="HOGENOM:HBG327074"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000051FFEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP0"
FT                   /transl_table=1
FT                   /translation="MGTALGDLNAPPPLNARRPAAPTLPSFELPPPNFQINVGTPKYPL
FT                   QSNTHPPAHPSVSSLLTPPASTQAGEVTAPSTAAPATTVSATSDVTPSYGTAYWQGHSG
FT                   YGSTPGPRQPWTAGSNQSYPTRDSFSPSTLNPLSRNQPTSPPVTEGMAQPYDMHHLPPF
FT                   QQSLSVPPSGLPTGTAPHPAMTHAMLASPTGLPNPGPSPHLLPSNDPYGPKSQPAPVYG
FT                   GAQQIPSPHQTSFPPYGQPGLGIHPPGRVSSTPTLSATGPPPHLNYSRQPWPSYSLPAM
FT                   NGPVMTNIHSPNSQMSLLGSMQPGILPGFNSGHVASMQQMYGGHPPHPIHQPGPTNDRP
FT                   FKCDQCPQSFNRNHDLKRHKRIHLSVKPFPCTHCDKSFSRKDALKRHILVKGCGKDGPK
FT                   TSTASVKEEDKEGVDTNGHS"
FT   CDS_pept        join(complement(279314..279424),complement(279053..279241),
FT                   complement(278751..278998),complement(277771..278671))
FT                   /codon_start=1
FT                   /gene_family="HOG000190808" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263225"
FT                   /orf_name="AFUA_6G01920"
FT                   /product="Xenobiotic compound monooxygenase, DszA family "
FT                   /function="monooxygenase activity"
FT                   /protein_id="EAL85847.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="HOGENOM:HBG419245"
FT                   /db_xref="HOGENOM:HBG673014"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="UniParc:UPI000051FDBB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP1"
FT                   /transl_table=1
FT                   /translation="MGDSAGTASTGRTGQKHILLNAFDMSTVGHLSPGQWKNPNDKSAT
FT                   KRSLEYWIELAKLLERGGINALFLADTFGGHDTYQGKLDECIRRAAQWPVTDPSIPISA
FT                   MAAVTKHLTFAITSSTSSEAPFLLAKRFSTLDHMTQGRFGWNIVTSYKKAAFKAIGLDS
FT                   PIEHDERYRQADEYLRVLYKLWEGSWASDAVSPDPTTDSYIDPDKVRTIKHKGKYFTLE
FT                   TPHIVDPSPQRTPFLFQAGTSAAGSEFAATHAEAIFVSSHSPAVLRPKVDRIRQLAAEK
FT                   GRDPRSIKVFATFTPILGRTDEEARAKYEELKKYASVVGGLVLFSGWTGIDISRIPLDQ
FT                   EITAADSAEAGRIVSILDAFTTTSKDIPRWTPRVVAEKASIGGLGPVAIGSAATVADEM
FT                   ERWIVEADLDGFNIGHVSTPGTFEDVVELLVPELRRRGLYPEQPAQDAEALTARERVYG
FT                   KGQRGLRADHPGSRYKYDVYEDDA"
FT   CDS_pept        join(complement(281543..281699),complement(281239..281489),
FT                   complement(281155..281188),complement(279958..281099))
FT                   /codon_start=1
FT                   /gene_family="HOG000179304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263226"
FT                   /orf_name="AFUA_6G01930"
FT                   /product="MFS transporter Seo1, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL85846.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG056374"
FT                   /db_xref="HOGENOM:HBG398100"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051EF11"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP2"
FT                   /transl_table=1
FT                   /translation="MASVQRRKWYQIKWFADDDTKEERHLIMKLDLLIVPYAFLAYWTK
FT                   YMDQSNINNAYVSGLSDDLNLRGNELVHLQTMYTVGAVLGQIPFAYLFTKFPMSWVIPA
FT                   LDISWGVFTLLQYRVTSYGELMAYRFLVGWFEAAFFPGMHYIFGSWYRGDEIGRRGGCF
FT                   YVGLTLGTLTSSLIQAGTSARLDGVHGLAGWRWMYIICAIITIPIGLLGYVILPGTPDK
FT                   PNRLVLKQADIELAKRRLQRAGHGVQEHFRWKALVSIAGNWKFWALLLLDIFFWNGSIN
FT                   TTTGGYLLWLKSLKRFSTSRINELNAIAPALGIFYTLFICFSSDLLFGPAWAITIAHTW
FT                   NIIGLVILVVWDVPQSALWFAFATTYSAVAMSSVLYGWVNSQLRYSAVERAVALIILNA
FT                   VSQSTTAWTPLLVFKTVEAPRFTKGYSFVLGNAICLVILAHVIQFFAKREEYALCHIFI
FT                   DTSNRPTGEFQKEQEATPTSATQMKRGILNLVIEQSCRCIQRSSHPRRRMIDLADMQPE
FT                   SMYAGPCVDE"
FT   CDS_pept        join(282872..282999,283061..283159,283219..283289,
FT                   283348..283395,283470..284077)
FT                   /codon_start=1
FT                   /gene_family="HOG000171458" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056120"
FT                   /orf_name="AFUA_6G01940"
FT                   /product="Dienelactone hydrolase family protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL85845.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG056373"
FT                   /db_xref="HOGENOM:HBG525846"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI000051EA69"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP3"
FT                   /transl_table=1
FT                   /translation="METQQPRSSSSLLTILLPLYLIIGHGAQLLSSIANRSKRYLCASL
FT                   LGSVKPRSIYAFRPLHCSSVNMSGISKACCSIPPIVAQGYQGKGEYKTINGMKTYVTGP
FT                   DSASKAIFIVYDIFGFFPQTIQGADILATSSEQKYRVFMPDFFEGKPADITWFPPQTEE
FT                   HKQKLGNFFQTKAAPPANLPKIPSFVDEANKLAPNGKAFESWSILGYCWGGKIACLSSA
FT                   KDTKFKAAVQCHPAMVDPNDAKNVTIPMAMLASKDENPKDVEAFGANLKVDHYVETFST
FT                   QIHGWMAARSNLEDEEVRKEYERGYKTALSFLQKHA"
FT   CDS_pept        join(284815..285057,285123..287996)
FT                   /codon_start=1
FT                   /gene_family="HOG000202621" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263227"
FT                   /orf_name="AFUA_6G01950"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85844.1"
FT                   /db_xref="HOGENOM:HBG056372"
FT                   /db_xref="HOGENOM:HBG327069"
FT                   /db_xref="UniParc:UPI000051FFDE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP4"
FT                   /transl_table=1
FT                   /translation="MPVLSGRRRSASTAAPSNTGASKASASSPRRASFSLENSRDYSAS
FT                   GRNPLRNFFQKHGAAPVTEDVSATDVPHASIEEHSNAESTTTPNAQSVKNPDRKGHCLG
FT                   SSWTRHIHHSGEHGGGQDASKSTADTLARSHNADVHDKPSSETHLSRDDIHAIFSGAPY
FT                   FLLEKGKHGLWYPHVIFPWDDHDPTIQHLWDRKLLPHPSYTLCTLHAHLPVPEGFLEGD
FT                   PPLLLDSWKRTGAPKRATFDIGIFEVPNMLAMSGIEPGTVGFRYFLELPVADSVRFVHT
FT                   GTSHPHTNLLHIHSLPAVQADELLEHYHEPYSQCLDGTIHDRKKLLGDGPTAWKRIGLR
FT                   DINFKAVVDRLETLRNLRHKLLYETTQKTILDVETAQDLYSDLFSKFLHSPPRSILKDL
FT                   DSTHGLKAEIKALTMVLATPGAWFDFSLVDWRFRIGQLLWEAPPHVDGDFFDPSILHKP
FT                   WAHPGLEQKWFLIQMLLAAELLLRLDAIVKVGLLESSKDVSVSAQDVNHFDKLRNPKVD
FT                   WDLVVVRRFFDSFKISWVDCQSAAVSNAPSQPPTQEKSPQKARRFSFFDSITRRHSVAS
FT                   SPHSDDQGMFRLTPTHIEQQVEGLLVFAENIGWPRVDSLREIFASKLQHGDSNLDIKEI
FT                   FNRPARGASVEGHTEETTKDDTFRKLATRRLVVLSGPSSDDTKSAMGGWITRCWLSGFV
FT                   VPGQAISHLLMATVLENDQEAIARLGLIANLYGGFALNGKSWWSQECIVGRVLSALNET
FT                   KACMGWISSTNIPKEYQTQEPLDDAWFEVIVSEPPTGLGKPRIKQGNKISVESTPLGLG
FT                   SLVSGEFTLPVDDVPDAKSPVDVKFNALTFSTMEERRNSNQHAIVARKATMSFSLRTGT
FT                   STATADVSFPLTYNVNFVTSHACRLPPGLASYQHNASPDGDGKGDRSRSLSPAEAFSLK
FT                   YGRLPGHPLPSSYRYKYLALDDLPAPEGSSIAKVFEHAGFDLTVDEVFVVDARQSAEKE
FT                   ALARSWCASVGYDAIIGRTGRTCLGCCIREARALAVKVVIRVGDQEITG"
FT   CDS_pept        join(293478..293601,293700..294032,294097..294746)
FT                   /codon_start=1
FT                   /gene_family="HOG000202610" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263228"
FT                   /orf_name="AFUA_6G01960"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85843.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056371"
FT                   /db_xref="HOGENOM:HBG327059"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051EF17"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP5"
FT                   /transl_table=1
FT                   /translation="MPAVLVQNMTSLPNAQAPIMENPTADKKRNKLGYHRTSVACVHCR
FT                   RRKIRCLVAADDPQGRCENCIRLRKECQFFPVDQQPPVEKKSRPSSRLESASTDPSTTS
FT                   SSPPTMGGGADHSESFFAYQPMPLDASQDASGFHATSFPGNPMSSFVPGSTDFAAAPTL
FT                   DPSVPWDEYTTISDPQILSAMAAGKHQMMNVPPNAWSPGPNNMVAMPPNPAMAATPTVP
FT                   SQSQPISPVQTYAMQPDGSVWPVAQPTRSMTFPAQPEMASYPNPSQFSQQMHTDLKRRM
FT                   TSPAQGYPGTPINPQSPPPAELQTTTVSMSYPGQPAGMGYPGWHDMNGMPTMNVVQYPM
FT                   YTADPAQQAAFGAPPAHMGHPGQGPPPT"
FT   CDS_pept        join(302648..303075,303159..305376)
FT                   /codon_start=1
FT                   /gene_family="HOG000202599" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207407"
FT                   /orf_name="AFUA_6G01970"
FT                   /product="GATA transcriptional activator AreA "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription activator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="nitrate assimilation"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85842.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="GO:0042128"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG056370"
FT                   /db_xref="HOGENOM:HBG327052"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR011420"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniParc:UPI000051FDBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP6"
FT                   /transl_table=1
FT                   /translation="MSGMSHGGAPKAARPTPTAVSASSGYDIADADRSSSSHFHHTSQL
FT                   SDDFSLGSPLSPPDSAHVQDGLLQDSLFPEWRNAAPRDGVESPDEMQRKDPLATQIWKL
FT                   YSRTKAQLPNQERMENLTWRMMAMSLKRKERERLQQNNRPSTKNSGSSEPSGIAQLRQT
FT                   DRPSFARPSTSTDLASDPMNIDDFIVPIESPADRPRSPPTDKAATSSVAIPIKSRKDQS
FT                   ADATPVPASFPHPPQDQRRNNEFGYVPRRVRKTSIDERQFFNLQIPTRKRPAESSPQVP
FT                   PVSNAMLAQDPNFSAGVPDYTLDNASSGFALHSNTQNHHNNNNLTSPGVPFGLDTFSLG
FT                   EDPILSSAGPYQAHFTFSPSDSPMTSANPFANVYAQTPIASSLNSTEFFSPPPSGYQSS
FT                   VSTPQPTYDGDHSMYFDMPSIDARTQRRIPNYITHRSNLSASLQPRFMFNNNTGSEQQH
FT                   GMTHGSNSSSAVHSPNYTMSQSQHVDPTQVLNPSDFPTSNTHAGIFSFGADSDNEDDDA
FT                   NNYTERAGLAMPADFGDDNAGDMNGLNWDGQFPGSFHSLSGFSVQHRKHVTIGSADMMD
FT                   TPSEWNQGGSLGRTHGSAASVSEVRNREQDPRRQKIARTTSTPNTNQLLRQSMNNTSHT
FT                   SPNTPPESGLSSAVPSRPASPGGSKNGDQNNGPTTCTNCFTQTTPLWRRNPEGQPLCNA
FT                   CGLFLKLHGVVRPLSLKTDVIKKRNRSSANSLAVGASRSSKKSSRKNSVAQISMTTPTS
FT                   SRAQSNTTSESPPAIPGGAASAAGRTAGATGKSGVVPIAAAPPKATPTSAGQSRSTVQV
FT                   APKRQRRLEKASETDAADDSNKPSTSSGGRSKVVPLAPAMPPAAVNPANHSIAGGQGAS
FT                   QEWEWLTMSL"
FT   CDS_pept        join(complement(307556..308110),complement(307298..307492),
FT                   complement(307057..307260))
FT                   /codon_start=1
FT                   /gene_family="HOG000197115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263229"
FT                   /orf_name="AFUA_6G01980"
FT                   /product="Haemolysin-III family protein "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85841.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG056368"
FT                   /db_xref="HOGENOM:HBG749828"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniParc:UPI0000520217"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP7"
FT                   /transl_table=1
FT                   /translation="MVFNGLLRFRIIRSKQVKEIALGGGHDQSQPVEKQTLLTIKQLPP
FT                   WYDPNPFILSGYRPETRSYYRCFASWLYCHNETGNIYSHLIPGILLLSSQGILYEYIRT
FT                   KHENLSNFDWSIVSLQLVTASICLLTSTTYHTLLNHSAAVAHRWLQLDYIGIIALILGN
FT                   FISGLHFGFYCNPQLKHFYWSLILAFSSATAVALLSPQFRGLEWRSFRLASFVCTGLSA
FT                   FAPIGHACMLWGVPYLWKIGVKYYLLEGAFVNCIQKGKITDTLQKRVPESLYPGAFDIW
FT                   GHSHTIWHVFVTFSIGAHVMGLLHGLEYSYSQAECR"
FT   CDS_pept        join(308940..309108,309165..310081)
FT                   /codon_start=1
FT                   /gene_family="HOG000048652" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263230"
FT                   /gene_name="ipi1"
FT                   /orf_name="AFUA_6G01990"
FT                   /product="Pre-rRNA-processing protein ipi1 "
FT                   /function="binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85840.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG056367"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051F8CB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCP8"
FT                   /transl_table=1
FT                   /translation="MGSSAKKKKEKKKDFQVSHASCLHQSITNSAQKTKLKVGKTKAKP
FT                   DNFTDTSFRAKTITLNQQSLHITAPSSDAQFTHHVSLLSSKSDTQRRDSLAHLTTSLVS
FT                   RPVDSPLPQPVSVLLPTLLPLILDASSSVRTQLLKLLRALPANDIQDHVPQLLPYIRAG
FT                   MTHLAADIRVSAVEVLSWLVDVAGAEVVSCAGGWIKTLNCFLSVLGWHTEESSKWSGNR
FT                   ASFGKSGAKGQPMVKVLAALAVFLQAGIGRPDERMDDSSDEDSAPGVSGWEFPLCHAAQ
FT                   HMVPQATAPFVHLNLFGQPRDEEGEMYETREDRYRVFENRFLGAVQRGLESARGEGGEV
FT                   GRASAGVSKVLKEAIAYGPGV"
FT   CDS_pept        join(complement(312033..312168),complement(311344..311978),
FT                   complement(310419..311294))
FT                   /codon_start=1
FT                   /gene_family="HOG000202588" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263231"
FT                   /orf_name="AFUA_6G02000"
FT                   /product="NCS1 allantoate transporter "
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85839.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG051000"
FT                   /db_xref="HOGENOM:HBG333533"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="UniParc:UPI000051F8D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP9"
FT                   /transl_table=1
FT                   /translation="MIFSRPRLRITQPKSAFAEGNARWTNLDLDPVPHHRRKWGPLSFV
FT                   AYWISDAFNAATWQFASSIIAVGLSWRESLAIVAISFFIISFVIAANGAVGAIYHIPFP
FT                   VIARASWGFWGSYVAIISRVILAVFWFAIQNVNGGNAVRCMIGAIWPSFLTLKNDIPEA
FT                   QGITTAGMVGYLIFFLVQFPFLCIHPNKVRWLFVAKSIIVPIAWLAILVWAFVAEGGGA
FT                   IFDQKPTVSGSKYSWLFLANMTSVLGNYATLSVNQSDFSRYSRVSPKWQLLYIPMLPIV
FT                   FTFITFIGIAASSAGQSRYGGEIPWDPIVLISHWTSRACRFFAAFSFALASLGVNISAN
FT                   SISAANDLTALAPQYINLRRGQIICAILSWCLVPWKILASAGSFLNFMSAYAIFLGPVG
FT                   AIMLWDFWLVKRRKYDTLALYQPSNPTYRYSSWGTNWRALVAFLVGVAPNLPGLIASVN
FT                   SSIDVGVGIHPYQFGWLLGFVATSIVYVGLSVWFPARESLIERAVLADEIYDSRGTVEG
FT                   VDAGSEEVLGEGLGREEKMLGVKNGILEKRI"
FT   CDS_pept        join(complement(315014..315204),complement(313051..313987))
FT                   /codon_start=1
FT                   /gene_family="HOG000202577" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263232"
FT                   /orf_name="AFUA_6G02010"
FT                   /product="Putative uncharacterized protein "
FT                   /function="FMN binding"
FT                   /protein_id="EAL85838.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="HOGENOM:HBG056366"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI000051F195"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ0"
FT                   /transl_table=1
FT                   /translation="MADGLSLEERPRLLRDPLSEAEYPPGSLNDRCKNKRGLQQDDTTA
FT                   LTVQVETVGSTTVRSQKDCISPTSQSARVVSLENMGRATLFSALAFLAGHVLQATAIPS
FT                   AFPQDNAVNQVLLSDSYQDQSVSSISAEDDAQNSAVIHIGESETMRAPSWFTSTLMARR
FT                   LLALSTTGTVSTIFPDPLPGNSHAPPSVAGLPISLPEYIADCDEYLPADVSNGGNGDPT
FT                   FLALHISTTFRNTAAGSNVSLAIDWWDHLNQTEPVAPGFPPSEAGLPRVTLIGYVEPFD
FT                   TPLHRDIEAALEECYLSVHPDASAWLPGKPGAPHSSYWAKMVVEQVYWIGGFGGLQQIG
FT                   WMNVTEWKGIRRVRSLPGVGDGRGWEDVRLPGEKE"
FT   CDS_pept        join(complement(319303..319738),complement(317567..319239))
FT                   /codon_start=1
FT                   /gene_family="HOG000202566" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207408"
FT                   /orf_name="AFUA_6G02020"
FT                   /product="G1/S-specific cyclin Pcl5, putative "
FT                   /protein_id="EAL85837.1"
FT                   /db_xref="HOGENOM:HBG056365"
FT                   /db_xref="HOGENOM:HBG327048"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI000051FFE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ1"
FT                   /transl_table=1
FT                   /translation="MTGMDVLGLRDSNPSIQYKAPYAHPYASSVSSSASSSSSSVFSLD
FT                   CVSNQSSISSTSTNPVDVIWENEGEHQVAGRILTSATSSRGGVRGVLPKATDAAVAPEL
FT                   RRHPRRTNSCMAQSNGVTCARPPPCLLRQSDRKVNFVDNLVDTASQIVEIIWPLSAVAS
FT                   RSDSTTGCKGVLPLRTFIQETLRRSRTSYSTLQVALYYLIKIKEHVPRYNAEQEQPPRS
FT                   KPVCRAMQCGRRMFLAALILASKYLQDRNYSARAWSKISGLNTVEINQNELMFLEAIGW
FT                   RLHVTEATFQRWTDIVLKYTPGAGGPFTGEGQCWRTVIPKLTPELDTVDVELSTPSSMV
FT                   GFESGLVSGSPSPRSPSTGEHPSPSSIFNQGSAYQRYSPVSAGASSLPSMPRPPMLPTP
FT                   QLTPQTVVATAPAASGSTFCARRASICAAMSQVQNVCMARSTLDLRPSLAFCQKANTFD
FT                   GYPTVVRRSSLARSTSSASSPESMISDVSTLSSSSLSSCSSGSGPVSILGTSASTKPRL
FT                   AMKATHRCTSNSLKEGRKALAIASPIDEGPLGEIYSSPETYLGAAGQVPDLSNISLGTP
FT                   VDHEAAQSLCELSGAISRSAQTFEQGTTTQRQCRKRGRTGSEDILWQNHVRHLMNPNAR
FT                   NEGKASDCSMSDTRSYPKHSQSLSAAQLSLLAVSAPLSGPAGMKRACCGSEARKIALNP
FT                   SVRSEYLG"
FT   CDS_pept        join(complement(325419..325500),complement(325135..325223),
FT                   complement(324762..325112),complement(324631..324708),
FT                   complement(323985..324575))
FT                   /codon_start=1
FT                   /gene_family="HOG000017511" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263233"
FT                   /orf_name="AFUA_6G02030"
FT                   /product="Aminotransferase, putative "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="EAL85836.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG000049"
FT                   /db_xref="HOGENOM:HBG635316"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051EF05"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ2"
FT                   /transl_table=1
FT                   /translation="MASEFNIAQARTRFPALNAEQVFLDNAATYGISRAATTAFSKGYE
FT                   AAAKFVNASPDELRLALTPLPQICLGISTTQLLHNLSTALKFEPGDELVLSKLNHEANT
FT                   APWVRIAERLGLQVKWWSASDTRNPVCDLDELGQLLSEKTRLVACPHASNITGTITKVK
FT                   EIAKLVHQYPRALLCVDGVALAPHRQVDVKDLDVDIYAFSWYKVYGPHIAELYASSRIH
FT                   DQINSLGHFFKGTDTLDLKLNLASASYEATQSIPAVLEFLGPNPAATWDTIASHEEKLQ
FT                   AILLNYLRSQDQITIYGEPSSSKVLRVPVISFTVQGIKSQKVVEEVERRTQFCFRHGHM
FT                   YSHRLLNDVVGLEDVEDGVVRISMLHYNTGESAPGSLRGRVADGHQRKKLPSWSRA"
FT   CDS_pept        join(complement(326592..326609),complement(325918..326523))
FT                   /codon_start=1
FT                   /gene_family="HOG000202555" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207409"
FT                   /orf_name="AFUA_6G02040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85835.1"
FT                   /db_xref="HOGENOM:HBG056364"
FT                   /db_xref="HOGENOM:HBG327040"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniParc:UPI0000520216"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ3"
FT                   /transl_table=1
FT                   /translation="MAYATVTTQVPQHVTALLSHLTSRPGVQSTFILSRKDGSIIQSTG
FT                   LLASPPPRNSTTSETQTPPAPNDANSTTTIPTESLDPSSPAGASTARAPTAQKPYQPSQ
FT                   AEALAARIFAFVESASELGMTLSCPRAEDMDSYQTGLNGDGAGRDDARSEGVDREEEDE
FT                   VKLLRLRTKKHEIVVVPDRKYLLCVVHDAAHASGGSGVAGVRSR"
FT   CDS_pept        join(complement(329353..330141),complement(328016..329282),
FT                   complement(327827..327977),complement(327351..327795))
FT                   /codon_start=1
FT                   /gene_family="HOG000202544" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263234"
FT                   /orf_name="AFUA_6G02050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85834.1"
FT                   /db_xref="HOGENOM:HBG056363"
FT                   /db_xref="UniParc:UPI000051FFE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ4"
FT                   /transl_table=1
FT                   /translation="MSTLPSQTQYLAAAENDRPRQSLEVQMTNEDITELHRFLQSPSTT
FT                   PASQVTGARELLKAGQRRLRQLAQLQWKPTDPKTKAEEASRHLLVLQQEGFLSLPASAA
FT                   KKSLDSVMSGSRSASSFGFRSSSQRDVEKIGQPWLENPLEVSATQHIKSPEPSPLDLGN
FT                   LTSMVEAAVSFPFHFDDAYPPPYQPPANTTSDQRTEGQDSCHLHSAACQLKPKERRTED
FT                   QGAPSAVSTRQVLTNGKDHIPPTVLPIKDVARDGPKDGKSQVVDSDEDQNNSAQLLKPP
FT                   TSRAKAGPRDPPNPVAQSLKLFPDTMPPRSSSKGAWRIPNNRIRGKNAPISAKFSDSQQ
FT                   IPATVASKRETDNVKNSIKGTSECQGDPQRSYHSGKASTTRPRKPCSEPAMSPIHPEFP
FT                   RLKNTRRPASLPMGTIDSFPLPAPLRPLPSLPEQPPALSTVRHHNTPVIKAATRTNRDH
FT                   SGAFPTTTSNNRSDAEHCHLNTQFALPQLSLVGDDLPASEQGKSVEEAPPNHPESSGKA
FT                   EENQAERLHSLKFRDMMASRISLDEARKGDGINSPASPMSSGSDHELRIGYENEHLVRT
FT                   SVQKEATPPAPLSPPLSPPPAPPLVKSAEQLPFSRRHVSSATAIMRASTERREPSLPAS
FT                   DRSATVHRSKRTRSIDVLHELVASEQHTSNRAGSPLPSSDDECMDKGTFMCSLKKVEQS
FT                   LSEPTAWSKEVQYPRSERPLDAAKAKKPHFGGDTLIIARLIERDKAAHTLVLLEGRIEQ
FT                   LERQNRILQAALFAALDLGVKPNAEALLGGSTTSLSASANSSSAETSSPSSTQRASKLP
FT                   GRAVANGRRSLMKKSLRRPESWIDSPGASLQSDYQSDDDVSVRDLEEMIEDIEFTCSSD
FT                   KPGSDRVRIGRD"
FT   CDS_pept        join(complement(339950..339972),complement(333649..339856))
FT                   /codon_start=1
FT                   /gene_family="HOG000202533" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902850"
FT                   /orf_name="AFUA_6G02060"
FT                   /product="tRNA-splicing endonuclease, putative "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="EAL85833.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056362"
FT                   /db_xref="HOGENOM:HBG327038"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI000051ECAC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ5"
FT                   /transl_table=1
FT                   /translation="MDFMDIVGELRALPDNVHILCPRQHDDDHGRYDDPNEIDDAGKSA
FT                   AELVAEASSRREKFLSCMRILAYNQEGVEELQTWIWRKLDDALEKCDLCIKQYYTGKIW
FT                   LMEQLKENYDDEDIEKFARMLDDWDVKRITKNLATATAKLKEVPPQEIGLHVLDRASLL
FT                   SIFESLSCEAMLRNDTLLQEHFDEPFRLIQTKRSLKVSDYVPAVTRFLFDSNQSRSFWA
FT                   IHSWMRYSRPPTALEFDWAIKEGLLDMLKTASQQPPQIAVIQRLWRGMQLVVKRLDKDQ
FT                   ITHHLRALEIDPCRLSVEHLGIQSPGLRFLLNTIQIFLEKAPGDFWDAMQTISPQAIIE
FT                   LVFYNPQLEAFLMQISEGEPYEKSALKDMLSWVEPFMSSLKGAHQPSACRSLVYQLLDR
FT                   LQNPRFPDLARYHCFYVGLASLLQTLRSFTDNESSRGSVARIVLSETMGVVSANIETIL
FT                   NPPKFAVEQRRQEEISSLCMDVIRNTLALECQSLKSDYEVILRQNLLQHGVSTYSASIW
FT                   EAVVRNLHEDNRALSTSALLGILPLVGLETFPTKGESSPEKTHFNLIYGHLTRLSCQII
FT                   ERLADFKPEHLNELLKSQDTSSALISALFAADLDTYQAAVDLIKNMSGQSARRDAISHL
FT                   LQSFFITTMYGLSWSFRRISNMKTFASAPRMLHTGTDIIDILCDSQTGMLRTRKLADRR
FT                   EILSLQKLWEYLWQALSTIFDETEAWHLRGNDKAVMLEFCRDTIQFADLLFDQYGVFLS
FT                   AVVDADPSQEASARENFLKSPTTTMSAMVKWLRLKDEYLATTLVGLVAKLLRRLGELSV
FT                   TTVKDDALSFIEGVAVKSTIKTILTLREKAELVRALEAYYKKPVVTASTASLKKQSMIT
FT                   AFAKPAEVSATPSPAKTTSEDEFDEDNVPDDVLMQLSRSVELNKERLVAEARRRGDKAA
FT                   KALPAIPKPSAAPLKPNLTVQSFREKREKEKEAKRKRDLAELARLKKNLPARGVGEQTA
FT                   EQGSGLSGIGVKGKVHTTVEESMMVSSDSESESESEDELDKELFGPKARSQPDAIKAYE
FT                   ESKKLSLKQQGPVKKIKQVRSAKDMRARLAPDLSSLHRTILAWDFFANGDLPPNSGRTD
FT                   YSLVSNTFKDPLEYQKTFEPLLILEAWQGFNSTKEEGTFRPFEIKVATRLSVDSFVEVS
FT                   TVLPSLEVKDLGLSEADIVLLSKSSRPTSDSSAPHCFARVAGINKKRGTVEISYRVNPG
FT                   SPFINSLGPGVTIWGAKITSLTPLEREYGALMALQYYDLCEEVIKAKPSPILHYSDASL
FT                   KPIADNYNVNPAQAKAIKSALDNDAFTLIQGPPGSGKTKTIVALVGALLSNVLGDQGVT
FT                   ISRPTGVTNPRVPGRTTTSKKLLVCAPSNAAVDELVMRFKEGVKTIHGRHEKLNVIRLG
FT                   RSDAINTNVLDVTLDELVNARLSQNPRKDSGERDLQTIYMEHKAADTAFKETRAKIDQC
FT                   RAQGLPVPEELEREFDLLKKKKTQLSQEIDTARDKNHSAARDADLNRRRIQQEIINNAH
FT                   VICATLSGSGHEMFQNLSIEFETVVIDEAAQSIELSALIPLKYGCSKCILVGDPKQLPP
FT                   TVLSKVASKFQYEQSLFVRMQANHPKDVHLLDTQYRMHPEISVYPSAAFYDGKLKDGPN
FT                   MAKLRARPWHQSELLGPYRFFDVQGLHQNTTKGHSLINLAELRVAMQLYERLITDFREY
FT                   DFSGKIGIITPYKGQLRELKTQFAARYGNAIFNMVDFNTTDAFQGRESEVIIFSCVRAS
FT                   NKGIGFLADIRRMNVGLTRAKSSLWVLGNSQSLVQGEFWNGLIKDARRRNVYTDGDILG
FT                   ILQRPQFTGYKNIDMMDAESPNPTASLKAAGSEPASRPTSASFDRPTSESSISTSVSRR
FT                   GTPTEPPPDLPSGGPNGLDDTRTCGYCGSFAHMTHNCDNIDAKEASRGTCYRCGRSGHT
FT                   RVVCMAERCLQCGEFGHDAQRCQSARELSKKEKSRIAREEHQHAQMKKQRTERQRQKQL
FT                   GGHDPKVPVLQVSSDPPPREDKKPEKRKPDQSNAPGKRKRTGSESPDTSKVSKPRSSDS
FT                   VPNPPKGPRRKIDANVPTNTAVGLD"
FT   CDS_pept        join(complement(345509..345961),complement(342486..345437),
FT                   complement(342202..342431),complement(341260..342151))
FT                   /codon_start=1
FT                   /gene_family="HOG000202528" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263235"
FT                   /orf_name="AFUA_6G02070"
FT                   /product="Phospholipid-translocating P-type ATPase domain-
FT                   containing protein"
FT                   /EC_number="3.6.3.1"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85832.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG176466"
FT                   /db_xref="HOGENOM:HBG745019"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000520215"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ6"
FT                   /transl_table=1
FT                   /translation="MASDFLSPDSIDPGNGVREVSSNVSKPTKRQRWATQRVAGAGGVR
FT                   KRVSIMDRLHKRSEAKSEKRGSMLPPTDDSNTESDQDAQGGSNRRVYFNIPIPESERDE
FT                   DGQIKTSYPRNKIRTAKYTPLTFIPKNIWFQFHNIANIYFLFIIILGFFSIFGVDNPAL
FT                   NTVPLIVIVVATAIKDAIEDWRRTVLDNELNNSPVYRLVEWNNVNSTEDKVSLWRRFKK
FT                   ACTRATISTYRWIRRLMKKNKDVPQMFQDERRASILTTVTPRASVYSQRGDHGMEEDAI
FT                   QMTPVPSPSAEARADWPLPAGDSDQFLHPDKRNRDSLQAVTLPVTPPRKGGSVVDPSKQ
FT                   TIGKARFKRDYWKNIQVGDFVRLYNGDPIPADIVVLSTSDPDGACYVETKNLDGETNLK
FT                   VRQALNCGRQVRHARDCEKAEFLIDSEAPHPNLYAYNGALRWEQRDPDYPDAPRREMVE
FT                   PITISNMLLRGCSLRNTEWALGVVIFTGDETKVMLNSGVTPSKRAKLAKALNWNVIYNF
FT                   ILLFAMCFVSAVVNGVAWGSDDRSLNYFDFGSYGSTPVVTAIITFWVALILFQNLVPIS
FT                   LYISLEIVRTCQAIFIHSDVFMYYEKLGISCVPKSWNISDDVGQIEYIFSDKTGTLTQN
FT                   VMDFKKCTINGVSYGEAFTEAQVGMIRREGGDADTVAAEAREKIAADTTKMLQMLRRIH
FT                   DNPYLRDENLTFIAPDYVADLEGQSGEAQKQATEHFMLALALCHTVITEQTPGDPPQIE
FT                   FKAQSPDEAALVSTARDCGFTLLGRSGDDLILNVMGEERTYTVLNTLEFNSTRKRMSAI
FT                   IRMPDGTIRLFCKGADSIIYSRLARGKQQELRKKTAEHLEEFAREGLRTLCVAERVLSE
FT                   EEYRTWSKEHDIAAAALTDREQKLEQVSSEIEQELMLIGGTAIEDKLQDGVPDTISLLA
FT                   DAGIKLWVLTGDKVETAINIGFSCNLLTNDMELLVFNIPEDQPQRASQELDEQLQKFGL
FT                   TGSDEELIAAREDHRPPPATHAVVIDGDTLKLMLSDELKQRFLLLCKQCKSVLCCRVSP
FT                   AQKAAVVRLVKNGLNIMALSIGDGANDVAMIQEADVGVGIVGEEGRQAAMSSDYAIGQF
FT                   RFLQRLILVHGRWSYRRMGETIANFFYKNMVWTIALFWYSLYNDFDGSYLFDYTYIVLV
FT                   NVAFTSLPVILMGIFDQDVDDKVSLAVPQLYMRGIERKEWSQTKFWLYMLDGFYQSIIC
FT                   FYMPYLLFSPATFVHSNGLNINDRTRMGVLVASCAVIASNTYILMNTYRWDWLTVLINV
FT                   ISSLLIFFWTGIYSSTTASAQFYKAAAEVYGALSFWVVLLMTVIICLLPRFTVKAVQKV
FT                   FFPRDVDIIREQVTQGKFKYLDQYEAFVPPKAAATSGGLSNGSAASSDLGKPIQSSMKQ
FT                   DPFSDDQQIYPPSVAPTIHTHNPRSQNGSNGTNYSFDTTQHPRPQSVQSAQRTRHSFDR
FT                   ARPSYDVNSDFNSGAMLSRVDSATGIPVPQSPHSPLKSPHDPPSYQV"
FT   CDS_pept        join(351807..351889,351911..352289)
FT                   /codon_start=1
FT                   /gene_family="HOG000048651" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750822"
FT                   /orf_name="AFUA_6G02080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85831.1"
FT                   /db_xref="HOGENOM:HBG056361"
FT                   /db_xref="UniParc:UPI000051FFE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ7"
FT                   /transl_table=1
FT                   /translation="MSDLKMIINLLKDRRFNINLYKGRGNPDAVTDLLNVAIDSGWSGL
FT                   AFPTKEAEKDFNADVDRLSDRVKKIFVSIQDSGASHLKRTLAKEALETLHYRIIYSVRS
FT                   KPPPKKTLLGHYGTEDGRAKYNLKQWIEVRSREDKKDTQMPIRSHEHPS"
FT   CDS_pept        join(complement(353062..353609),complement(352850..353000))
FT                   /codon_start=1
FT                   /gene_family="HOG000202506" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207410"
FT                   /orf_name="AFUA_6G02090"
FT                   /product="ATP synthase subunit E, putative "
FT                   /EC_number="3.6.3.14"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting two-sector ATPase
FT                   complex, catalytic domain"
FT                   /protein_id="EAL85830.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0033178"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG285939"
FT                   /db_xref="HOGENOM:HBG525538"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="UniParc:UPI000051F19D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ8"
FT                   /transl_table=1
FT                   /translation="MQVHRAHPVYEQVAGELRKMTAFIRQEALEKAREIQLKADEEFAI
FT                   EKSKLVRQETAAIDSLYEKKFKQAAMSQQITRSTLANRTRLRVLSARQELLNDLFQQAR
FT                   EKISTVASQDAKKYQNVLKGLILEGLYALNEDKVSVRARKTDFSVVKNAIEEALKEFKS
FT                   TVGKEATAELDEADPLPEGSAGGVYIVGGQGKIEINNTFEERLRLLEVDALPAVRETLF
FT                   GKNANRKFYD"
FT   CDS_pept        join(354224..354265,354337..354474,354533..354625,
FT                   354684..354958,355010..356219)
FT                   /codon_start=1
FT                   /gene_family="HOG000202485" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263236"
FT                   /orf_name="AFUA_6G02100"
FT                   /product="DUF803 domain protein"
FT                   /protein_id="EAL85829.1"
FT                   /db_xref="HOGENOM:HBG056360"
FT                   /db_xref="HOGENOM:HBG327035"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniParc:UPI000051F669"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ9"
FT                   /transl_table=1
FT                   /translation="MGNLGDLSPQGSVAVGVIVGLISTSLQAIGLTLQRKSHILEDEKH
FT                   PYDLRRPPYKRRRWQLGMLMFVVSNIVGSTIQITTLPLPVLSTLQASGLVFNTIFATLV
FT                   LGEAFTRYSFIGTILVCIGAVLIAVFGAIGEPAHSLDQLLELLQRRNFVLWMVGTAVVV
FT                   LVILLVSKSLKLLAFPHRSSRVRLIRGLCYGLISGILSAHSLLLAKSAVELLVRTIVDR
FT                   VNQFNRWQSWVILLAMISLALTQLYFLHRGLKLCSTSILYPFVFCIYNVIAILDGLIYF
FT                   RQLSQLAGFHAGLIALGTVVLLSGVLCLSWRLEIIESHACETVVGPSQTGLGPGIAFLE
FT                   EHPHSPREVGVEDEELHIGERQPLLQASHPPHGFPHRRAPSLPSVSSIPQQTPSADIDP
FT                   ASIWAELDDSDYEYTGTGPRWQPRPRSSTLRESVLRGPRHSTIGAVGQHAWTNRRHTRS
FT                   VYEGHHQRRTSILGPDNRQSLQKRSTYFSPLPGNHPSRSIGYGTSGESERERGHEGSTH
FT                   LISSSGGHEPLQLSATPSSDGPLAGSRNALAQAWRNGLQYLSRWSRHRPRTGSDSHDPL
FT                   LDSSHSPST"
FT   CDS_pept        join(complement(358038..358283),complement(357720..357854),
FT                   complement(357383..357661))
FT                   /codon_start=1
FT                   /gene_family="HOG000202474" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750823"
FT                   /orf_name="AFUA_6G02110"
FT                   /product="MADS box transcription factor Mcm1 "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85828.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG056359"
FT                   /db_xref="HOGENOM:HBG327033"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI000051E82F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR0"
FT                   /transl_table=1
FT                   /translation="MADITAVGEENPSPTQDDLQQAAGNGAADNRGPKRSRMSAEDDDD
FT                   DDDKPGRERRKIEIKFIQDKSRRHITFSKRKAGIMKKAYELSVLTGTQVLLLVVSETGL
FT                   VYTFTTPKLQPLVTKAEGKNLIQACLNAPDPATNENGVEAPEVPAETPEDVNHANVNPQ
FT                   QSNIPRPAGMHPGYMTNEQQQQMAYYQGLQQQQQAGGQYPGMPVGNRMPPQHQPTA"
FT   CDS_pept        complement(360355..361968)
FT                   /codon_start=1
FT                   /gene_family="HOG000202452" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263237"
FT                   /orf_name="AFUA_6G02120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85827.1"
FT                   /db_xref="HOGENOM:HBG056358"
FT                   /db_xref="HOGENOM:HBG327032"
FT                   /db_xref="InterPro:IPR006740"
FT                   /db_xref="UniParc:UPI000051FFDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR1"
FT                   /transl_table=1
FT                   /translation="MWKKSLDLHHSTKMPVFRLKTVFPLIALLSIIGFFWGIQRYDHAA
FT                   LRFKHPVDRVAPTTQTPQIQLQPSSPGSTKTCQADPYIMPPLPFTEWLPRKNYTRAYFR
FT                   PRFVSPRAEFSSLEDINVPVLPPMTVLERGMVVSPDNKDPSLPCPPIIDVDVAADDAVD
FT                   ETEKLLFGLATTADRLDRLLPSLLYSYGNTKAGIIVLVPESDDDLDKQMTYFRNRGLDL
FT                   TLIKSPLDFTARYFGLVQAFAEHIRTKRPQTTWVSFIDDDTFWLSLPTVAEELKLFDVN
FT                   KKHYIGALSEASWQVDTFGHIAFGGAGVFVSKPLLDVLEQYYDECQSWGEQPGDQKLGQ
FT                   CIQKYGDTPLTLWPSLYQMDMKGEVDGVYESGRKIESLHHWNSWYTKDVVKMTTVAAAA
FT                   GRKSVLRRWVFDQEEYVNNSTGKSVRTFWVMTNGYSLVKYTYDENTPDDAINFDHTEKT
FT                   WEEDPRGYEGRLGPLRLKDQAGVTKDRWLLREAYVVGDNVHQWYVREEDEGHSVIEIVW
FT                   LGPKGGGGAGVHDYAVRKQH"
FT   CDS_pept        join(complement(368500..368573),complement(368322..368440),
FT                   complement(367220..368254),complement(366678..367027))
FT                   /codon_start=1
FT                   /gene_family="HOG000202441" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263238"
FT                   /orf_name="AFUA_6G02130"
FT                   /product="Rab geranylgeranyl transferase escort protein,
FT                   putative"
FT                   /function="transferase activity"
FT                   /biological_process="regulation of GTPase activity "
FT                   /protein_id="EAL85826.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0043087"
FT                   /db_xref="HOGENOM:HBG056357"
FT                   /db_xref="HOGENOM:HBG327029"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR017230"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniParc:UPI000051F411"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR2"
FT                   /transl_table=1
FT                   /translation="MESLAETPWDVTISGTGLAQSLLALALSRSGKKVLHIDRNPYYGG
FT                   SEAAFSLQEAENWVSQVNQEPKSFPFEDASILKPQQTEECNARLASSRAYTLTLSPQLI
FT                   YCRSTLLPTLVSSKVYRQLEFQVVGSWWIYRPSSNSASGSSSTTVNAFSDLYRVPSSRE
FT                   DVFADDVISVKSKRTLMRFLRRIANPQQNDECSSEQEDLTGSFPDYLNSSFHVPAELHD
FT                   PLLSLSLAQSPPTQTSAEYAVTRIKRHLTSIGVFGPGFGSLVAKWGGGSEISQVACRAL
FT                   AVGGGVYVLDSGIQSVRNDPIEADNGDVGRIEAQLANDESIKTRFLVGSNWDLPANVLE
FT                   SAHYEKVSRSITVVSSSLESLFPVTAEGGPIPVCAVVVFPGALLGQRDDSPSVYILVHS
FT                   SETGECPPGQSVLYSSISISGPDGQSLLESAVQKLLQSSADPNAKILWCLRFTQLGRPS
FT                   RDVRGTPGIQRSSLSANILSFPPPSLDLAFDDGVIDTVKEAWKIIMGDQASDDFMNFED
FT                   REGAYDAE"
FT   CDS_pept        join(complement(370179..370211),complement(370085..370126),
FT                   complement(369612..370022))
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263239"
FT                   /gene_name="cyp1"
FT                   /orf_name="AFUA_6G02140"
FT                   /product="Peptidyl-prolyl cis-trans isomerase-like 1 "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="EAL85825.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG524497"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000051F674"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCR3"
FT                   /transl_table=1
FT                   /translation="MATDVVFDTSMGSFTVELYNEHAPKTCRNFATLAQRGYYNNVIFH
FT                   RIIPNFMVQTGDPTGTGRGGSSIYGEKFEDEIHPGLKHTGAGVLSMANSGPNTNGSQFF
FT                   ITLAPTPWLDGKHTIFGRVKSGMRVIQRMGLVKTNSEDRPVDEVKIIRAKVVEEGDE"
FT   CDS_pept        join(370513..371048,371229..371582,371755..371809)
FT                   /codon_start=1
FT                   /gene_family="HOG000048650" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207411"
FT                   /orf_name="AFUA_6G02150"
FT                   /product="Signal peptide peptidase, putative "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85824.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG056356"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="UniParc:UPI000051FFE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR4"
FT                   /transl_table=1
FT                   /translation="MDEVSPLAELLGQAIYQYTKIKPFLPTYGHLLVSALFPIYIGAHA
FT                   SLSRPSSAAKPPKKDTNNIETDNEEEDEEGLSPVQKMEGLEPSDALMFPLTAGLTLGGL
FT                   YLIIKWLDDPAILNKVLSFYFSQMGLFFAVAFLKDCLLVFRSFLFPRRYRFAGRIWRAK
FT                   QSERVFKADQQDSTQGALLALSTVGYFAFVAKPWWLTNFLGFSFCYGALQFMSPSTFKT
FT                   GSLILGSLFLYDIYFVFYTPLMVTVATKLDVPIKLLFPRPPAPGEAPDVVSLAMLGLGD
FT                   IVIPGMMVGLALRFDLPFPNLISRPACLGTLSE"
FT   CDS_pept        complement(372617..373852)
FT                   /codon_start=1
FT                   /gene_family="HOG000229504" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750824"
FT                   /orf_name="AFUA_6G02160"
FT                   /product="3' exoribonuclease family protein "
FT                   /EC_number="3.1.-.-"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="EAL85823.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG056355"
FT                   /db_xref="HOGENOM:HBG737187"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000051E5BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR5"
FT                   /transl_table=1
FT                   /translation="MAPAAASTAAPSAPPSLSLPPSQFARLQPHAYLLAHLSPPPSSNQ
FT                   PSIRANGRATSQFRVTSANTGSLTHTNGSAVVRIGDTAAVCGVRAEILHTDDIASWSVS
FT                   RASAPASINKRRKLIDTTEKPTVTANDDNDDEDDESHIQDLNLLVPNLSLSTGCAPGFI
FT                   PGAPPSALAQSLSHQILSLLHSTRLVRAEDLRIWYQPPNWGAEELERHNEDEQMDVDAQ
FT                   EGDTSAKSREIKAFWVLYIDVMIISLAGNPFDAAWAAVLAALRDTKLPKAWWDVDNEMV
FT                   VCSEAVSEAHKLSLRGMPVASSFCVFEADAASGWRKVIIPDAEEERKIEESDRKGIQRR
FT                   WILADPDGYEESLSQERICIVVDKENGEQGKTVIVKMEKNGGWAADTRELKQLVDISAQ
FT                   RWDDMKRILDSC"
FT   CDS_pept        377445..379652
FT                   /codon_start=1
FT                   /gene_family="HOG000202419" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902851"
FT                   /orf_name="AFUA_6G02170"
FT                   /product="Metalloreductase transmembrane component,
FT                   putative"
FT                   /EC_number="1.16.1.-"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85822.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056354"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000051F8CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR6"
FT                   /transl_table=1
FT                   /translation="MQIQWDTVASLAKRIIIPTTASTTPAEVAERQRDPWSQSGKYGQG
FT                   WVYFSVILLALATIIRFYHVWSDKMRIALYKEDLAGAMQGNSLQDEYELPSAATDSSTA
FT                   QFFPAGGPLPGMKKQQSSISTIAPLNNTAAFLRWIFYRPLPVLRIGDLRIVFPSLGTSA
FT                   VVLAAFVFVTLYTFVPQPLYYSSITVGSPPLAIRAGMIAVAMVPWIVALSTRANFISML
FT                   TGFGHERLNVLHRWSGYLCLFLSLVHTIPFFVTPIWEDGALIWYQQYLPRHVWIYGTGL
FT                   AALVPLVFLCIHSLPALRRRMYELFLFIHMPVSVVFVAMLFWHCKDFLASWNYLWATIA
FT                   IWVMSYAMRLFYLNWTNPFRMSFMIGEESAVTILPHNAIKVTVATTMRWKPGQYVYLRM
FT                   PGISLLGRHPFTIASLCSDDFPSEYGENYRDLALVFRPFGGFTRKVLLKAFEYGPYKTW
FT                   TAFLEGPYGGMRREMAAFDDVIFFAGGSGITAIASQLLDLIKKMRDGKAVTKRVRVIWA
FT                   LRSPEAIEWFREELRICREHAPPNTVHCHFFLTGPAQDGPGEQPGHDIVQEKIYNVLSG
FT                   MDKRNSAYIREEAAGDLEREKELRRENEDAITSLPRIYTSPVIGSRQFTALPGLQSGPG
FT                   NVPFDFGFSNAPSPPQKQTPRFASLPLQRRDGWRIDHVRPDIPRMLTEYSQTFGRRTCV
FT                   FVCGPPSMRIEVTKTVAHLQQQVMMDSRRDEIFLHAENYNI"
FT   CDS_pept        complement(380077..381222)
FT                   /codon_start=1
FT                   /gene_family="HOG000202404" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207412"
FT                   /orf_name="AFUA_6G02180"
FT                   /product="GNAT family acetyltransferase, putative "
FT                   /function="transferase activity"
FT                   /protein_id="EAL85821.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG056352"
FT                   /db_xref="HOGENOM:HBG327028"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000051EF04"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR7"
FT                   /transl_table=1
FT                   /translation="MAYQFFAKAHQSNKAPSSPPLSPPASSPSPRHSRPPMQPPSLLVL
FT                   PQSSSPSATPNIASRLKPPAARDPLFQPPAYPHAISPGYQTPHPHVTIDPVSTAHIPSL
FT                   TRITGLLLPIRYPNSFYTATITDPVIASVSRVAIYHDHPVAAAPSTTPSPAASGLGAST
FT                   GTDKVIGGIRCRLERLSVGSETSSHSQKPEPTNLYIQTLHLLSPYRGCGIAASLLNSIL
FT                   FASPPSPSSSSSSSSFSSYNVSELVKHYNIRTVTAHVHEANEEGLRWYIARGFQVEEGL
FT                   VENYYRRLKPSGAKIVKLVLQWSDDDGSDADGTSQSGSEQAQPGQNDARDQDEDDDWEK
FT                   VEAEDSDDPDAQGVQFTESRILEGGDGPPRKRKADDEPQRH"
FT   CDS_pept        join(382183..382288,382393..383303)
FT                   /codon_start=1
FT                   /gene_family="HOG000202393" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263240"
FT                   /orf_name="AFUA_6G02190"
FT                   /product="Transcriptional activator (PtaC), putative "
FT                   /protein_id="EAL85820.1"
FT                   /db_xref="HOGENOM:HBG056351"
FT                   /db_xref="HOGENOM:HBG327027"
FT                   /db_xref="UniParc:UPI000051E5C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR8"
FT                   /transl_table=1
FT                   /translation="MAAELIPDFLLASNNSETEDHLAKMGDSKETEAQASQTCDILNET
FT                   FYNIIHDIVAQVHRDEKVARMRSAVVVARQKAEEEVARRREDAGGKATGSVDSEDLKGI
FT                   RVETDGAVFEDGKVYLKGNPLQTTKEIICPDCRLPRLLYPVTGVGARPPPDPYREYCQN
FT                   QPLITKPGHDVHGNPFATDKLNPKKKKQTNASNTPASSPPTTPDSSFNKTQEKVSYPTV
FT                   KCPNCPRYFVVTRVAQHLDRCMGLSGRQANRNKTPMENGNGSPSTGPPKRPLADDDAPP
FT                   TLTKKKKLNTHKKLSGKKPPLPPSSKLRNGLTPDMAAAADAAASGDVDVKREAKDNA"
FT   CDS_pept        384019..385632
FT                   /codon_start=1
FT                   /gene_family="HOG000202382" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263241"
FT                   /orf_name="AFUA_6G02200"
FT                   /product="C2HC5 finger protein"
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85819.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG056350"
FT                   /db_xref="HOGENOM:HBG327026"
FT                   /db_xref="InterPro:IPR009349"
FT                   /db_xref="UniParc:UPI000051EA71"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR9"
FT                   /transl_table=1
FT                   /translation="MSNSNLVAWAVPRLAQLLPLDEESLTQIITYSAGLPKEEGAEHLK
FT                   NLLGDSPAAFEFIASFSARRDQTQAQTRSTVPSPVRGGEEQSAATDAYTTDNVNSGTKA
FT                   GAKRGKKAKAPLHSAGPVRRPENFGNVAGGYRKEDQDEEYMSAGTARQVRQDTAALRSK
FT                   GSASSLQVPQRQSALSSLESSAASSRTQSPAPRSSGTPKNPPSASGPVLSDLLPNVKSK
FT                   AAKPSTRQQGGGSSSKGALTTNNISDLTAAIAALEVSTNPTLGNGRQKCNCYATIHPLF
FT                   EPAPNCLNCGKIICSLEGLQPCSFCGTPLLSNEEVQSMIRELRAERGQERMRAHNESVH
FT                   REGGPGPTPVGNSKLDAAKAHRDKLLQFQAQNAKRTRVVDEAADFETPNVASTLWMSPA
FT                   QRALALKKQQRILREMEEQARPEWEKKKTVMSLDIKGGRVTRVYQSAAPAQSSSAAEEK
FT                   EEDVEDVSYEKSKPTGGEAFSRNPLLAAGGLLRPVWKAADDKQERTATKERKQTWRRVQ
FT                   DDNDDNEQWILDGGLHGYTT"
FT   CDS_pept        join(386599..386676,386769..387388,387435..388338)
FT                   /codon_start=1
FT                   /gene_family="HOG000169619" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207413"
FT                   /orf_name="AFUA_6G02210"
FT                   /product="Cytochrome P450 monooxygenase, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85818.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056349"
FT                   /db_xref="HOGENOM:HBG325771"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000051EA70"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCS0"
FT                   /transl_table=1
FT                   /translation="MLVQPLLENLSVWGAVQGILSLLGVLTLAYVTYNRFFHPLRSIPG
FT                   PFLASITPWVQLYHGLKGDRHLWLHRLHEKYGSHVRAAPNFVSINTDRGLHDIYGHGKR
FT                   LRKANFYNAFPAIKGVYNTHNAIDKAMHGRKRRVLSQAFSDQALKSMEDVMLLHVRQLC
FT                   EILTGGLDGPKGEKSATAVFNLGDWFSYLTYDVMGELCFGKSFDMLISSGRRKLIELVD
FT                   RAANRHYVVWPQKKKCGLWMPLDTWHLDQILIHKLTNDRWNFIMNSRVEANERAKERTQ
FT                   AGHDAKKDFFYYLLNAKDPETGKGLTTPELWGEANVLMIAGSDTTSTTMSATIFYLVRN
FT                   PRAMELLRKEIRENFSSVEEIVTGPKLNELVYLKACIDEAMRLAPAVPGAPPREVMEGG
FT                   AMIDGVFLPEGTDCGTPTYSIHRQPEYYREPEVYIPERWIEGATCQAGSESWTTSKESV
FT                   ELARRAFCPFSIGPRGCIGKSMAFMEMRLTIARLMFLFDLELADHKGEDEKGQLALVDH
FT                   FTSAKYGPNVVVRKRV"
FT   CDS_pept        join(388721..388816,388877..389428)
FT                   /codon_start=1
FT                   /gene_family="HOG000201616" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263242"
FT                   /orf_name="AFUA_6G02215"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27246.1"
FT                   /db_xref="UniParc:UPI0000F51CD7"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA28"
FT                   /transl_table=1
FT                   /translation="MPSPLTTTLIQSTLLNALSNILAQIIAQHKKDGPFTLNTLALLQF
FT                   LTYAIIIVPINFSWQKYLEARWPGFPGRKGRSTPTAVAGAEAKTGAVVVTVESADLLPV
FT                   KEKVEEKQRVSAARPRPRSRWRWRSRSRLRSRSGLGNFLMKFVLDQTVGSVMNILLFIV
FT                   LINVLKGVGWSRIGELIYEVRLVHFVIGPFHGEKMVIEVMRVGLWADHGCAA"
FT   CDS_pept        join(complement(391366..391677),complement(390488..391298),
FT                   complement(389643..390430))
FT                   /codon_start=1
FT                   /gene_family="HOG000048649" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263243"
FT                   /orf_name="AFUA_6G02220"
FT                   /product="MFS toxin efflux pump, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL85817.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG056348"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FDB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCS1"
FT                   /transl_table=1
FT                   /translation="MENTASGHSPHSPGANSSQTKLTSEPHAPGRRQSSDKESTLVESS
FT                   PGLEYPQSPVPERRSESQAMGMEYSEGHGNEKQEPEHLKSWKLGFVMASISLVIFCMSL
FT                   DNTILATAIPKITDQFNSLDDVGWYGSSYLLTTCSLVLPYGKLYTFYSTKWVYLTAIAI
FT                   FEIGSLICGVAPNSVALIIGRAVAGLGAAGLFTGSILIIAQSVPLQKRPIYTGVLGGMY
FT                   GISSVAGPLMGGAFTDHVTWRWCFYINLPIGGVTWLFVLLFFKAPKSYKDNSGLKDQVS
FT                   RLDLPGLFVFLPAIISMLLALQWGGTKYNWGNARIIALFVVFGVLIVIFAARQHWAQEN
FT                   ATVPPRILKNRNVWGAAFYSFSVSAAFMLFVYYVPSNLVPSHQRRLGDQIWYHEPAHAA
FT                   WNSSDVPRLWVPGFGNRLLHPLHADLFGDHDDRGRSAIDTEGRLRPSCLDRVPGPDWDW
FT                   DWRRTSASNDCGADCGSGHGCPQRNGHRDVHPISRRRAVRFSRAERIPEPTVQKPGHRG
FT                   AECQCCTSRRDWCHYAATRCFRGCATGSPRCLQQRHHRVVLRCCCHGGNFDHRRPSSPV
FT                   ALREGKEDRSTPCLDLIAARGYRLFIASKLIAELMQALAWGRDTCLQGGCLSLSFRWPV
FT                   A"
FT   CDS_pept        join(complement(395285..395467),complement(393918..395216))
FT                   /codon_start=1
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902852"
FT                   /orf_name="AFUA_6G02230"
FT                   /product="Glucokinase GlkA, putative "
FT                   /EC_number="2.7.1.2"
FT                   /function="ATP binding"
FT                   /function="glucokinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="EAL85816.1"
FT                   /db_xref="GO:0004340"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG130961"
FT                   /db_xref="HOGENOM:HBG522186"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniParc:UPI000051ECB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCS2"
FT                   /transl_table=1
FT                   /translation="MSSPLVTEATRIARQFDFSAEQIQSGVKEYIREMCEGLTKEHTTL
FT                   SQIPTYVTSVPNGTEKGLYLAVDLGGTNFRVCSIDLHGDTTFNLTQSKIMIPRELMASG
FT                   TSKDLFLFLARQIEAFLRIHHNEHFEAHLRRRREPNSEEELFDLGFTFSFPVRQLGINK
FT                   GTLIRWTKGFNIPDAVGHDVCALLQNAIDELDLPVRVAALVNDTVGTLMARSYTSPGDT
FT                   STFIGAIFGTGTNGAYVEKLDRITKLQTIEHADYEKSTGEMIINAEWGSFDNHLSVLPN
FT                   TKWDKELDEDSNNPGIQMFEKRVSGMFLGEILRRALLDMHKDEAFGLFKPNQSSKVVTP
FT                   ENSPLYRQWGIDTSFLSLVEADKTDRMEEVKAALKDHLKIENPSDAECQAVKVLVHAIG
FT                   KRAARLSAVPLAAILISTGKLETDDMVDIGVDGSLVEFYPNFEGYIREALREVPEVGAA
FT                   GEKKVRIGISKDGSGVGAALIALVASRNETGSGPK"
FT   CDS_pept        join(complement(401642..401867),complement(401360..401540),
FT                   complement(401226..401332),complement(400818..401167),
FT                   complement(400491..400782),complement(400256..400437))
FT                   /codon_start=1
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750825"
FT                   /orf_name="AFUA_6G02242"
FT                   /product="Serine/threonine-protein kinase, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EBA27245.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000F51CED"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA27"
FT                   /transl_table=1
FT                   /translation="MLPLRWLTSASRRTMFTFAKKSLWQVPPTVEPPIPQQEPVDEERC
FT                   PGYNSASFYPANPGEVLNHNLLYGLPETFQVALKIINSNSADDAQHEKEIESHIAHRNP
FT                   GHRGRVVLRTCLDDVEVTGPEGRHICLVYEPMRFVDRRIPLPIATAYIYFLLAGLDYLH
FT                   SECQVVHSDLKLSNILISFENERILTNFIKQQQKMQYKIDGKGGRIIYRCHNDFGALDG
FT                   RDIKNLIPKIADFGLATRLDKLDSQDGVVGKQLGIYPIQPDFYRAPEVILGCGWDFKAD
FT                   IWNFGVLVNRSFGLALMLTILFGKLWNILGSQELFKQVYDADGKYEARSHLAEMIALLG
FT                   PPPKELLARSKTMSDQNWPQPVLNDSGKLCNNAQEFFGGPFFDAEGEFRHNELIPSRSL
FT                   ENTTPLLEQEEQEAFLSFVRQMLTWLPEERKTARELMDHQFLKLGG"
FT   CDS_pept        join(403252..403521,403623..404132)
FT                   /codon_start=1
FT                   /gene_family="HOG000202371" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750826"
FT                   /orf_name="AFUA_6G02260"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85813.1"
FT                   /db_xref="HOGENOM:HBG056346"
FT                   /db_xref="HOGENOM:HBG738556"
FT                   /db_xref="InterPro:IPR012471"
FT                   /db_xref="UniParc:UPI000051FFE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCS5"
FT                   /transl_table=1
FT                   /translation="MHYNTSLTPIAALLDFIVPGITTTLSLSQYSKGPLPSGQSPRNKS
FT                   KLQQKALRPNQPSKYKSNPLTSQSNSNAPIQFSSNLVDALQTNTETDSSRAKSLELQIQ
FT                   ARVAQELERLREREQQTLAEIEKRLAEAKDSAPAAPSSTPNITYPAGSLNLDAPRIPFA
FT                   GREYESTPAPTVAADQPINRDLSRESVNAEIEQLRAKLEGRRKLVEVDENVERARNEVV
FT                   TCLRLHDRRPLDCWKEVEGFKREVARLEEAFVDRVVG"
FT   CDS_pept        join(complement(406871..407206),complement(404464..406777),
FT                   complement(404264..404355))
FT                   /codon_start=1
FT                   /gene_family="HOG000202360" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263244"
FT                   /orf_name="AFUA_6G02270"
FT                   /product="Ribonuclease P complex subunit Pop1, putative "
FT                   /EC_number="3.1.26.5"
FT                   /function="ribonuclease P activity"
FT                   /biological_process="tRNA 5'-leader removal"
FT                   /protein_id="EAL85812.1"
FT                   /db_xref="GO:0001682"
FT                   /db_xref="GO:0004526"
FT                   /db_xref="HOGENOM:HBG056345"
FT                   /db_xref="HOGENOM:HBG327024"
FT                   /db_xref="InterPro:IPR009723"
FT                   /db_xref="InterPro:IPR012590"
FT                   /db_xref="UniParc:UPI000051F19C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCS6"
FT                   /transl_table=1
FT                   /translation="MASNQPSKRKSAFPGPQPGAAASRKRAKTFDARSLAVQSADAALS
FT                   ASGELNVAAYVEAREFEIRALESGMQRSKSALTSRAFQKVPRALRRRTASHNVKRVPRR
FT                   LRARAKREMIEDNTPTVTARRRRPTEILRLRLETARRLQNLNSKTKAKRAAAKAKRDKE
FT                   TQKALEEAGSHAYNIAPRVPKIKKNKLSRPPPPESKYKKRQRCKTWLPTHMFHAKRAHM
FT                   ATSKDPLWRFAVPLSPTEKSYRPSHRAKGARGAVAWDMSYMSTIQLEGTEEAMEAVLRG
FT                   IGINGQDAWGPKGRKWRAGTRSLHAWAFERDGTQRPIAPITLIRCADGKAEDVEMVDAD
FT                   GPKKKSQKDRKKLFIRVHPSAFLQLWNELLGISKRQNPPVMVEDLRFEIGSIEITGPGS
FT                   TEALLSALKPLVPDGAEPPAGSPEATWTSLLGVSNPSSLPQNAFLGFSVSDPRLHFPPR
FT                   TLKPPASDQEMQNLAILLSTWSPDTTQTSPALFDRRARLTATRQLPRQKAINRRRTLAG
FT                   PGVYPPAEASDPKIPVMILASRSTSQSKNTNAPGTWTVLLPWKCVLPLWYSLMYYPLSS
FT                   GGTVRFGGLKEQRQLAFEAGEPWFPGDFPGTRAGWEWNIREREKAKQEWERRPKGRRTE
FT                   FDSLDLGNGQKGEIGHGWACDWERLVQGPPKISTPEPNEAKEIEQSQDAEQQDTQMSDA
FT                   EQQAVGGHAPPFDIHHLPIAKAEAAINNRSEPTEQAAIATVKISLLHRGSPNPAARIYR
FT                   LPTTNPDLRQEWLRLASDERKSKSRKAPHPQGHLQQSAQPSAAQGDARQKLAASLITPA
FT                   ADTESRKEHLPIPTEEDLIGFVTTGNYNLSEGKGTGIGSILVSKVAASGKGQARERRMC
FT                   IVRNAGERVGRLAFQSEALVFFAYHVQPTFVKTRTYENLEQS"
FT   CDS_pept        join(complement(408429..408478),complement(408055..408331),
FT                   complement(407836..407979),complement(407732..407767))
FT                   /codon_start=1
FT                   /gene_family="HOG000255884" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16263245"
FT                   /gene_name="pmp20"
FT                   /orf_name="AFUA_6G02280"
FT                   /product="Putative peroxiredoxin pmp20 "
FT                   /EC_number="1.11.1.15"
FT                   /function="peroxidase activity"
FT                   /function="peroxiredoxin activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="EAL85811.1"
FT                   /db_xref="EMBL:AAB95638.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0051920"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI0000131C89"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43099"
FT                   /transl_table=1
FT                   /translation="MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWAD
FT                   KKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQV
FT                   TGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAET
FT                   VLKHL"
FT   CDS_pept        complement(410772..411101)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263246"
FT                   /orf_name="AFUA_6G02290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85810.1"
FT                   /db_xref="HOGENOM:HBG056343"
FT                   /db_xref="UniParc:UPI000051F412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCS8"
FT                   /transl_table=1
FT                   /translation="MLFADVYSINVNPINKPAAVTVPVRSKYHVIPAHHSLAHLASFPF
FT                   KRPILEAVAALPAHPIFCVLILVPELHGNTVICESKKLLAESVIMFTLPFAGQERDNRF
FT                   CAREE"
FT   CDS_pept        join(412644..413227,413279..414007,414070..416027,
FT                   416084..416389,416437..416669)
FT                   /codon_start=1
FT                   /gene_family="HOG000202349" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750827"
FT                   /orf_name="AFUA_6G02300"
FT                   /product="Serine/threonine protein kinase (Kcc4), putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85809.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG024051"
FT                   /db_xref="HOGENOM:HBG056342"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020671"
FT                   /db_xref="UniParc:UPI000051EF03"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCS9"
FT                   /transl_table=1
FT                   /translation="MDGITASPQSFRPPLTDATHRLNNCATPKSEKGSHIEAEDLLITP
FT                   DRMYIVTSPLATRENVGENRASPNPNSQAGSKRNSAISTTSNVSGKGKRKTHVGPWQLG
FT                   KTLGEGATGRVRLAKHAVTGQTAAIKIVSKRSAAIAQSESIAAMDRNASLFSGTGTRQM
FT                   PSGIEREVVIMKLIEHPNVISLYDVWENRGELYLVLEYVQGGELFHYVQNHGPLPEEEA
FT                   VRLFRQIIAGLGYCHRFNICHRDLKPENILLDSWRNVKLADFGMAALQPAGHWLNTSCG
FT                   SPHYAAPEIIYGRKYRGDKADIWSCGIILYALLTGYLPFDGGDLPSTLRQVKRGEYTIP
FT                   PELSVEAADLIQRILQKRPEDRITMHGIWMHPLLKKYEQFHQAMSHHYLGPAPPLTAQD
FT                   CGPPVLSRQDIDIDILRNLQTLWHGVKTEALIERVLNPQPTQERMFYNALIKFRNEQLE
FT                   NYQGQPLEYSASDYHHISRLPASSANRRKHARVQGGSRRQGQNSTTTTTTATTTSNSSS
FT                   KQPQSKSRALKSSATEKSYDPFRSPRHIVATPEVQCAQVTIHRNGPEANTKEMSEAVPD
FT                   LDDDMKEEEVEDIDCLPSSPFSIVPNKKSKASFTRSFQSRASHSSARRVMNTTPTPRSA
FT                   SYKRNVLFLHHQNRSQASMSARPRKARANASSISRQESDCSIKSDEDGVLSSDRCGSPL
FT                   LPVQPLIVRGAGVTIKNCPQVKRVCDADIIWRDEARKVSHELSQICEEAFNGGSLSTGC
FT                   TTSIGSETPATSLSMVSAGDSQNQITGSNIKSNQPSNRARDSPNTYTATELTETRRKLI
FT                   QHSTQDGTESVPGYLSAVINHLDRLIAQDRIKERGKRDKSKENGNSTYDSLQRSSLDTG
FT                   NLPIISEERSNSLAESEMRNGQDVTRHNSDSASSIQTKRQSGDGKATIRMVPQSSQQCL
FT                   EEIKPLNIRKKRQASNESPQPREDTRSKDETGRPIRSSQRYASADSRQTRFLSELDPIQ
FT                   EVPKLTGMSDTKTPENKKWSWFRNRSHGSSEPKTKTPTLKPIHPSSATVIVREIDPSFE
FT                   SGPGEQTEKSQDAKGITDNKKGGFFKKFMKKKHSDNVNKGATEVDFADTNPLLKRPAET
FT                   EHAFDTDKNQKPAPARPSINGKSHNWFARVFQIKPATRVVALNTSKLKGRKDVLKLLRE
FT                   WKQFGMEEAYLDKANGVIRAKVGEVNCLRLRAVDFSAEFYTVLEHGRQANLSLVRFRQE
FT                   RGAASSFHKVVDTLEMVLKQRGLLVEDPDRAKNMARILDAFPNG"
FT   rRNA            complement(418039..418154)
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(complement(421463..421594),complement(421014..421292),
FT                   complement(420602..420925),complement(420126..420530))
FT                   /codon_start=1
FT                   /gene_family="HOG000202338" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263247"
FT                   /orf_name="AFUA_6G02330"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27244.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG325072"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51CDE"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA26"
FT                   /transl_table=1
FT                   /translation="MSTNPHEFGDPNRQGQYPPPPQWNSSQPEDNPAPANYPPASQYPY
FT                   PPASYPPPTTDHPYPHPPPPPSQYPPTSHMATIHPHVQGAQDPYRLPPPPGAYRPPDVY
FT                   AQPAPPPQPQVVYQAAAPRQRTAIACRYCRRRKIRCSGFESSQDGRCSNCIRFNQECMF
FT                   TPVSSQAQAFVPAHAAYPHLRNPQNGRAGPPVMLYGAHGQPLPPQQQPQPPADTTLPPP
FT                   QGMYQHPYRTAPPPLASAVPADHRPTGRRGSGSGFEYPDPTNLAPVTPATSAPAYQAHP
FT                   APSPYYPPPPQHDRRPSPQSAYPYDSRHSSSPHSSPYPPLHTATSTMTPPPTSTPGGSV
FT                   SSSRGGLNVRDMLNPGDNQGRSSTDSDMLNALNRRGLNQ"
FT   CDS_pept        join(complement(435726..436362),complement(435545..435660),
FT                   complement(435379..435432),complement(435142..435193),
FT                   complement(434677..434879),complement(434042..434095),
FT                   complement(433649..433963))
FT                   /codon_start=1
FT                   /gene_family="HOG000202327" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263248"
FT                   /orf_name="AFUA_6G02340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85805.1"
FT                   /db_xref="HOGENOM:HBG056338"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="UniParc:UPI000051F410"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT3"
FT                   /transl_table=1
FT                   /translation="MPRRSSRAVPAPAAAPAPIPKRRASDRTFAASETDLKRQKHNSTT
FT                   AKKVVRSTARKSKYFEDEGNEESDPESSHASEVGEDSDPAYEDKNLSYPSTESDSEEPE
FT                   VLSTGEERTKRSTRKTANPSGGRKIPARRGGGNEAEEHPNEDIAASLKDKELWREGVST
FT                   GLGPGKEVFIRKPKARDPGDIPYQDHTLHPNTMLFLQDLAKHNDRQWLKAHDADYRASK
FT                   KDWETFVESLTEKIAEVDNTIPELPAKDIVFRIHRDIRFSKDPTPYKKRPLCRLLCASA
FT                   ARILLCSGLWQPEADKLALLREDIDHNSHRLKAVLQRPDMRREFFNGIPDDEKKAVQAF
FT                   VSQNKESALKTKPKSFLRRLICFHGSASDYWRGYEADNENIELLRLRSFTIGKPLSDSE
FT                   FMASNVQERITALIGVMEPFVSHASHPCCAASLGFLPPVHVSTYWILPSRIRYMALPCL
FT                   VHVTLFLMRFPAIQWYSL"
FT   CDS_pept        join(437032..437356,437405..437517,437701..437868,
FT                   437920..438246)
FT                   /codon_start=1
FT                   /gene_family="HOG000202316" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056121"
FT                   /orf_name="AFUA_6G02350"
FT                   /product="DUF207 domain protein"
FT                   /protein_id="EAL85804.1"
FT                   /db_xref="HOGENOM:HBG247204"
FT                   /db_xref="HOGENOM:HBG327010"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="UniParc:UPI000051F417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT4"
FT                   /transl_table=1
FT                   /translation="MSNPEVCTIPEVFESRKRKILADLSVPDTEYTDLSPKGSVDEGIR
FT                   DLIRDINALPGLVTTSSCSGRISVFLEGRKKQNDHQQDQRQFAPSGGKGAGKWLYVSHD
FT                   PLNGHCPRSLHELFGMVPGNGKPPGLKGGHAPRLVRFHYDPMILHIMAATLHHAHPVLS
FT                   AAATSGFRESGLQSLRCLEGENGPSPIVAVRSAGLSLESEPVIRSLVTEEYLQMLVAIS
FT                   NERFLVNAERKERFRTNLLKLCSTEQLCGPKTRSKAKHEGWEDPAARRERKRTEGLMRK
FT                   KFLETQTKSADHSSTGTYEMGWGSGPMPL"
FT   CDS_pept        join(complement(440400..440939),complement(439897..440313),
FT                   complement(439764..439826),complement(439374..439682),
FT                   complement(438741..439286))
FT                   /codon_start=1
FT                   /gene_family="HOG000202305" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902853"
FT                   /orf_name="AFUA_6G02360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85803.1"
FT                   /db_xref="HOGENOM:HBG056337"
FT                   /db_xref="HOGENOM:HBG327009"
FT                   /db_xref="UniParc:UPI000051FFDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT5"
FT                   /transl_table=1
FT                   /translation="MEGKETNGQASGHESGYAFTSPYPQSYNMLPFGAPGMPGFAPRQG
FT                   QYMMAPGNPNPSQPLQRGGPFMYSPFYGMQSMAHALPGVIGQAHGMHSPMPASNTKLQL
FT                   SVRPKQTGFTPTGSHWAPRSSLHQLLEHDSASRDIATQAVDCEKSFDTVALPAEMPIGS
FT                   QVHNRMPSQWGVVKIANIPYSVTRQEIIQFLGRQARLITPQQGCAIHIIMERSTAKTMD
FT                   CYAEFQSANDAQETATRINRIYETGRAPRLGNRSVDVEFSNQDALLKDLFPRAKCIIWK
FT                   DAMPTAVPNDDPFSTGFSGFFTSEEIVNAIRHAEIPHRSPFCAKCPQRTYESTISTLYK
FT                   FPWYATKLYTVHDRNQLFELVSRHILSLVARVKRSNTVGLDQRLLRELLYAGLNCPAFN
FT                   ERQKYTLCVNSEDTTEILKFPDMGKWFPFDTLVKLPKSEESTLLYYVKLISKGTLHDRT
FT                   DMKLPNNFPLTNIHLESPYGPIWFEWPSNIAKTMTWEDASLHEMSILSHLVLTGWMKND
FT                   QENTKKSGLLPDSTTGSSRESHANTIVSSGSDNSPIDVRTPSRTDNLATPSRRASVQLG
FT                   SRSSFAESSDDSWRRAIYMHSSAGMRGRFPGHRNTQSSPTCLPSAGNP"
FT   CDS_pept        join(complement(442663..442665),complement(442284..442610),
FT                   complement(442109..442234),complement(442007..442051),
FT                   complement(441939..441947))
FT                   /codon_start=1
FT                   /gene_family="HOG000202303" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750828"
FT                   /orf_name="AFUA_6G02370"
FT                   /product="ARP2/3 complex 20 kDa subunit (P20-ARC), putative"
FT                   /biological_process="actin filament polymerization "
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="EAL85802.1"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030041"
FT                   /db_xref="HOGENOM:HBG026656"
FT                   /db_xref="HOGENOM:HBG314395"
FT                   /db_xref="InterPro:IPR008384"
FT                   /db_xref="UniParc:UPI000051E834"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT6"
FT                   /transl_table=1
FT                   /translation="MSQSLRPYLQCVRSSLTAALAISNFASQTSERHNVPEIEAQSSPE
FT                   LLLNPLTISRNENEKVLIEPSVNSVRVSIRIKQADEIEHILVHKFTRFLTQRAESFFIL
FT                   RRKPVKGYDISFLITNFHTEAMLKHKLVDFIIQFMEEVDKEISEMKLFLNARARFVAES
FT                   FLTPFD"
FT   CDS_pept        join(443140..444793,444856..444917)
FT                   /codon_start=1
FT                   /gene_family="HOG000202292" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207414"
FT                   /orf_name="AFUA_6G02380"
FT                   /product="Ubiquitin C-terminal hydrolase, putative "
FT                   /EC_number="3.1.2.15"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="EAL85801.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG027359"
FT                   /db_xref="HOGENOM:HBG524155"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000051E826"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT7"
FT                   /transl_table=1
FT                   /translation="MFSVIVKHQGKRHEVELDPSANGETLKYQMYSLTGVEPERQKILV
FT                   KGGQLKDETPLSALNAKPGQTFMMMGTPSGGQDAVDLGRPKEPVKFLEDMTEAEAARAE
FT                   GAIPAGLQNLGNTCYLNSTLQTLRSVPELQQELLNYKPSAGSSAGSRLSDLSSLGLGGL
FT                   GASMDLVSSLRDLFKQMSETQEGFPPLMFLNALRSVFPQFAQKDRNGHGYAQQDAEEAW
FT                   SQIVTQLRSKLVIKEGEGDSATEVSFVDKFLAGRFESVTECDDPAAKAAGEEATKSSDI
FT                   FFKLDCHIGKETNHLHDGILAGLEEKIEKRSPTLDRDAVYTKRSRIARLPKYLTVHFVR
FT                   FFWKRETQKKAKIMRKVTFPAELDVVEFCTEELKKQLIPIRDKVRDIRKEEVDVERARK
FT                   RQKLAHQREEELKRAAESDAGLEPLQKKKATEGQKEATKSGEQDGDTAMTDVFKSDAEY
FT                   EAEKYASILAAKKELAALIDPKLASDAGTNNSGLYELRAVITHQGASADSGHYTSYVKK
FT                   QPNGKGVEDGKWWWFNDEKVTEVDGEKIETLAGGGESHSALILLYRAVDLPTAE"
FT   CDS_pept        join(445384..445812,446001..446378)
FT                   /codon_start=1
FT                   /gene_family="HOG000202271" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263249"
FT                   /orf_name="AFUA_6G02390"
FT                   /product="Thioesterase family protein "
FT                   /protein_id="EAL85800.1"
FT                   /db_xref="HOGENOM:HBG056335"
FT                   /db_xref="HOGENOM:HBG327007"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI00005206C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT8"
FT                   /transl_table=1
FT                   /translation="MLGPRRIFQSRPRCNATQLKSVHLSKPRLSRHTSTIAPAEPPTTK
FT                   SRWPRRLAYAGIFGGLGVAAGKWMDEKVSAPAVPGTVEDAAKLEEINHVFEHGLPIVQE
FT                   LRNNPDYLETNAYEGFSEEDKAHRLTSGPLRGSRGLALQRVFYNDKEKKVICVVYLGSG
FT                   LEGWPTVVHGGVLATVLDENLGRAAIRHFPARTGVTANLEINYRAPVYSGNFYTFHSQV
FT                   DPERSTERKAFVTGEIRDPVGRVCAQASAIFVVPKGFKLRKIGERF"
FT   CDS_pept        join(447462..447617,447658..447766,447827..447885,
FT                   447944..448100,448160..448539,448609..448981,
FT                   449051..449181,449222..449656)
FT                   /codon_start=1
FT                   /gene_family="HOG000202260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207415"
FT                   /orf_name="AFUA_6G02400"
FT                   /product="MFS drug efflux pump, putative "
FT                   /protein_id="EAL85799.1"
FT                   /db_xref="HOGENOM:HBG056334"
FT                   /db_xref="HOGENOM:HBG327006"
FT                   /db_xref="InterPro:IPR010573"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FDB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT9"
FT                   /transl_table=1
FT                   /translation="MEVADHSGQSQVDEKAAGQTSMANNQEHKYSHEEIVGLESGGSDT
FT                   AEGQDIPLIELTAGSIQLTFRRFMGFTAMAFLWTGSQIPVYLFGGIPPYIYADIGGADR
FT                   WIWFVLANLLALAGVCPFVGSLSDLIGRRYVAIIGASLICLGMIVTSTAHTMNIFIAGM
FT                   AIAGAGAGVNELTALAATSEMAPTSQRGKYVAILIFTIVPFCPSVLWAQLIAAHSGWRY
FT                   VGAFCGAWGGFGLLATVFFYFPPPRVNSQGLSRKEVIRRIDFVGGLLSITGLILFLAGM
FT                   QWGGYQYPWTTAHVLAPLILGFVILVAFAAWEIYGAKYPIFPTRLKQEPRTLGLTLVIT
FT                   FISGANFFSVIMFWPTQSFNVYGHDPVQVGLRSLPVGFGIMAGACIVLWLLSVLRGHNK
FT                   ELLIISSVLMTAGCGAMAVARQDNLYQLWGILVLAGLGIGGIVVPASIITTIICPDANR
FT                   LVHQDLIATISALTLSIRVVGGSIGYTIYYNIFISKFVPNAKHFIGGVMGTKLNITNPA
FT                   YIGEAIELTGASLLEELKTIPGIAGSEAAYNAVVAAGQLAYAESYKWVYYVSIAFGGIS
FT                   ILAACFLGSISQYMDDHVAVVMH"
FT   CDS_pept        complement(449987..454315)
FT                   /codon_start=1
FT                   /gene_family="HOG000202249" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263250"
FT                   /orf_name="AFUA_6G02410"
FT                   /product="WD repeat protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL85798.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056333"
FT                   /db_xref="HOGENOM:HBG326969"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000051FFD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU0"
FT                   /transl_table=1
FT                   /translation="MMEPRPLASAFESPTFGEDSSFHVEQPVGSMSISPCGRDVVLASK
FT                   EGLHVIDLDSPYSPPRYLPHHTPWEVADVQWSPFAARDYWVVSTSNQKALVWNLAMQTG
FT                   ENSIEHVLHAHTRAITDINFSAHHPDLLATCAVDSFVHCWDLRTPSKPAISFSDWFAGA
FT                   TQVKWNRQDPNVIASSHDKFLRIWDTRMGAYPIKSIEAHDTKIYGVDWNRVRPGALVTC
FT                   SLDKTIKFWDYTVDDEVPEKVITTPFPVWRARNTPFGWGVLAMPQRGNSDLHLYSRRSS
FT                   DGTNLTENLPLVHSFPGHKGQVKEFLWRARGGVADGIDYREFQLVSWGTDKELRLHRVD
FT                   PDILQRVGYERGKSFVSKLNVTRQGAVYKTFRDANGDDGYGEHDSILSPNPKLAGGTGI
FT                   NTISVPYSRPWTQGGNEDSRVGMQRRSNFRADTNPISWMRGVKISGWDIETLGDEITHV
FT                   GEKFTKVAFESVDIRQRKATISLHGPWGPEGDSLFLKVDIKFPSDYPKTSMPTFGVQRT
FT                   AAVTDQLADKLISELRTIAETYLSHKRGCLEGVVRYLLGESTIEESIAHILGETAETIK
FT                   SPINGDLGDDESSDEDEVGMSQSQELGMSSELLRPVNNANVMVPVAKACGALWANDGRL
FT                   VCFFPSKKEKSSNLIENLGLKEMSRLSRADKVFEGFGRIQTSSPGPKINGTLASTDDGT
FT                   SEYSDDSDAETSSSSGSSDMLSGLQARFPTSQTWRSAGSLGIYRPRSTDHSQRSTAGAL
FT                   TAKSSDSAQNIISIHDFSDLLPAKRELARRYRICGKVTDVCAHNASAALDLGYHELARI
FT                   WGLVKLILQHQNDSLSSTRSEMMQRPSGIQRKDSAVDLSFDQSNQEQSRKESANSANQW
FT                   GDHPYGGRWLIPSLIDHFERIGDVQMIAMLSCVLQQPKSEEISKEATRNRDPVSSGMGH
FT                   QSFPMDIFPTQAATQNKSQAVTPLASTPKEGHPTPITQSSGRSSSEFWRADSTPPYSTG
FT                   TTPPLASRVGALNAERKTMSHNISIAASPDQQSQPRSGSGFGSALASSFSRSFTFGPSS
FT                   ASPTAVPSGQKKQSPSGSMITSAFAGKPATAVPDYLAPSAALTSQTHSDIESERPQENP
FT                   KPQAKFKVVLKNQDEFDGGRSNQTPMLDPRKEGLYKAYRVAYAHLLSIWGFPVQHSEVL
FT                   KIGTAGGQSDELRSRKRSHNNIDAPLIVSSRSHKDDRLIDVDREGQGLGLQRHCIKCGQ
FT                   ALQMSIFAPTAVEENGRNHLNTGPVTVTCQHCKPHRPLFLKLPCVICGEVVEGMLVPCL
FT                   RCGHVTCFDCHRRWFSVSTYVTQRDKNCIPASGIDEEQEVQFCPSGCGCHCSEHIGTDI
FT                   PTPLEPSTPAHGRDASPTSTRLKRSELPARPSELSSSVDPHDDDLLGPWRESPFASLAR
FT                   GLGGGLSRGLRAKEDRRRLRPSSTAFIPKKSSMNQVEKVT"
FT   CDS_pept        join(455227..455279,455344..455432,455491..455622,
FT                   455674..455849)
FT                   /codon_start=1
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263251"
FT                   /orf_name="AFUA_6G02420"
FT                   /product="Ubiquitin conjugating enzyme (UbcM), putative "
FT                   /EC_number="6.3.2.19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="EAL85797.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000051FB5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU1"
FT                   /transl_table=1
FT                   /translation="MALPKRIVKETERLMAEPVPGINAVPHEDNLRYFDVSIHGPAQSP
FT                   YEGGIFRLELFLPEDYPMTPPKIRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTIL
FT                   LSIQALLGAPNPDDPLANDVAQRWKEDEQAAIQTAKEWTRTHAMT"
FT   CDS_pept        join(456861..457671,457734..457865,457905..457951,
FT                   458016..458399,458475..458522)
FT                   /codon_start=1
FT                   /gene_family="HOG000217791" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207416"
FT                   /orf_name="AFUA_6G02430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85796.2"
FT                   /db_xref="HOGENOM:HBG056332"
FT                   /db_xref="UniParc:UPI0000F51CD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU2"
FT                   /transl_table=1
FT                   /translation="MSPDPHAADRKAQKQREKKMNAERLKYQKQQSEYFPLTDSFIVPK
FT                   SRVARALDTCVRYLQTTYCVVSFPTHHFVVSGIKNSGKQLKLRSRSFESESRFSSCDVT
FT                   HPASDLPTVPNLKDLPEKVRKRPERSSQVVNKASISLSLLCCPRNCGSVKLTVKQKDPA
FT                   RTSPKESSFTRKFSRTMTGDSVKKVSSMDRKSWQTQSSSAGSGGKTRSIRSASVTATGT
FT                   DLGEGDAATRLEGGLKKLTISEGLKREGKPAAISTAQPKVIKCLRSPGDYVFIDIETPG
FT                   EKSNANSNSSPGISPKAKSAEVGSGEDESGEHEAEAANDQDPRSIVEKRLEVIRHIVKN
FT                   IFQGQSDEDTKTGKALQNAKKWDTKNTKCIKCFGDCPVCSKACCIFDVARRTAAQADST
FT                   PEHAEAANQILKLIQRLGNSVLEATTYSLCTTPGGCGRYVCSDCWGICPVELCHDVQCK
FT                   DCKEDPWAACDWHDY"
FT   CDS_pept        join(459025..459075,459220..459363,459570..459857)
FT                   /codon_start=1
FT                   /gene_family="HOG000184343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207417"
FT                   /orf_name="AFUA_6G02440"
FT                   /product="60S ribosomal protein L24a "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85795.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG232163"
FT                   /db_xref="HOGENOM:HBG600564"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="UniParc:UPI0000520222"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU3"
FT                   /transl_table=1
FT                   /translation="MRTYDDSFSGQKIYPGKGKLYVRGDSKIFRFQNGKSESLFLQRKN
FT                   PRRIAWTVLYRRQHKKGISEEVAKKRTRRVVKHQRAIVGASLDVIKERRSMRPEARAAA
FT                   RQQAIKEAKEKKAASESRKKAEKAKNAATAAKGTAQRIQSKQGAKGSAPKVAAKSR"
FT   CDS_pept        join(460900..460959,461190..461294,461456..461479)
FT                   /codon_start=1
FT                   /gene_family="HOG000202227" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902854"
FT                   /orf_name="AFUA_6G02450"
FT                   /product="Ribosomal S30/ubiquitin fusion "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85794.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG056331"
FT                   /db_xref="HOGENOM:HBG744125"
FT                   /db_xref="InterPro:IPR006846"
FT                   /db_xref="UniParc:UPI00005206D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU4"
FT                   /transl_table=1
FT                   /translation="MGKVHGSLARAGKVKSATPKVEKQEKKKEPKGRALKRLKYTRRFV
FT                   NVTITGGKRKMNPNPTS"
FT   CDS_pept        join(complement(462632..463114),complement(462471..462560))
FT                   /codon_start=1
FT                   /gene_family="HOG000106325" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI20750829"
FT                   /orf_name="AFUA_6G02460"
FT                   /product="Glucosamine 6-phosphate acetyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.4"
FT                   /function="glucosamine 6-phosphate N-acetyltransferase
FT                   activity"
FT                   /protein_id="EAL85793.1"
FT                   /db_xref="GO:0004343"
FT                   /db_xref="HOGENOM:HBG341300"
FT                   /db_xref="HOGENOM:HBG736206"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:2VEZ"
FT                   /db_xref="PDB:2VXK"
FT                   /db_xref="UniParc:UPI000051FB55"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU5"
FT                   /transl_table=1
FT                   /translation="MTNATIAPTTTAAPVTKSVDAPTADENTPLFSPSLISPDVLAVLP
FT                   ADYTIRPLCRSDYKRGYLDVLRVLTTVGDINEEQWNSRYEWIRARSDEYYLLVVCDGEG
FT                   RIVGTGSLVVERKFIHSLGMVGHIEDIAVEKGQQGKKLGLRIIQALDYVAEKVGCYKTI
FT                   LDCSEANEGFYIKCGFKRAGLEMAHYY"
FT   CDS_pept        join(complement(466480..466824),complement(466389..466433),
FT                   complement(466294..466331),complement(466089..466204),
FT                   complement(465010..466027),complement(464770..464956))
FT                   /codon_start=1
FT                   /gene_family="HOG000061736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207418"
FT                   /orf_name="AFUA_6G02470"
FT                   /product="Fumarate hydratase, putative "
FT                   /EC_number="4.2.1.2"
FT                   /function="fumarate hydratase activity"
FT                   /biological_process="fumarate metabolic process "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="tricarboxylic acid cycle enzyme
FT                   complex"
FT                   /protein_id="EAL85792.1"
FT                   /db_xref="GO:0004333"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006106"
FT                   /db_xref="GO:0045239"
FT                   /db_xref="HOGENOM:HBG000141"
FT                   /db_xref="HOGENOM:HBG284369"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniParc:UPI000051E833"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU6"
FT                   /transl_table=1
FT                   /translation="MLTSSTNSSRAAVRSMASLTHAATRTTSLNAPAAARNALAFAARS
FT                   PASFSSRRALSFNTRSLVQYPRLQSIQSISNKRTFGTTVRMVSVRPSPDGRKAGLTDLR
FT                   YPLCSQDFVIAASATRTESDAFGEIQVPADKYWGAQTQRSLTNFDINQPQDRMPAPVIK
FT                   AFGILKAAAAEVNMRYGLDPKIGEAIKQAATEVAEGKLMDHFPLVVWQTGSGTQSNMNA
FT                   NEVISNRAIEILGGTMGTKKPVHPNDHVNMSASSNDSFPTAMHIAAVLELENTLLPSLR
FT                   SLRNALQKKVEKFDKIIKIGRTHLQDATPLTLGQEFSGYVAQLDRNIERVEASLPHLRY
FT                   LAQGGTAVGTGLNTFKGFAEGIAEEVTKLTGTEFKTAPNKFEVLAAHDSIVEASGSLNT
FT                   LACSLFKIAQDIRYLGSGPRCGLGELILPENEPGSSIMPGKVNPTQCESLTMICSQVMG
FT                   NHVAATVGGMNGQFELNVFKPLMIRNLLHSVRILSDGMKSFEKHLVEGLEANEPRINTL
FT                   LHESLMLVTCLNPVIGYDMASKVAKNAHKKGITLKESAMELKALSEEEFDKHVRPELML
FT                   SPKEKK"
FT   CDS_pept        join(complement(467909..468508),complement(467581..467898),
FT                   complement(467269..467526))
FT                   /codon_start=1
FT                   /gene_family="HOG000152322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263252"
FT                   /orf_name="AFUA_6G02480"
FT                   /product="Esterase, putative"
FT                   /protein_id="EAL85791.1"
FT                   /db_xref="HOGENOM:HBG056330"
FT                   /db_xref="HOGENOM:HBG757640"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI00005206C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU7"
FT                   /transl_table=1
FT                   /translation="MIDSSTAGIEELHALRPKTIHQPLHNAIPPELVPRFDPVYVEYYN
FT                   KYNAGRLHTHEVPIEDFRRNPAKYTIAYGRAAGPDVFRITEQKCPVKDGEITVRIFEPA
FT                   PVSDDQGNLKKRAAYVNFHGGGWVFGDLSVDHDFCKRLVHGLDGHLVAFDVNYRLAPEY
FT                   KYPIPVEDCWAAFNWVSDLVINSFTVQLSKSETKGLTIRLKKADEFNIDPDRMAIGGVS
FT                   AGGQLSAVLAHLCRDGNIPLRLQLLTVPACDLHSVFTSDGQFDRENCPYESYREMEFTP
FT                   ALPAARMAYFHRHFLGNPRPPRSEEDWKISPMLAPNFENLAPALVHTAEMDPLRDEGEV
FT                   YAAKLKDAGVRVELIRAVGAPHIFPLLDGILESGRVYNEKVIATLRKELLV"
FT   CDS_pept        join(469439..470509,470588..470693,470753..470814)
FT                   /codon_start=1
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263253"
FT                   /orf_name="AFUA_6G02490"
FT                   /product="Aspartate transaminase, putative "
FT                   /EC_number="2.6.1.1"
FT                   /function="L-aspartate:2-oxoglutarate aminotransferase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="EAL85790.1"
FT                   /db_xref="GO:0004069"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG122224"
FT                   /db_xref="HOGENOM:HBG446828"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051F666"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU8"
FT                   /transl_table=1
FT                   /translation="MSVLSTLAPVPPDEIFALNRAYATDPFPQKVSLGVGVYRTDDGKP
FT                   WPLPCVREAEKQLLAEDSLTRHEYTAIEGDIPFLELARDIMFGFDGKNAAEKHKSRIGS
FT                   VQTVAGTGANHLGALFLATHMKPGKVWLSNPSWANHMTIWELAGVPRKTYPYYNPTTRS
FT                   FDFDGMMATLEAEAQQGDVILLHACAHNPTGLDPNKEQWKAIADLCERKKIFPFFDSAY
FT                   QGFASGSLEEDAWAVRYFLNEKPGMEMCVAQSFSKNFGLYGQRVGAFHYVLPQGSESLR
FT                   DTVVVNLCHLIRGEYSMGPTAGCNLVKKVLTNEELTAQWHKDLKVMSSRIRSMRKALYD
FT                   ELLRLQTPGSWRHIVEQNGMFSYTGLTPAQVHSLKDKYHIYLLKSGRASISGLSEKNVA
FT                   YVAQAIDDVVRNV"
FT   CDS_pept        join(complement(472710..472781),complement(471318..472619))
FT                   /codon_start=1
FT                   /gene_family="HOG000202216" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056122"
FT                   /orf_name="AFUA_6G02510"
FT                   /product="Chitin biosynthesis protein (Chs5), putative "
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85789.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG252834"
FT                   /db_xref="HOGENOM:HBG326972"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008957"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniParc:UPI000051F8C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU9"
FT                   /transl_table=1
FT                   /translation="MLVSLTVGKVDAGVAVLLTQDNRLDSTLLVRTVGRFTAANLGNLQ
FT                   IEFPSVLLPNSITSGSIVDITVSRNHAAEAASTSAFQALQKRILNTYGVKTPAPPVLRL
FT                   RNATQTSLVLEWDPIDLATASLKSLSLYRNGSKAGSIPRPLETRSTKISGLAIDTEYSF
FT                   HLVLRTTAGTYQSEKLTCRTHKMTDLSGITVTPGVLPEQQKEALAAALERIGGKMIDTV
FT                   RIDTTHFVCTEGRGPLWEKAVEMNIPVVVPEWVDACEAEGTIVGVRGYYLNADPKARQL
FT                   GPIHASTHQHTRSSVSMATNAPSQSQSQSQSQPQSQSQSRLSLQPQPTHQRELSVGDPP
FT                   VTPFPGADMSGQPRADEREVSSDEEDLPPPPPPKDDAAGAEPAVNGKPESTSPEGVVSS
FT                   GDKEERSESDEKHDEKDEDETAHEQAEEKQEQEEPTSNDSDAKGKGKEGEGDFSEISL"
FT   CDS_pept        complement(473217..473759)
FT                   /codon_start=1
FT                   /gene_family="HOG000202205" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902855"
FT                   /orf_name="AFUA_6G02515"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27243.1"
FT                   /db_xref="HOGENOM:HBG325070"
FT                   /db_xref="UniParc:UPI0000F51CE7"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA25"
FT                   /transl_table=1
FT                   /translation="MMTGQTVQRKLVKSTSQFYMRYNPKAVLPPVASRYILSETHPIRP
FT                   KIQHLYANRDPSTLWWRVNPQPLQSFKRVVRSWATRRARLAFRQALAAQGFDAEGRRLV
FT                   SEASGSMATRSPKEGLQGSLEIAVLPQSVKAGYDTIRKEMDYLLRTLLRHLRDGKKQTN
FT                   TFRKQGEDHKRIPTNTS"
FT   CDS_pept        join(474302..474322,474357..474440,474530..474958)
FT                   /codon_start=1
FT                   /gene_family="HOG000223675" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263254"
FT                   /orf_name="AFUA_6G02520"
FT                   /product="Eukaryotic translation initiation factor eIF-1A
FT                   subunit, putative"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="EAL85788.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG411380"
FT                   /db_xref="HOGENOM:HBG521228"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniParc:UPI0000520456"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV0"
FT                   /transl_table=1
FT                   /translation="MPKNKGKRVPRLRKFFTAISSYQPVWLRCANAAITGGKNRRRGKN
FT                   ENDNEKRELVFKEEGQEYAQVVKMLGNGRLEAMCFDGEKRLAHIRGKLRKKVWINQGDI
FT                   ILLSLRDYQDEKGDVIMKYTADEARSLKAYGELPEHAKINETDTYGHEGFEDNVEFDED
FT                   RESEDEKEIDVDEL"
FT   CDS_pept        join(complement(478878..478925),complement(478587..478807),
FT                   complement(478477..478521),complement(478356..478426),
FT                   complement(478252..478303),complement(477722..478198),
FT                   complement(476571..477657),complement(475589..476515))
FT                   /codon_start=1
FT                   /gene_family="HOG000202204" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263255"
FT                   /orf_name="AFUA_6G02530"
FT                   /product="DNA repair protein RAD1, putative "
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="EAL85787.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG113141"
FT                   /db_xref="HOGENOM:HBG396488"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR006167"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR020819"
FT                   /db_xref="UniParc:UPI000051F194"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV1"
FT                   /transl_table=1
FT                   /translation="MPPERANVPVKLSLPLQYQQDIFNELRGEDELVILARGLGLLRLV
FT                   TNLLHFYDAAGNNLVLVVGADDRENEWIGEGTEYAGFDTLQVSQKGLKVINTERATVPM
FT                   REKIYAQGGILSVTSRILVVDLLSKLLDPEKITGMVVLHADRIVATSTEAFIIRIYRQI
FT                   NKSGFLKAFSDSPEPFTTGFAPLANYMRNLFLRKTSLWPRFHVTVAESLEGHRKAEVIE
FT                   LEVPMTDKMREIQNAVLECVEISIAELKKANTGLDMADWTLDSALHRSFDIAIRRQLDP
FT                   MWHRVSFRTRQIVSDLSDLRAILHALLTYDAVSFVKYLDTIVTAHSPPPGSTRHNYSPW
FT                   LFLDAAHVLFQTAKSRVYEGKITRDAANTLDSTLQPVLEEQPKWAVLAEVLEEIEQDAY
FT                   LNPVSTDGSNSTVLIMCTDQRTCRQIREYLGTMHARIGKDKAEDPGDLDAMSEKKFSAE
FT                   VMLRRRLREYLDWKTSLANVNRNLSAKSGDDTQNAKGQESPKPTSQQGRAPPNKRRRVR
FT                   GGGTVTSAAARVPNASVQTDTELPGQVSSLLEELQPTDIEETQKGEIISDDLEDMEDFF
FT                   ELYDMDDLVIVHPYDGDMDEHILEEVRPRYIIMYEPDAAFIRRVEVYRSSHVGRNVRVY
FT                   FIYYGGSVEEQRYLSAVRREKDSFTKLIKEKGSMAVTLTHDKSQEDPQEQFLRTVNTRI
FT                   AGGGRLAATASPPRVVVDVREFRSALPSLLHGNNMIIVPCQLTVGDYILTPDICVERKS
FT                   VRDLITSLRNGRLYNQAETMLQHYKNPLLLIEFDQNKSFTFDAFASASTPGTSFLTDYG
FT                   FSSSGTGTTSLSVSSSLMNPSSPKSAQHLLVLLTLTFPRLKIIWSSSPYQTAEIFADLK
FT                   KNNPEPDPLRAVQIGLDMDIVTSSHPGDVMAAAGIEHRTFNALPQDMLRAVPGVTPKVL
FT                   ERLILETGNISEIANMDVEQLDPLIGREAARKIVGFFRKNLFDNS"
FT   CDS_pept        join(complement(479950..480097),complement(479835..479896))
FT                   /codon_start=1
FT                   /gene_family="HOG000202183" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263256"
FT                   /orf_name="AFUA_6G02535"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27242.1"
FT                   /db_xref="HOGENOM:HBG325069"
FT                   /db_xref="UniParc:UPI0000F51CCE"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA24"
FT                   /transl_table=1
FT                   /translation="MPVIPSDTSNFPTAQGSNNPEDNSSKGSEREQKKATAFDHISKGP
FT                   QIPDSMPPKASRDEIEQRKKELNQ"
FT   CDS_pept        join(481139..481348,481426..483115,483172..483203)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750830"
FT                   /orf_name="AFUA_6G02540"
FT                   /product="Actin associated protein Wsp1, putative "
FT                   /protein_id="EAL85786.1"
FT                   /db_xref="HOGENOM:HBG056329"
FT                   /db_xref="InterPro:IPR000697"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000051E825"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV2"
FT                   /transl_table=1
FT                   /translation="MPSILSDADKETVKRNVSKPSNKILAVAVARLYVAYPDPQRWTYT
FT                   GLQGAAVLANDLVGRTFWLKLVDVSPAGRGVIWDQEIYDNFAYNQDRTFFHTFELEDCA
FT                   AGFSFADEKEAKTFIKKMHEREKHASKETRQTPFASTRGQGPAPMANGKPGVGRSLFGS
FT                   LLGHRSPSGSSVPPPAPAPAAPSAPPTQSALPSGPSRKELPFDTSDPSWKGLLDELLQM
FT                   GITEDQIAENSDFIKAYIEQRQGSEAEPTASPSEDQRRGKAPPPPPPSAPPALKTTPIS
FT                   PQNTGNSGGSRRGAPPPPPPSRKARPEAEEEPAPAPAREPSPPRPRFRAPPPIADAGKL
FT                   AHTVGPPVPGRQRAMSGTNPGPPPPPRPPKTPMEDGGGPRFGVPPPFHGERKVSAPPAP
FT                   PSRSSAPPGPPPPPPRSPATPPQLPPKVPHVPTSAAGPPPPPPARNPVPPPPPPPVPAA
FT                   SRPTPPPPVTSAVPPPPPPPPPPSTSVPPSPPPPPPVSSGPPAPPPPPPPPPSIGGPPP
FT                   PPPPPPAPGGSAPPPPPPPPGAGAPPPPPPASGAAPPLPKPTGGREDLLAAIRASGGGG
FT                   LRKVKDSEKRDRSAALVPGSATESTAPAPSSGGAAQGGLAGALQDALAKRKQKVSGSDD
FT                   EKDDDDDW"
FT   CDS_pept        join(483780..484382,484443..485071,485129..485690)
FT                   /codon_start=1
FT                   /gene_family="HOG000202172" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263257"
FT                   /gene_name="mrs2"
FT                   /orf_name="AFUA_6G02550"
FT                   /product="Mitochondrial inner membrane magnesium
FT                   transporter mrs2"
FT                   /function="magnesium ion transmembrane transporter activity"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mitochondrial magnesium ion transport "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL85785.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0015095"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0045016"
FT                   /db_xref="HOGENOM:HBG056328"
FT                   /db_xref="HOGENOM:HBG326973"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI000052021E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCV3"
FT                   /transl_table=1
FT                   /translation="MLSSSHLKPSAPSATLLRFLRSQSDFLSVNSSRCARPSRSKPYVH
FT                   QILPCNASSRASSTWTCTASAPHRTTLQTSLVRTPTPAARSHSSSRPRLWLCAGQAGRS
FT                   SSIFPLSNAPYSRSASTKSRPLLRRLLDLRRSNSSADKHNRGGPALIDDGTEGGFTIGR
FT                   GLAAKATNEPRLRCTEFDKNGNVTLVNGEFKKSELIAKYGLLPRDLRKIDSSTLPHILV
FT                   RPSAILINLLHLRVLIKHDRVLVFDAYGSTDSYMQSLFVYDLEGKLQQKQTGGFGALPY
FT                   EFRALEAVLISVTTGLEEEFNGVREPVVRVLRALEEDIDRDKLRHLLIYSKKLGTFEQK
FT                   ARLVRDAIDDLLEADDDLAAMYLTERANGVQREEDDHQEVEMLLESYHKVCDEIVQASG
FT                   NLVTSIRNTEEVVKAILDANRNSLMLLDLKFSIGTLGLATGTLFSALYGMNLKNFIEES
FT                   DLGFGAVSMTCFMITAVVCVYGLAKLRKLQRVRMWGEAGVGGAPLTPLTTRSGILSGHR
FT                   SNWRADSIEPVWGSLPGEARTERIKRLRETAAAAAARSASADATAQRASALRSSANANG
FT                   GAPKGSEHSPTRETEASGSSA"
FT   transit_peptide 483780..483947
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCV3 "
FT   mat_peptide     join(483948..484382,484443..485071,485129..485687)
FT                   /product="Mitochondrial inner membrane magnesium
FT                   transporter mrs2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCV3 "
FT   CDS_pept        join(complement(487563..487791),complement(487169..487452),
FT                   complement(486737..487106),complement(485992..486647))
FT                   /codon_start=1
FT                   /gene_family="HOG000161224" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263258"
FT                   /orf_name="AFUA_6G02560"
FT                   /product="Alpha-galactosidase, putative "
FT                   /function="alpha-galactosidase activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85784.1"
FT                   /db_xref="GO:0004557"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056327"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR006215"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000052093A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV4"
FT                   /transl_table=1
FT                   /translation="MHISGYKIPSNQGQAIWRNIYCNCQLLLLWLRVTVFLQTLSSLHN
FT                   GALFTAALRGALRPQGFCIEQWLSSNTADGMVILDAAERIVSLGFKDLGYEYVVLDDCW
FT                   SAGRNSSGYLIADSEKFPNGIAHLADKVHELGLKIGIYSSAGRWTCARYEGSLGYEEKD
FT                   AALWASWGIDYLKYDNCYNEGEEGTPKLSFDRYNAMFKALNATGRPMLYSLCNWGVDGP
FT                   WNFAPTIANSWRTTGDLSNVWDRDDVNCPCSELDGLDCKTPGYKCSIMNVLNKAVYYPS
FT                   KAIPGAWNDLDMLQVGNGGLTDDESIAHMSLWAALKSPLLMTNVMTKIDPPTLSILQNP
FT                   AVLAVSQDPLASTPVRQWRYFVDDVDENGKGEIQMYSGPLSGGDQLVLLLNAGSKAREM
FT                   NATLVDIFWESGAKGTAKQVKQHWDVYDLWANRMSNEDAAAIINGTFTGPSPYNLTAMG
FT                   GAHEVYSRPLPSNSKVLMGSKVGSVQPSGTVTAYVRPHGVAMLRLRATDKKDEL"
FT   CDS_pept        complement(488312..490264)
FT                   /codon_start=1
FT                   /gene_family="HOG000202161" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056123"
FT                   /gene_name="trm44"
FT                   /orf_name="AFUA_6G02570"
FT                   /product="tRNA (uracil-O(2)-)-methyltransferase "
FT                   /EC_number="2.1.1.n2"
FT                   /function="methyltransferase activity"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85783.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG056326"
FT                   /db_xref="HOGENOM:HBG326974"
FT                   /db_xref="InterPro:IPR011671"
FT                   /db_xref="UniParc:UPI000051FFDC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCV5"
FT                   /transl_table=1
FT                   /translation="MPRNVKKNPRDVTKLSGKPLAETIEPSPVLKTLQEGWVTSPDLIE
FT                   GDLSFTLEVIQNMTVFLLANPNLNSSHLFRADILYDSLGVLSAPHAMEQSRDQGSGGRD
FT                   QDTQKEDYVEPLPARSVPGFELKRTFVRRLIPRNRNLDRPLEQTCHFYEADELPPTSNS
FT                   TNIAQSEQCESKAESPRQRFLVIYLPHVSSKEEMPWYHPLLRSLAFLYDFTPNAFPHSS
FT                   EENKGTGIMSVHFLPYEEEPIQNRLERTLLALLSTHIRLARQTRLDEKPEGGNYNPHKD
FT                   NVIPKHLVQDTYARLKLKYAADLCQNWVEDTEPTKHVFEDLSITAFLIELWRSMYGVVP
FT                   ADERSPDQKEQGKYDLKFPGFVDVACGNGVLVYVLLSEGYHGWGFDARRRKTWSIFPSS
FT                   IQERLKEEIYIPKPFADVCTDSEMDFGVKTHTGMFPEHTFIISNHADELTVWTPLMAAL
FT                   SNPASPLPFISIPCCSHSLSGARYRYPPPKPNQKGSVDRPEDQEVEQNPQPAAGDLKAL
FT                   RAAKQKERTDTGAANSMYGSLTAKTVATAEEIGYEVEKTLLRIPSTRNMGVIGGRRRTT
FT                   QEWTSRVHSAQASQAVGCSAPEAVRAAAQVLEWVAAVVQRECAREGGVEVAAKVWIERA
FT                   KGLHKGQGKGNQPAH"
FT   tRNA            complement(490721..490809)
FT                   /gene_name="tRNA-Asp"
FT   CDS_pept        join(491908..492092,492134..492518)
FT                   /codon_start=1
FT                   /gene_family="HOG000048646" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263259"
FT                   /orf_name="AFUA_6G02575"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85782.1"
FT                   /db_xref="HOGENOM:HBG056325"
FT                   /db_xref="UniParc:UPI0000520937"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV6"
FT                   /transl_table=1
FT                   /translation="MVENKFIKVDRESFPYVFVKDVDISLKTHEKGLAQVDWPIPDTQY
FT                   TKFFLTPKQTLLQISDILPRTSDLVLPDAHLGSAGRPSLFGIRRPQHWRSPATYRYISP
FT                   FSAPEQSKSRLRRTISTCSSRCARECGREASLYTGTMGDPVPIMKGWLRVSLREVNENH
FT                   PFHCDYLPHRDYASADVQPVKAGEKY"
FT   CDS_pept        493180..494400
FT                   /codon_start=1
FT                   /gene_family="HOG000234671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263260"
FT                   /orf_name="AFUA_6G02580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85781.1"
FT                   /db_xref="HOGENOM:HBG056323"
FT                   /db_xref="HOGENOM:HBG332065"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniParc:UPI000051F40D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV7"
FT                   /transl_table=1
FT                   /translation="MQIPKPFLGGVAGAFVLLQLLFLANMSYLYGSAYHDSYRISSMNV
FT                   LFVDYDQGVIGESVAAAYSQMQGDSFPTLRQHPPSEYPSQYSIRQAVCEGHFWGAIYAN
FT                   PGASSRLSSALSSPDVAQTYDSSQALTYVWNGVKYASYAQIISSSLQMLAHAATGAYQQ
FT                   INGTKAMGAVDTLNPAIAHTLLNPIAASSIDIKPTNQGVRFYYNTVSMVMPILQQFFFI
FT                   MALNGLTAEFGVVLRTMSLRGSIVLRLTLSVLYTFIAALCMTGYIWGFREAWAVTGGQF
FT                   ALTWMAIWLVMHLNFLLIDAVTSVLPMKFMPFAILTWIIINVSSTIGPFDLSPGFYRLG
FT                   YALPAYELYQLLLDIWTEGCNPPLYRELPILFAWWVVGFVAFLAGMRKRVLAARADYVE
FT                   TRRTDKA"
FT   CDS_pept        join(complement(497351..497571),complement(496962..497293),
FT                   complement(496595..496911),complement(496377..496535))
FT                   /codon_start=1
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902856"
FT                   /orf_name="AFUA_6G02590"
FT                   /product="Protein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85780.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051F190"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV8"
FT                   /transl_table=1
FT                   /translation="MNNVRRRRLSSRECSTVAHIIHTETPIEEETLPHYKAEHYYPVRI
FT                   GNVYHARYKVAGKLGYRAYSTTWLCRDLQANNYTVLKVSTSLPDYPTAADRELRVYKHL
FT                   AKIDSSHPGRSLIRELYDSFDLHGPGGTHRCLVLQLMNVTLLKMMRMNPRLFDLPLLRM
FT                   TIKRLLLALDFLHTEAEVIHTDLMSNNLMLSLEDSSMLADFTTAETENPSPQKLINQSY
FT                   IIYYSQNFRRPTGGRNYGLPVLCDLGEARIGKTQASGPFVQPHIYRAPEVIFEMTWGSA
FT                   IDIWNLAGLIWDLFEGQHLFGDIFDAKGGHDPFRHLALMVALIGPPPTEFVRCSETTEA
FT                   VL"
FT   CDS_pept        join(498109..498126,498177..498457,498585..498848,
FT                   498902..499156,499213..499282)
FT                   /codon_start=1
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263261"
FT                   /orf_name="AFUA_6G02600"
FT                   /product="Phosphoglycerate mutase family protein "
FT                   /EC_number="5.4.2.1"
FT                   /function="phosphoglycerate mutase activity"
FT                   /protein_id="EAL85779.1"
FT                   /db_xref="GO:0004619"
FT                   /db_xref="HOGENOM:HBG469482"
FT                   /db_xref="HOGENOM:HBG658938"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000051F8D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV9"
FT                   /transl_table=1
FT                   /translation="MFDYQLRNLGFLTYLLSVATKVDSIKRRTLKSVIANTRGKEMTPR
FT                   CFIVRHGETEWSLNGRHTGSTDLPLTANGEKRIKATGKALVGNDRLIVPKKLAHVYVSP
FT                   RTRAQRTLELLEIGCKERLPWTEARKSEEEEPIRTEAKVEITDAIREWDYGDYEGLTSK
FT                   QIRELREKNGQGPWDIWRDGCPGGETCTAQLMKVNPDRSPEDVIRRLDALIAEIREKFH
FT                   NKYFEGSSGGKGDVLIVAHGHILRAFAMRWTGKPLSETTLILEAGGVGTLSYEHDNIHE
FT                   PAIILGTAGFVVEE"
FT   CDS_pept        complement(499461..499838)
FT                   /codon_start=1
FT                   /gene_family="HOG000048645" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263262"
FT                   /orf_name="AFUA_6G02610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85778.1"
FT                   /db_xref="HOGENOM:HBG056322"
FT                   /db_xref="InterPro:IPR013183"
FT                   /db_xref="UniParc:UPI000051FB5B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCW0"
FT                   /transl_table=1
FT                   /translation="MPPSSHQHHPSQSYPRHSILPTSTTASASSGMGNSGMSAAKTRQY
FT                   AQLHSQLEQLNANLADTQNLLRMTAVQAEDMRFLGGYVGALFMGSAKVLGEEGVKGNSG
FT                   SGLASSGEGDKGEEAKVKTES"
FT   CDS_pept        join(complement(503421..503620),complement(503311..503351),
FT                   complement(502811..503240),complement(501127..502735))
FT                   /codon_start=1
FT                   /gene_family="HOG000202150" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902857"
FT                   /orf_name="AFUA_6G02620"
FT                   /product="2-dehydropantoate 2-reductase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="NADP or NADPH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="pantothenate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85777.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015940"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056321"
FT                   /db_xref="HOGENOM:HBG326978"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EA7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCW1"
FT                   /transl_table=1
FT                   /translation="MSGIVKRLPQHPPQPEMSPELTRACLVGSNAISAFLSWRLQATTS
FT                   CDVTLVWKSGFESVSQYGVSFKSKTYGNERFKPRHVVRAPEEAASRENAYDYVILCVKA
FT                   LPDVYDLASVIESVVTPQHTCILVNTTNTLGVESQLEQRFPTNVVLSLVSGVEISQTGP
FT                   SEFEHLDSSDIWVGATSNNSSIPVSIQNDMASALAMTLSSGQVNCRVSENIRQEQFERM
FT                   IGPIAFQPTSVMFETSSHAQLLEKVGVRQLVTGIIEELIELAKSQGCSFPSDFAQKTIE
FT                   KMVAIESPSTMYQDFQSRRPMEIETYLGSPIKLATESGIRVPRIETLYAALHHINTNNL
FT                   NRPSTNDTPPPILAQPPPRMSSAPPPRNGPMRPPPGGRSGSGMMIPPGRRGYPMPGMSR
FT                   PPSGQPVPPSARIPREPSLEGLEEFSHLVVYDEFAEGGMPRQNGSNGMHDMPPGPPPAA
FT                   ADLALRERELALRQRELQLREQEMQMRRGPRSRAAPSRAAAFDEDDEDDYFDPMDNIPI
FT                   PHIDPDSVDMMSITSRRTRKAPSASQFRKNPEISVNGRPQSSFSRYLPGRKRTSERIMQ
FT                   EIPGLHDSLMDNPMMAYSSNRYGSVDRNQIQAGSRANSMTASRMGDFPPHPYPQSRRNS
FT                   QSPATPYGGPGPRMGRPSTAQDQPVGPPGPHGGHPSPPGNMRAPVPKYPPGHGNAVGPQ
FT                   QVEQHYGVSNPYPAKGTPKHRSLTGSASASAESGDSGASANLDSEASAHSSQISLGAQQ
FT                   AAMPVR"
FT   CDS_pept        join(complement(511848..512097),complement(510857..511288),
FT                   complement(510465..510825),complement(510155..510412),
FT                   complement(510055..510100))
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263263"
FT                   /gene_name="sub2"
FT                   /orf_name="AFUA_6G02630"
FT                   /product="ATP-dependent RNA helicase sub2 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mRNA transport"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="EAL85776.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051ECA2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCW2"
FT                   /transl_table=1
FT                   /translation="MSHEEDLIDYSDEELQTTDAAATTAAPAANGAQDKKGDLTVSGGR
FT                   PDKKGSYVGIHSTGFRDFLLKGELLRAITDCGFEHPSEVQQVCIPTAILNVDVLCQAKS
FT                   GLGKTAVFVLTTLHQLEPVPGECSVLVMCHTRELAYQIKNEYARFSKYLPDVKTAVFYG
FT                   GTPIQKDIEVLSNKESYPNIVVGTPGRLNALVREKKLSLRNVKAFVLDECDKMLDQIGK
FT                   QAQIAHMRRDVQEIFRATPADKQVMMFSATLSQEIRPICKKFMRNPLEVYVDDDTKLTL
FT                   HGLQQYYIKLSESEKNRKLNELLDSLEFNQVIIFVKSTLRANELDKLLRECNFPSIAVH
FT                   SGVSQEERIKRYKEFKEFNKRICVATDVFGRGIDIERINLAINYDLPADADSYLHRVGR
FT                   AGRFGTKGLSISFVSSEEDEKVLKEIEKRFEVALPEYPEGGVDSSTYMA"
FT   CDS_pept        complement(513117..513395)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263264"
FT                   /orf_name="AFUA_6G02640"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85775.1"
FT                   /db_xref="HOGENOM:HBG056320"
FT                   /db_xref="UniParc:UPI0000520929"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCW3"
FT                   /transl_table=1
FT                   /translation="MSSTFAGIWDDSGHDMDCRSRQRTDCTSCLLGIGQLVPLREAEGS
FT                   IVKHQQDYGFQWREEGDSVSPPCAPDLSTSDRGDYFECVENKALAFT"
FT   CDS_pept        join(complement(514918..515193),complement(514515..514745))
FT                   /codon_start=1
FT                   /gene_family="HOG000202139" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207419"
FT                   /orf_name="AFUA_6G02650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85774.1"
FT                   /db_xref="HOGENOM:HBG056319"
FT                   /db_xref="HOGENOM:HBG326982"
FT                   /db_xref="UniParc:UPI000051E82E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCW4"
FT                   /transl_table=1
FT                   /translation="MSVSASIPDTSLGLTSSEIQILRQQQQIALQNGHTGNGVSRGRGT
FT                   GRTSNSSSRAASAASSHGRLLLDPMSLRALSHQLDGLQEQIRSRIGYLEEQMQLSIQNS
FT                   YDRAGNVIRNVDAEIARTRSILASIDDLENELAKIGHIREIVKAYRGRIESLDQRIDQA
FT                   ARRRH"
FT   CDS_pept        516783..517658
FT                   /codon_start=1
FT                   /gene_family="HOG000202128" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902858"
FT                   /orf_name="AFUA_6G02660"
FT                   /product="Putative uncharacterized protein "
FT                   /biological_process="RNA processing"
FT                   /protein_id="EAL85773.1"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG056318"
FT                   /db_xref="HOGENOM:HBG326985"
FT                   /db_xref="InterPro:IPR019007"
FT                   /db_xref="UniParc:UPI000051F19B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCW5"
FT                   /transl_table=1
FT                   /translation="MPKDKERSVNPAMAQRKLEKQKTLKKAKAEALARRNEKLARRNPE
FT                   RIQRQINELKEMEESGQTLRPREKQILEALERDLRAVQKAREALGDKAPTFASSEHRRG
FT                   PQGGQRDHRDGLLGKRRREDHRRFEPESDSSETDEDVRRIPMPRDTPPPIPKEYQGRRG
FT                   PNADMDLDSARGPHPLPPKPPVVETKTVYEAKPEIRNLRQEAVSKFIPAAVRVKQESIK
FT                   GRGKLLEPEEMDRLEKAGYSATSAKLKGGANSAQPAKDDIEQKLLEEEERFNRELRTVQ
FT                   IEEVEDEEAS"
FT   CDS_pept        join(complement(520600..520651),complement(520479..520531),
FT                   complement(518426..520423))
FT                   /codon_start=1
FT                   /gene_family="HOG000202117" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207420"
FT                   /orf_name="AFUA_6G02670"
FT                   /product="G2-specific protein kinase NimA, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85772.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG056317"
FT                   /db_xref="HOGENOM:HBG326986"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051F416"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCW6"
FT                   /transl_table=1
FT                   /translation="MAIALAEADKYEVLEKIGCGSFGIIRKVKRKSDGFILCRKEINYV
FT                   KMSQKEREQLTAEFNILSSLRHPNIVAYYHREHLKASQDLYLYMEYCGGGDLSMVIKNL
FT                   KKTNKYAEEEFVWRILSQLVTALYRCHYGADPVEVGSNILGPAPKPSGLKGKQAQMTIL
FT                   HRDLKPENIFLGSDNTVKLGDFGLSKLMHSHDFASTYVGTPFYMSPEICAAEKYTLRSD
FT                   IWAVGCIMYELCQREPPFNAKTHIQLVQRIREGKYAPLPDFYSPELKNVIASCLRVNPD
FT                   HRPDTATLINLPIIRLMRKEKEVVDLGKTLRKREEAASQKVKEMEQAFAKLEKEKQQMK
FT                   TEIENTVRREWEVKARLEIDRQVQNELDRLRKRFEFEVQERVNIEVEKQKRNNTSRDDT
FT                   VLPTGSSQSSVNSGDDTGFPSNTDLSQLSIESPTANANKQPKKETRTPFSRSKTMVKSP
FT                   VDVQMAEPSPISIASLSLSPRRTSAASKNIFAEADKQRAKWEPTLAYSDDEDDIPDLPS
FT                   PTRQKVKHDPPKGPARPLLRQNTTAFMQKLSSQPPLFPSNSSRLPQMPGGPSETRHGEK
FT                   SRSPHRRLSKIPSSANLAADAGSPTRKSATKQLPSKANGGGEEMFKAVMQRNMGGRTLV
FT                   ELAQARAGGRPMDEVKRCASDSRASGCSSNLKSSDREPPAVWDPEKDEMPSPFLAHGRK
FT                   VIRNFR"
FT   CDS_pept        join(521343..521579,521687..521772,521841..523407)
FT                   /codon_start=1
FT                   /gene_family="HOG000202106" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056124"
FT                   /orf_name="AFUA_6G02680"
FT                   /product="Ankyrin repeat and BTB/POZ domain protein "
FT                   /protein_id="EAL85771.1"
FT                   /db_xref="HOGENOM:HBG191648"
FT                   /db_xref="HOGENOM:HBG397648"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR013089"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051EA6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCW7"
FT                   /transl_table=1
FT                   /translation="MMTERTVLRKDQLEISLHNEKKLIQEGTIKDDNPLDLSEPFRELC
FT                   EACRKGDLKVCQEKITEGVNVNARDPYDYTPLILASLCGHYEVAQLLLESGALCERDTF
FT                   QGERCLYNALNDRIRNLLLEYDYSKSTDPLQPLAAHVSSLLTRDQPGTSDIVVTAGDES
FT                   LYLHKFILAARSPYFRGKLVADPKSTTWKLPSTIPPQAFGTAIKYLYFGEAPRDLRSGP
FT                   GTGFTESEVFAGIDRISKHLEIPSLLDSILDSGDRRLARQRRSMELSRGRDQLEEWFRK
FT                   NVLGSKIEVNSSKVDGFRWDRHNGIFADVVLRADELREDEDDICDGFNLNGKQQDRKSV
FT                   LFPCHRAMLLRSEFFQAMFSSTFREAHLKEHLNVIPVDCSPEVLEIVLTFLYTERADFP
FT                   LDIAVDVLFAADMLFIEKLKTKAAVVISTLGSGDMSQAEAARTRGTKEEDEIDIYAIIR
FT                   AAWLTRVQRLEEFAARYLAYRLEAHIDSPEFAELIQESAARIKARQETDSIELLDDIRF
FT                   YLGERFRLRFDDAGLEEMMEEEQRQQLADSSGVDKDLVEITDKVDTMGIQSQTLPIGAE
FT                   AEVTPGEMIREQGPIIRTLDGEIAGDEFSKDAINYQILMEKLDLLLKELNLEA"
FT   CDS_pept        join(536693..536966,537031..537767)
FT                   /codon_start=1
FT                   /gene_family="HOG000202095" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750831"
FT                   /orf_name="AFUA_6G02690"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85770.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056315"
FT                   /db_xref="HOGENOM:HBG326998"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000052021D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCW8"
FT                   /transl_table=1
FT                   /translation="MDVASLISPSESDTVPTFRSRSIQNSSASHYKRLSEQSTGSYFSA
FT                   VPTHTTSYSRTPQPPLSPPAEDQSKCSLPSISILLENADGAAAHAAKRQRNSLSTHRDS
FT                   DPRPPYDSITPHAMPPTPPLRPGSGFHSNGHSPSTSSVSAASSSALMKNTESYPQAPIG
FT                   LPSPTDRSSISSQGSVQHAASAPYASPAPSVSSFSSPIEPSTPSTAAYYQRNPAPNTFQ
FT                   NPSPFPQTSTASLPSPGHQQMISPVTPAWQHHHYFPPSSSTSYQQNHDRYICRTCHKAF
FT                   SRPSSLRIHSHSHTGEKPFRCTHAGCGKAFSVRSNMKRHERGCHTGRPVATAMVQ"
FT   CDS_pept        join(complement(542034..542510),complement(541060..541971),
FT                   complement(540118..541008),complement(539992..540064),
FT                   complement(539799..539902),complement(538631..539737))
FT                   /codon_start=1
FT                   /gene_family="HOG000202084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263265"
FT                   /orf_name="AFUA_6G02700"
FT                   /product="Structural maintenance of chromosome complex
FT                   subunit SmcA"
FT                   /function="ATP binding"
FT                   /cellular_component="chromosome"
FT                   /protein_id="EAL85769.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="HOGENOM:HBG056314"
FT                   /db_xref="HOGENOM:HBG326999"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="UniParc:UPI000051FDB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCW9"
FT                   /transl_table=1
FT                   /translation="MPFLSTVPRRRRRSEDEDDDEASTNSSRDTTPASRDSINGKRRRL
FT                   DPVHDGVDEDEDDGEIGDEGSDEGTEQNTPGLTQADSRPTQSSISQTTSLANGEVDDDG
FT                   YKPGAIVRIKVTDFVTYTSAEFFPGPKLNMVIGPNGTGKSTLVCAICLGLGWGPQHLGR
FT                   AKDPGEFVKHGCREASIEIELAKGPGLRKNPVISRTIKREGNKSSFTINGKQASLAQVK
FT                   KFAQSFAIQIDNLCQFLPQDRVSEFAALTPVELLHSTQRAAAGPEMIEWHESLKKLRAE
FT                   QKKLQLDNQSDKDLLANLENRQEMQRVDVERMRQRAQIKRKIEMLEHLRPVIQYREARN
FT                   ELNQKKTEQRRLRKELEDLEAELAPALRAVNAKQDYCSKLDEVVKYKKRCFEQADRDAM
FT                   EIVKKIEQFDDALKDLNNQIEAEKKTGQSYRQQATKIQQTINRLNRELNEQPAEFDIGW
FT                   YNERIKEKRLATRELEAKATEIQQARLPLVEELKSKNDQIRRAEQQLQSLASQSGQQEA
FT                   KLRKASRDSYQAYKWLQDNQDKFEKEVFGPPIVTCSVNDPKYADAVESLLQRTDFTAFT
FT                   TQTRNDFRTLQRALIIDLRLHDISIRTSTTPLESFRPPVSDEELRTLDFDGWAKDFLSG
FT                   PEPVLAVLCSENRLHQTPINLQGISDETFATLENGSISSWVAGKQNYQIVRRREYGPGA
FT                   VSTRVRQVRPAQIWTSQAVDVLGKQEIEREILALKDELSRIKEKMESERSRLHRMGEEK
FT                   KELDRERATLEKEKAEKQTALINYRAIPEKIHIERLFGEMRVRVLEIRGRQDQISIQKA
FT                   KANLEYADAQDAVENLRRLQEEATQLSIRLIEGLSDCTTLRERSQHHKMRLDQKSSEVK
FT                   AAHEDVKTRSEAVRKMVDQANRAIRLINEQEDLREFMPTLVEYTLEQLEADIDSERAHL
FT                   ELVQGGNANVIKEFEEREKQIDKLRDKVSEFQNQLAEYDHAINEIRGKWEPKLEELVKS
FT                   ISDAFSDSFARIGCAGQVTLDKAEDEEGPNGEPGGSNFDQWSIQIQVKFRENENLSILD
FT                   SHRQSGGERAVSTIFYLMALQSLSASPFRVVDEINQGMDPRNERMVHGRLVDIACAPAR
FT                   NGGGGQYFLITPKLLSGLVYKPGMRVLCIYSGEHMPEDYNLLNFGGAIKRMRALNAKKK
FT                   GKARAIEGDAHRNNGDVDVYG"
FT   CDS_pept        join(542777..542890,542957..543142)
FT                   /codon_start=1
FT                   /gene_family="HOG000202071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902859"
FT                   /orf_name="AFUA_6G02705"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27241.1"
FT                   /db_xref="HOGENOM:HBG325068"
FT                   /db_xref="UniParc:UPI0000F51CE8"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA23"
FT                   /transl_table=1
FT                   /translation="MPAPKNVQKLVLAAAVTSITIAGTLYGASVKTEQEVTKTVQKSRE
FT                   ATIDERIASLRAMRQNLTSKKELVERQIDDLEKRIQERAQKGLGEKKETPHNGR"
FT   CDS_pept        join(complement(547094..547456),complement(543779..547033))
FT                   /codon_start=1
FT                   /gene_family="HOG000202060" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263266"
FT                   /orf_name="AFUA_6G02710"
FT                   /product="Lipase, putative"
FT                   /EC_number="3.1.1.-"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="EAL85768.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG056313"
FT                   /db_xref="HOGENOM:HBG327000"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000051ECA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCX0"
FT                   /transl_table=1
FT                   /translation="MSRLLGFRSFFGKRVEAEGDIEEALGPDGASHVSATSGPTLLPRP
FT                   VASALSILTQSTSLSLKLGSFFGGIAIEGARVTTLTGLELSRAVIEGILTRAGRDVALR
FT                   SSGERGKVEAESLLERSLAALHTTVTSASFFAAATFHFSSTTLSSAAHVSQALLSTLDA
FT                   ILGSTESSRAIAAIITLIRREFRSPSAEIGTDNIGVGDLLVGTVGFAMLQRWGRKSTER
FT                   HMRLNGGYETVWDVVILDNGARADVIGTHPIEPAEYSRSALGSATRRSSFISPGNEEER
FT                   FDAVQRPSSVVEHAEVPEMVLPASDQQVSDEDVRLHIMKQLPHGCRASIRSDVVTTRTI
FT                   TVDIYDDDNAELAAPPGMMMIEERFHNDRPDENSGLLSTMNQLPKHTVVFRTAFNKTQN
FT                   ADVRPSLRPEAFDSRELENPIATKSLPALPSTLLDTTTPTDNKNEADSQARISDSRGLS
FT                   GEQPSTTEHMESLEYDKPRSRAAPESSSEGFSSAGAARDTRSGGGAKKSREVSSSCPVN
FT                   ELSTGSKGTFGKASLTRLAQKVKPANVERDETGKRIAQRSTLDKAQKFSKNGTQRNKMQ
FT                   KGPLVDKRSAHHDMSTTPTAAESATKMTGSHTNRTLLPVANRGVPRSAIHDPRLRISPS
FT                   QTRQVQTPSRSQRDAQPDYFTVHEVNQETFITKSDSFSLRSAGTRANSPAATRTHVRSS
FT                   SSLSLTRSETDMALSLSADGRPTSSGWQQRTTSFAPSIYSLATAGSETSLILAHRARMS
FT                   AYDDIDTIRSLTRDGRIPGIFPEQHFVQNIRRFCRFSSASYGSNALKVMGVTRQTQAIP
FT                   HLESDNQEHSDFSVHTGLPASTILLSSFVDPAGGTNAAGETDSGFPLVHYVCLDHASKA
FT                   VVLTLRGTWGFEDVLTDMTCDYDDLVWQGRSWKVHKGMHASAKRLLMGGGGRVMITIRT
FT                   ALEEFPDYGVVLCGHSLGGGVAALLATMISVPNSEQFGTSFVTATPQSAARRMLLGNND
FT                   DEDEESRLPFYLPTGRPIHVYAYGPPSAMSPFLRRATRGLITTIVNGQDVVPSLSLGIL
FT                   HDMHAVSVAFKSDTSGTKSHVRYRVWEGLRQSIVNKFYVNETPMLLHAGDGLGEDAWAW
FT                   KTLKALREEMCAPKLLPPGEVFVVETMRVLQRNAFTSDFGGDGYPMLGRPATRVQLKFI
FT                   RDVESLFGELRFGSGMFSDHNPARYEASLAALAQGILDD"
FT   CDS_pept        join(complement(549218..549426),complement(549100..549135),
FT                   complement(548409..549037),complement(547997..548334))
FT                   /codon_start=1
FT                   /gene_family="HOG000217463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263267"
FT                   /orf_name="AFUA_6G02720"
FT                   /product="FMN dependent dehydrogenase, putative "
FT                   /EC_number="1.13.-.-"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85767.2"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG516177"
FT                   /db_xref="HOGENOM:HBG517781"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000F51CE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCX1"
FT                   /transl_table=1
FT                   /translation="MPENYGDFQTEIYGRGALMGLKPNVTTDPRLLEEQARKALGARSF
FT                   NYVAGGAGEKATMDANRLAFRQWKLVPRMMKPVRLMHLTVNLFGQEYPTPILMAPVGVQ
FT                   SLFHEDKETGLAEVCAEVGVPYILSTASSSTIEEVAEANGDGKRWYQLYWPQDDDVTMS
FT                   LLKRAKENGFSVLVVTLDTWSLAWRPADLDNAYVPFIKGVGNQIGFSDPVFRAKFEKDQ
FT                   GFKVEEDIVGASRAWIGDVFSGKPHTWEQIAFLRKNWNGPIVLKGIQHAEDARLALKAG
FT                   CDGIIVSNHGGRQVDGAIGSLDVLPEIVDAVGDKMTVLFDSGIRTGADIIKALCLGAKA
FT                   VLVSRPIIYGLAVDGKQGAKQVMKGILAELWQSLSLAGICGIAECSRDNVKRVQYPGDL
FT                   KAMM"
FT   CDS_pept        join(550863..551040,551096..551196,551262..551409,
FT                   551458..552503)
FT                   /codon_start=1
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263268"
FT                   /orf_name="AFUA_6G02730"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL85766.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG328895"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F8CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCX2"
FT                   /transl_table=1
FT                   /translation="MKHEQDSKADVESSPARINENVSEDSTLDEKRERVLIRKIDYYIL
FT                   PLIVLLYLFSFLDRVNIGNARLYGLEEDLGLVGNQYQVAVSILFVTYCLFEVPSNLVIK
FT                   KLRPSRYLASIAVIWGVIATLTGIVQSYGGLIACRLLLGVVEAGLFPGLITYLTLFYSS
FT                   HQIALRTGYLFSSAAIAGAFGGLLAYGIGYMDGISGLRGWRWIMILEGIPTVILGIITW
FT                   FVLADEPDTAYYLNEEERALIVRCRNRYVGQTVSAQKFHWADVKEGFLDWKIYAFSIGQ
FT                   FGVDTMLYGYSTFLPTIIKGMGSWSTPEVQALTIPCYALGALAYLAIAWLSDRLQRRAL
FT                   FICIFSVISMVGYGILISDVSSGAHYFGALLIALGLYVTVGLPLAWLPTTLPRYGKRTL
FT                   ATGMQLTFGNVSGVMSPFLYKTTEAPRYVRGNAVTLSLIGFAGMMWVMMWLYYHHENSR
FT                   RANGLEDEKIAGMTEEEIQELGDNSPRFRYTT"
FT   CDS_pept        join(556816..556898,556996..558145)
FT                   /codon_start=1
FT                   /gene_family="HOG000202038" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263269"
FT                   /orf_name="AFUA_6G02740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85765.1"
FT                   /db_xref="HOGENOM:HBG056312"
FT                   /db_xref="HOGENOM:HBG327005"
FT                   /db_xref="UniParc:UPI000051ECAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCX3"
FT                   /transl_table=1
FT                   /translation="MEYHFVPPEERAKDDKGNLLPWGYVYKDEARNPRRPPEESGPFGK
FT                   RRNARYEQARSRTRTGTPAKRENPNVAEFGRLFAQQQEEEKSRNILPKSSSSSSLDNTR
FT                   KQTEKIATECILYGYRSKDGEWKVIDKYEKISRGLICEDYPRSDPNSTNGFAQLLSGGD
FT                   VVIRSNLSADANRKSKRYAGGFHWIKVTFDSTIAADRACFYSPQEIDGHLVFCELYHGS
FT                   GPAEDAPIPVDSSKAVQFKSKAPRTLTTSHSTTFLQPQDKDRAATLPRSFAMNNLSGVA
FT                   ESQEEASQISTSTASSATATGIEQPSALQQRNVSKESKPESEFMTHIPTVRRTKLRPIS
FT                   EALPPQPTVTERVLRSIPILSWFTGDIVGDGPQLREDGSFDYDKSNAYWRFWYMVDMIL
FT                   GTDICGLKEES"
FT   CDS_pept        join(complement(559625..559767),complement(559248..559420),
FT                   complement(558922..559166))
FT                   /codon_start=1
FT                   /gene_family="HOG000261245" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263270"
FT                   /gene_name="egd1"
FT                   /orf_name="AFUA_6G02750"
FT                   /product="Nascent polypeptide-associated complex subunit
FT                   beta"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85764.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG244178"
FT                   /db_xref="HOGENOM:HBG629031"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="UniParc:UPI0000520214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCX4"
FT                   /transl_table=1
FT                   /translation="MDQAKLARMQASVRIGTFCSFLWIFEVLESESVFSADGFQAHHLG
FT                   NVIGKGTPRRKVKKVHKSSGADDKKLQTTLKKMNVQPIQAIEEVNMFKEDGNVIHFAAP
FT                   KVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKQAGAEG
FT                   KKDEDEDDIPDLVEGENFESNVE"
FT   CDS_pept        complement(560648..561385)
FT                   /codon_start=1
FT                   /gene_family="HOG000250265" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263271"
FT                   /orf_name="AFUA_6G02760"
FT                   /product="UDP-glucose-4-epimerase, putative "
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="EAL85763.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG238565"
FT                   /db_xref="HOGENOM:HBG418344"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E832"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCX5"
FT                   /transl_table=1
FT                   /translation="MSGQFALSEPFPPGLPPTPDAVIHLAGYSRNMLAPDDETFRTNTV
FT                   STYNVIEAACKLGIRKIIIASSVTVYGVSFALGDTDYPSFPVDEEVDANPTDTYAIAKV
FT                   CGERVARGFAGRFGADIYVFRIGRVIAPEEYEQQLFHSYVYEPAKWKPHGWSYTDARDL
FT                   GRMCDLGLRKSGLGFQIFNATNDTITSTTPTEEFLRKQCPNVPFTRQMGEFEAPLTNAK
FT                   IKSVLGFQEEHPWRKYFPFNAEQ"
FT   CDS_pept        join(complement(562867..563050),complement(561936..562789))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750832"
FT                   /orf_name="AFUA_6G02770"
FT                   /product="Short-chain dehydrogenase/reductase family
FT                   protein, putative"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85762.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00005206C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCX6"
FT                   /transl_table=1
FT                   /translation="MALSNFAFAASFASHAIFHPLDFYSSVGPTLNESTFGLLGSPFDP
FT                   RHDITDLSGKVIFVTGGNIGLGKETILQLAYHRPSRIYLGARNATKARDAITDIQRQLS
FT                   TPVDIRHIPLDLASFASIRSAAAKFTSECDRLDILILNAGTMGNPPTTTEEGFEVQFGT
FT                   NHIGHFLLTKLLLPVLQKTAASPASTDVRVVTLASLANCAAPSYDVMTSTGALLAASTW
FT                   TRYAASKAANILFASELARRYPNILSVSVHPGTVTSNLYEHAKASSPVSKYSVAALSLF
FT                   FRSVRSGALNQLWAAGAKRELLTNGAYYIPIGNHAKNNKYATDADMAKRLWEWTEAQIS
FT                   EKFVP"
FT   CDS_pept        join(complement(565719..565804),complement(565488..565578),
FT                   complement(565367..565420),complement(564916..565304),
FT                   complement(564757..564862))
FT                   /codon_start=1
FT                   /gene_family="HOG000260139" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902860"
FT                   /orf_name="AFUA_6G02780"
FT                   /product="Acyl-protein thioesterase 1 "
FT                   /EC_number="3.1.2.-"
FT                   /function="carboxylesterase activity"
FT                   /biological_process="fatty acid metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85761.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006631"
FT                   /db_xref="HOGENOM:HBG398734"
FT                   /db_xref="HOGENOM:HBG651281"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="UniParc:UPI000051EA75"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCX7"
FT                   /transl_table=1
FT                   /translation="MAPPRAPYIVPALKKHTATVIMAHGLGDRMSLAQNWRRRGMFDEV
FT                   AFIFPNAPMIPITVNFGMTMPGWHDLTKLGRELDYESAIRHQDEPGVLRSRDYFNTLIK
FT                   EQIDKGIKPSRIVLGGFSQGAAISVFTGITCKEKLGGVFGLSSYLVLSDKLKNYIPENW
FT                   PNKKTPFFLAHGLEDEIVLFDFGDLSAKKMKEIGLEDVTFKSYPNLGHSADPVEIEDLA
FT                   RFLQKVIPPEDDGQASAGL"
FT   CDS_pept        join(complement(569715..569745),complement(568319..569598))
FT                   /codon_start=1
FT                   /gene_family="HOG000202027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207421"
FT                   /orf_name="AFUA_6G02790"
FT                   /product="Putative uncharacterized protein "
FT                   /function="alcohol O-acetyltransferase activity "
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="EAL85760.1"
FT                   /db_xref="GO:0004026"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="HOGENOM:HBG053681"
FT                   /db_xref="HOGENOM:HBG327419"
FT                   /db_xref="InterPro:IPR010828"
FT                   /db_xref="UniParc:UPI000051ECA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCX8"
FT                   /transl_table=1
FT                   /translation="MDQFERLRAVAATYILPETYNSPVKDYIYRACTRLINQHPILSAI
FT                   PVGEGTKEPYFARLPEVDLEKSVSFEKRARDFPEADEPDTELETLLTTQHNTPFTPPLP
FT                   YWRLCVLTDATSERRFTAAFVYHHAISDGTSGKAFHKTFLQALRETAGSVGLEEVKTVI
FT                   APPKVPLLPNSEAVHPLPVSIFYLATTLFKEKVWSWSDPGLWTGSGIIVPLETQLRHIV
FT                   FSEHVTSVLKDRCRHNYTTITAMLETAIARSLFARLPEKFTSVKCTGAMSTRRWLDDII
FT                   TDDSMGVWVQDFEDTFSRNNVTSDGFPWEEARRARQTIENVLSLKGKNASPNLLKYVDD
FT                   VHDLFLSKVGKARKSSFEVSNVGVLAADQDTAKPQIERMVFSQSASVTGNAFEVSVITG
FT                   GDRCMVLAFTWQTHVVESDLMSAVIESIRTELVDLCS"
FT   CDS_pept        join(complement(570450..570866),complement(570078..570389))
FT                   /codon_start=1
FT                   /gene_family="HOG000202016" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16263272"
FT                   /orf_name="AFUA_6G02800"
FT                   /product="Uncharacterized protein AFUA_6G02800 "
FT                   /function="transferase activity"
FT                   /cellular_component="anchored to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="EAL85759.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0031225"
FT                   /db_xref="HOGENOM:HBG056310"
FT                   /db_xref="HOGENOM:HBG326968"
FT                   /db_xref="UniParc:UPI000051EA6E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCX9"
FT                   /transl_table=1
FT                   /translation="MKFSPAYLLAFAPIVAAHFRLQYPTSRGFNADTMANFPCGDLAQS
FT                   SNRTQVSLSSGSFPVALRMGHDETAVEVLLALGNDPGTNFNITLHPTFRIEGLGEFCLP
FT                   NVVFDESVLGTKITDGMNATLQVQSNGDPSGGLYACADIQFSTTAQDEKPSSCTNNTGI
FT                   SAIAFTGAAAERNANESTADGQAQSGSSGSSSDSGSHSGHSSATQTSSTTASSTAGAVA
FT                   LETAAWGILGAAVVGGLAVL"
FT   pro_peptide     complement(570081..570152)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCX9 "
FT   mat_peptide     join(complement(570450..570815),complement(570153..570389))
FT                   /product="Uncharacterized protein AFUA_6G02800 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCX9 "
FT   sig_peptide     complement(570816..570866)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCX9 "
FT   CDS_pept        join(complement(572019..572467),complement(571843..571957))
FT                   /codon_start=1
FT                   /gene_family="HOG000202005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263273"
FT                   /orf_name="AFUA_6G02810"
FT                   /product="Ctr copper transporter, putative "
FT                   /function="copper ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85758.1"
FT                   /db_xref="GO:0005375"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG056309"
FT                   /db_xref="HOGENOM:HBG326967"
FT                   /db_xref="InterPro:IPR007274"
FT                   /db_xref="UniParc:UPI0000520213"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCY0"
FT                   /transl_table=1
FT                   /translation="MNMDHSSHSTMSSSSSMTMTMVFTNSHDTPLFSSAWTPSSSGAYA
FT                   GTCIFLVVLAIINRCLVAFKASMEHYWFATHLNRRYIAIAGKSSEAGRIDTDPDAKVAS
FT                   LVTAQGVEESVKVVRRVSREPIPWRFSVDLPRAAIFLCITGVSYLLMLAVMTMNVGYFC
FT                   SVLAGAFLGELAVGRYIQWNEHDH"
FT   CDS_pept        join(573281..573377,573439..575453)
FT                   /codon_start=1
FT                   /gene_family="HOG000201994" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056125"
FT                   /orf_name="AFUA_6G02820"
FT                   /product="Metalloreductase, putative "
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85757.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056308"
FT                   /db_xref="HOGENOM:HBG326966"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000051EA6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCY1"
FT                   /transl_table=1
FT                   /translation="MDGMSMSGMGHMSMGEGVPDVFYLQRMYWAVIGGLHSPFKRYEEP
FT                   GRSTQHRLRDSTLTPSKPKSFFFSSYATLTAVVREASYATLPPITIRGRSFHFAPLGPI
FT                   AIILANLVVVLVFCFYKLDTTNKWKWEDVGYRTGFVAISQLPLIFLLAGRQNIIGLFVG
FT                   LSYERLNWFHRWISRTLWLTATIHMGFWFRNWARYDYITYQLQNDVLTQRGFAAWCILT
FT                   FIVISSAAPIRRLSYELFVLQHLVTFAGFLAAVWLHAPAEVKAWVWISIGFLVFDRVAR
FT                   YVWAAYANLSIFHASKSNPHPLWANVATFTPLPGNVTRITVENPGVRWKPGQHVFLTCH
FT                   SIVPLQSHPFTITSIPDDGKMEFFVRAEKGGTRRFFRYASKHHLALGSGEVSTAQRPRT
FT                   VFIDGPYGRIRTLRQFDSVVLLAGGMGATFTIPLLRDIVAGWKAECAGNSTRRIAATKR
FT                   IRFVWVIKSRAQLSWFETQIQSVLSDVDECRQAQPDMIRELEVSIYITCDEKLEQQPPK
FT                   TACLQPPSSPTEAPKAIEPRKGEFSEKNNRISIQSVSASSSSGQDPASTSGCLPGGGCC
FT                   CTAAVEDEDEITEHKCTCSGNAPASESSKPIPTAAAETEETRQLKASAQPEPAQSHHLN
FT                   LLSGRPQPRIIIRKVLEKAEGESAVVVCGPEGLSDDVRRSVVYLSDERAVHKGTGAQGI
FT                   YLHVEAFGW"
FT   CDS_pept        join(575599..575603,575716..575767,575847..576182)
FT                   /codon_start=1
FT                   /gene_family="HOG000201983" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263274"
FT                   /orf_name="AFUA_6G02830"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="EAL85756.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056307"
FT                   /db_xref="HOGENOM:HBG326965"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012882"
FT                   /db_xref="UniParc:UPI000051F8D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCY2"
FT                   /transl_table=1
FT                   /translation="MTHVINPPIKTCFNMVFRFPKSLDPITLFHSPALASSKRAHNILR
FT                   QAAAVASETATEDQASDHLEHAKRQRGEFQLEVTTAPPTPDQLRNILDYVGAGVKPSDL
FT                   VQGAKDAKEALELFKKDEGKFVRPVV"
FT   CDS_pept        join(complement(578193..578772),complement(576757..578111))
FT                   /codon_start=1
FT                   /gene_family="HOG000201972" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207422"
FT                   /orf_name="AFUA_6G02840"
FT                   /product="Serine/threonine protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85755.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058711"
FT                   /db_xref="HOGENOM:HBG396340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI000051F40C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCY3"
FT                   /transl_table=1
FT                   /translation="MMTLDTPRESPERHGLRLPNPPPLLHTRSGNEPFDRPSTPADNGF
FT                   TTPAQTPQGSPSKNRMPPGAIDLPNVFEKGMKLTPSSPTKNTFNHYNHPMFAPPKGAMD
FT                   DFSESVIRQSPGSPTRRSNKENTPPSPLKVAKDLGPNPAAAAISRHEPYQQRDLETLQR
FT                   RQVQMRGLTPEEMEKLQSPRVKRLVNVTQLYFLDHYFDLLSYVHNRQTRYSQFRAAYPD
FT                   PPATPIDDYEPALLKYLGRERAHLRKRRTRLRQHDFQILTQVGQGGYGQVYLAQKKDTR
FT                   EVCALKVMSKKLLFKLDEIRHILTERDILTAAKSEWLVKLLYAFQDDEQIYLAMEYVPG
FT                   GDFRTLLNNTGVLHNRHARFYIAEMFSCIDALHALGYIHRDLKPENFLIDSTGHVKLTD
FT                   FGLAAGMLNPGKIESMRVKLEEVGNTPVPFGRPMEQRTAAERRQGYRSLRERQVNYAKS
FT                   IVGSPDYMAPEVLKGEEYDFTVDYWSLGCMLFEALAGYPPFAGATVDETWQNLKNWQKV
FT                   LRKPVYEDPNYFLSRRTWGLITKLVAAKENRAKSIQEIHAHDYFSEVDFSRLREQKAPF
FT                   VPELDSETDAGYFDDFSNEADMAKYKEVHEKQRALEEMAEREEKMSKGLFVGFTFRYVH
FT                   HILRAKIYL"
FT   CDS_pept        join(complement(580809..580906),complement(580521..580752),
FT                   complement(580425..580454))
FT                   /codon_start=1
FT                   /gene_family="HOG000076291" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750833"
FT                   /orf_name="AFUA_6G02845"
FT                   /product="Ethanolamine utilization protein (EutQ), putative"
FT                   /protein_id="EAL85754.1"
FT                   /db_xref="HOGENOM:HBG304734"
FT                   /db_xref="HOGENOM:HBG568350"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051FDB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCY4"
FT                   /transl_table=1
FT                   /translation="MTVPFRYHAKAQSTFKPPLIANENAFLGDVYSSEKENPDKPISAG
FT                   FYRLEKGTPLVYEYTYDEMKIILEGQFEIADETGQKVTALPGDVFYFPKGAKITFTTQT
FT                   YGLAFYTGQRKQGGA"
FT   CDS_pept        join(complement(585369..585540),complement(585046..585228),
FT                   complement(583081..585002))
FT                   /codon_start=1
FT                   /gene_family="HOG000201961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263275"
FT                   /orf_name="AFUA_6G02850"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85753.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056306"
FT                   /db_xref="HOGENOM:HBG325067"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI0000F51CF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCY5"
FT                   /transl_table=1
FT                   /translation="MDDIKIPSPTTILDTTPTISSSAGTFDSVSSIKGSASPNRTTKGV
FT                   VTDKPKQSKSRNGCITCKAKRLKCDESKPTCLQCKKRNVECGGYKKDFKWRPFEETNVI
FT                   SRISSIQARKSKCTGDPARSGKERRASHSVQAGKDRQPWPVSPRSPTPTASSLDSNDAA
FT                   LIHTLQSGISPSTDSPLALTQENLTSWNSGIARFLDFSNAEDELLTPLFTNSSPPEQSP
FT                   QLSDIVPSALDIHTSPMRRPLGLASQNTLRPGNLSFAALLEEDNDKIEEIARQSDKPID
FT                   PWLVGVSDGGAPSETSNTPAMLTKEPNFDIASPEMLALQFDRFTCGILSVKDGLNENPW
FT                   RTLIWPLAGETPALYHAIFSMTAFHSSKDNPGLRMHGVDHMRRSITYMVQDIQNMRTDA
FT                   ALATSLALAFADTWDQNTRNCIQHVRGAKALVLQVLKSKARDANDIERIRFLYNTWLYM
FT                   DAIARLTSRDDDGDQDMNFSIFQLPRDAVHEIDPLMGCATTLFPLINQVARLIQRVRNM
FT                   ESNSISLVSRAIELKRLIEQWEPPEWFVPPEDPTSEVQHSIQTAHAYRWATLLYLHQAV
FT                   PEMPSEPASDLAKRVLILLATVPPGSRTIIVQMFPLIAAGCEAEPGEDRQWVLTRWRAI
FT                   QSRLMIGSIDRCIEVVQEVWSRRDAIEAEKQRRQERVLSSSSRQSKGGPGLRSQGTREQ
FT                   FMSSPAIPSDLAVSSRPPFVGTRRSSAVSPLENIEFEKTVRGRLHWVSVMQEWGWEGES
FT                   LSCSV"
FT   CDS_pept        join(588115..588535,588587..588875,588936..589348,
FT                   589405..589828,589885..590287)
FT                   /codon_start=1
FT                   /gene_family="HOG000238475" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263276"
FT                   /orf_name="AFUA_6G02860"
FT                   /product="Isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /function="isocitrate lyase activity"
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="EAL85752.1"
FT                   /db_xref="GO:0004451"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="HOGENOM:HBG056305"
FT                   /db_xref="HOGENOM:HBG308645"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="UniParc:UPI000051EA67"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCY6"
FT                   /transl_table=1
FT                   /translation="MFRSVPRRIPRRLPTLSSTAGSPSHLALRSFTCGYPRMSSSPLPT
FT                   VEPPVSTTLPSDSFQLLSTAEKSGSAEDALYEQQIKDVEAWWKSPRFEGIKRPYSAADV
FT                   VSKRGTLQQTYPSSLMARKLFNLLNERAAEGKPVHTMGAIDPVQMTQQAPNQEVLYISG
FT                   WACSSLLTTTNEVSPDFGDYPYNTVPNQVQRLFKAQQMHDRKQWDARRKMTPEQRKSTP
FT                   YVDYMRPIVADGDTGHGGLSAVLKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVP
FT                   IGEHINRLVAARFQWDMMGVENLVIARTDSESGKLISSAIDVRDHEFILGVAEEVEPLA
FT                   ETLQAMEREGAAPAEIDAFELDWVKKHKLVTFDEAVDAHLEAEGAPQSVRDAYKKKVQE
FT                   NPDLSISRRRALASDYTKKPVVWSCDSPRTREGFYHYRAGFPAATKRAKEFAPYADLLW
FT                   VETGDPNVEKAGKLASDVRAAYPGKKLVYNLSPSFNWMGQGFDEASLKSFVWDLAKHGF
FT                   VLQLISLAGLHSNATITTELSRAFKDEGMLAYVRLIQSREKELGVEVLTHQKWSGAPYM
FT                   DGILGAIQSGSSSSKSMGEGNTEKGKLSIHFDLLAINANNPKLQASKQIPRHGRIIIMP
FT                   SVLLDRCRDKKKSP"
FT   CDS_pept        join(complement(592672..592740),complement(592097..592582),
FT                   complement(591719..592039),complement(591373..591667),
FT                   complement(591294..591322))
FT                   /codon_start=1
FT                   /gene_family="HOG000201950" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902861"
FT                   /orf_name="AFUA_6G02870"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="cell outer membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85751.1"
FT                   /db_xref="GO:0009279"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG056303"
FT                   /db_xref="HOGENOM:HBG326957"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniParc:UPI000051F8C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCY7"
FT                   /transl_table=1
FT                   /translation="MGRTVDQEVHAAFVEFRAKEDDKCLSVQCIYCQQIRAKNTSRQKQ
FT                   HLLECPGLRGQNQTAQTAPNGIGGANGYSATPNGAAATAPGAGPGGPGTAALPTPNGPM
FT                   MTNGVNPHATSMQTPLQNMQGRAALPTPGPPTGPASATSSHQPTRATPKSKTKASTSNL
FT                   PAPPLDDVHAAFVEFRAKEEDKCLSVQCIYCQQVRAKNTSRQRQHLLECPTYLSVMKDS
FT                   IPANNLLHTFPEGDIARSLQIPAPTLELDFRMSIKMNPKVVVGPSIWGQRDWVTFIGGQ
FT                   WAGRWGKGIVLPGGQDSQIVTKESVTHMRSNYVLQTADDPPAFIIVKTEGWLTGAKDVL
FT                   DKVNDPNIADTINPNTYKYRLNLSMETGDERYAFLNTLMWVASGCRRGHEVIFDAFRVN
FT                   "
FT   mobile_element  complement(593496..594332)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(594410..595006)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(594413..595003)
FT                   /mobile_element_type="transposon:mariner_ant1 transposon
FT                   family"
FT   tRNA            complement(596153..596224)
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        join(complement(599384..599402),complement(599248..599284),
FT                   complement(599050..599190),complement(598850..598984),
FT                   complement(597649..598774),complement(596808..597575))
FT                   /codon_start=1
FT                   /gene_family="HOG000201939" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056126"
FT                   /orf_name="AFUA_6G02900"
FT                   /product="Rad21/Rec8 N terminal domain protein "
FT                   /protein_id="EAL85748.2"
FT                   /db_xref="HOGENOM:HBG056301"
FT                   /db_xref="HOGENOM:HBG325066"
FT                   /db_xref="InterPro:IPR006910"
FT                   /db_xref="InterPro:IPR023093"
FT                   /db_xref="UniParc:UPI0000F51CD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ0"
FT                   /transl_table=1
FT                   /translation="MFYSHEILTSPEHGIATIWLVATLGSRSITRRLNKKAILDVDVPK
FT                   ACEVIMDPAAPMALRLQGNLLYGVARVYDQQCRYTLTDVQAMHDRLRSMLGAIPGTALD
FT                   PTAGKARFEQLILPYDPSFLPENNLPGLRMDFFELNLPKNDRESQQSSFQFPMTPDLSL
FT                   TAASRTSSLQLDFGSQDLILRDIHGFSSESEMTNSVQRSVQRGRIAVTALNDEEGILLQ
FT                   PDFDFDEDGNLIELGGLNAAAEVGKRSSGWLDTDIPVTDEVKEGELDDISWDYQVQFTQ
FT                   DGLLFLLTISPQPMLADEDMQAITEHGQPNPIFNRDTSMPQAPEERYPEDVENVSGTRE
FT                   APMRRTRRIPKAVPTDAQNALRNTELAQYNSEYVQNMAAALKKKLKNRVPAQAKKNAEF
FT                   WVFGLGIGSVGVGLGTSLVQHPLHFFSGETLYASLTSVKRSKKRKGSPSTTEDSDADSE
FT                   TRRIRRREESEEQLGRGGLFQDNNNFQDDLEFGRHVSSVLRDDSSQMPWNITASVRSSR
FT                   LGLSATSIFRGFGSISDFSARGIHDSAASVPPLAATGRVRSRLTSASPLAGRGFHYDLE
FT                   GLAIPGTQEDDVNFLEEIDLVGYLQSEFDVRTKAEPKDETDRKRAAFRDRLLKSSMDQE
FT                   SLNFLDFLNLQLEEPAGDPAAQDTVHETGAGFLRLDVSDGKEVAFSTLLPRETTSRTVA
FT                   THGLMHILTLATKGFLSVYQEPYEDESTEEYGVRYEFGEIYLRLSDM"
FT   CDS_pept        join(complement(600904..603327),complement(600587..600827),
FT                   complement(600472..600527))
FT                   /codon_start=1
FT                   /gene_family="HOG000201928" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263277"
FT                   /orf_name="AFUA_6G02910"
FT                   /product="Acetylglutamate kinase, putative "
FT                   /EC_number="1.2.1.38"
FT                   /function="N-acetyl-gamma-glutamyl-phosphate reductase
FT                   activity"
FT                   /function="NAD or NADH binding"
FT                   /function="acetylglutamate kinase activity"
FT                   /biological_process="arginine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="EAL85747.1"
FT                   /db_xref="GO:0003942"
FT                   /db_xref="GO:0003991"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056300"
FT                   /db_xref="HOGENOM:HBG326956"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011241"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="UniParc:UPI000052021B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ1"
FT                   /transl_table=1
FT                   /translation="MLVDKMFSLRTTVRRASTSKPLRALSAPHAVSSARLSSPRHALKA
FT                   SAVPLLQSRSYSRAADPHLSSTRSTVVQLLSNIGSKREVQQYLSHFTSVSSQQFAVIKV
FT                   GGAIITEHLQTLSSALAFLNHVGLYPIVVHGAGPQLNRMLEAAGVEPHFEDGIRVTDGK
FT                   TLALARKLFLEENLKLIEELERMGVRARPINAGVFYADYLDKEKYNLVGKINGVNKKPI
FT                   ESAIEAGCLPILTSMAETPDGQVLNVNADVAAGELARALQPLKIVYLAEKGGLFNGDTG
FT                   EKISVINLDEEYDHLMTQWWVRHGTRLKIKEMKELLNDLPRTSSVAIIHPADLQKELFT
FT                   DSGAGTLIRRGNKVHTKTSLSEFEDLEKLKDVLVRDREGLDARATVDRYVEGLKERDFK
FT                   VYYDEPMEALAVVLPPSKDNSSSFPHLATFTITKSGWLSNVADNVFAAIKKDFPQLVWT
FT                   VKENDENLTWFFDKADGSLSRDGEVLFWYGIESGEEVKQLVQEFNQHGRQMFGDINLEA
FT                   RLQRAAQAATNIGKGFGASGASVEQKRAFSSTANALRAARFGRPAVSPRVVRSYSTTNP
FT                   NPPLGEKNMSNNRPSKVALIGARGYTGQALINLLNAHPYMDLRHVSSRELAGKKLQGYD
FT                   KREIIYENLSPEDVKRMSANGDVDCWVMALPNGVCKPFVDAVDQGSETGNVIVDLSADY
FT                   RFDDKWTYGLPELVNRGKIAQATRISNPGCYATAAQIGIAPLVPYLGGQPTVFGVSGYS
FT                   GAGTKPSPKNDVQNLTNNIIPYSLTDHIHEREISAQLGTSIAFIPHVAVWFQGIHHTIS
FT                   IPLNQEMTSRDIRNIYQERYAGEKLVKIIGEAPLVKNIAGRHGIEVGGFAVHSSGKRVV
FT                   VCATIDNLLKGAATQCLQNMNLALGYGEYEGIPLE"
FT   CDS_pept        join(complement(605275..605385),complement(604822..605053),
FT                   complement(604728..604750))
FT                   /codon_start=1
FT                   /gene_family="HOG000042711" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750834"
FT                   /orf_name="AFUA_6G02920"
FT                   /product="SNARE protein Snc2, putative "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85746.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG386095"
FT                   /db_xref="HOGENOM:HBG519078"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR016444"
FT                   /db_xref="UniParc:UPI00005206C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ2"
FT                   /transl_table=1
FT                   /translation="MSEQPYDPYIPSGSNGPSASAGSAAQNGDPRTREIDRKIQETVDT
FT                   MRSNIFKVSERGERLDSLQDKTDNLAVSAQGFRRGANRVRKQMWWKDMKMRVCLVICII
FT                   CLLIVIIVPAVVTTTKH"
FT   CDS_pept        join(complement(607194..607434),complement(607003..607130))
FT                   /codon_start=1
FT                   /gene_family="HOG000048644" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263278"
FT                   /orf_name="AFUA_6G02930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85745.1"
FT                   /db_xref="HOGENOM:HBG056299"
FT                   /db_xref="InterPro:IPR012420"
FT                   /db_xref="UniParc:UPI000051F8C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ3"
FT                   /transl_table=1
FT                   /translation="MATVFRYAHLTTLSFSLNSGTVICVGGPAFVQSIRPTDEELFKRY
FT                   NPDLQKRSLEEGDRRAREFDEYVTRLKQWSKSDKSIWFAAQEQQEQKRAETESQRSQAK
FT                   EEARLQREEMRKELLGEK"
FT   CDS_pept        join(609718..610050,610136..612290,612361..612491)
FT                   /codon_start=1
FT                   /gene_family="HOG000201917" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263279"
FT                   /orf_name="AFUA_6G02940"
FT                   /product="Chitin synthase activator (Chs3), putative "
FT                   /function="binding"
FT                   /protein_id="EAL85744.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG056298"
FT                   /db_xref="HOGENOM:HBG326953"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0000520934"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ4"
FT                   /transl_table=1
FT                   /translation="MALALHHEDPRRQLRCKTGLMAKHTMTTTMGLVVTEVTTTPGTIT
FT                   PTIELFRDLMGPRAALRDPLVEVMVLLQSSLMIEAMPIMDDHPPAPTVVAATETGGHLQ
FT                   GRTARDRERMAWDNPFPTFPAQEARGPPGTRGLEKGMAAMKLNGQMPPGNVPERPHTSH
FT                   GRRDVPRQASSTSPGRGMGGYPGGPMRSASAGRSGRRPSDAYERSYTSASEPPPVPYIN
FT                   RSATMPVHSASPSSSVAQPTYPGQPTYQDPNSSNDYSDTDELLSYYRTAHTDESDMPNF
FT                   DAIPDGGKVIDENLPGLEQPKPKARAPADPAASSQGQYAAFNPHSGSTNQYPLSQHNVA
FT                   GDGTPNQFDSAGFQFDLPGNPPSASPVRTQGSVDHGYNGQQDAYEGPLNNQYMEQQGSG
FT                   GPAVAAYENGPPRPYRVNQPEYANQQPEMVNEMNELDSQQNPDGLPRHPAPFRPGHDQG
FT                   SKPPPVRQYDNSNTTGSPTSTVPQAQPIAQPDPAPAPVTHQELERLQQVVRSKAADQKT
FT                   QLLLAQKLVEASTVLVENSRMDPKTKARAREKYIMDAHKIVKKLVSSGYADAQFYLADC
FT                   YGQGLLGLPVDPKEAFNLYHSAAKQGHAQSAYRVAVCCEIGQEEGGGTKRDPFKAVQWY
FT                   KRAASLGDTPAMYKMGMILVKGLLGQAKNPREGVSWLKRAAERADPENPHALHELALMY
FT                   ANATDNDVVIRDEAYACQLFHQAAELGYKFSQFRLGAAYEYGLMGCPVDPRQSIFWYTH
FT                   AAAQGEHQSELALSGWYLTGSEGILQQSDTEAYLWARKAATAGLAKAEYAMGYFTEVGI
FT                   GVAANLDDAKRWYWRAAAQGFPKARERLEEIKKGGARMQKTRLSRSTVNRQQNEGDCVL
FT                   M"
FT   CDS_pept        join(613387..613686,613745..613917,613973..614133,
FT                   614241..614662)
FT                   /codon_start=1
FT                   /gene_family="HOG000236849" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263280"
FT                   /orf_name="AFUA_6G02950"
FT                   /product="Aromatic ring-opening dioxygenase LigB subunit,
FT                   putative"
FT                   /function="ferrous iron binding"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /protein_id="EAL85743.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0008198"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="HOGENOM:HBG058265"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniParc:UPI000051FFDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ5"
FT                   /transl_table=1
FT                   /translation="MSTSADTHPPSTSNQHTSKKLVILSLASLLVAILLAAFGYGLSTE
FT                   NTNTNITAKLFGLRRLFGTQSAAAAAVKRDISTSSAIPKSGSTMKTPVYFLSHGGPNIM
FT                   YEQDHPAYRKLSEIGREITTKVKPRAVVVFSAHWQAGRDTIQVNTAEMTDLIYDFYGFP
FT                   SHYYKEKFPNVGSKEIANKVLSALKEAGIKAEGVKRGLDHGVWASFKCVQVSLFNTEDP
FT                   AQHYRLGQAVSKLRDDNILIIVSGMAVHNLRDLQFTWGNPKPMPYTTSFDEALKDAVTK
FT                   PPAEREQAMSDLLKRPDARQAHPSFDHLLPIHIGAGAAGDDLGKRLWTLKEGSMSWAQY
FT                   RFGDVGNNSAL"
FT   CDS_pept        join(complement(615205..615290),complement(615029..615135),
FT                   complement(614925..614957),complement(614806..614864))
FT                   /codon_start=1
FT                   /gene_family="HOG000201916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902862"
FT                   /orf_name="AFUA_6G02960"
FT                   /product="NADH-ubiquinone oxidoreductase 105 kDa subunit "
FT                   /protein_id="EAL85742.1"
FT                   /db_xref="HOGENOM:HBG027451"
FT                   /db_xref="HOGENOM:HBG464594"
FT                   /db_xref="InterPro:IPR007741"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR016464"
FT                   /db_xref="UniParc:UPI000051EA7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ6"
FT                   /transl_table=1
FT                   /translation="MSSKYAFSKGLKELRFLFCQTSEQSAATRSFLQRAYPTMKKHNPQ
FT                   TPILIREAAGTLPRVYARYGFGKEKQESLSGLSDQQIEEKVSQLVKESS"
FT   CDS_pept        join(615788..615987,616062..616077,616211..616347,
FT                   616407..616593)
FT                   /codon_start=1
FT                   /gene_family="HOG000188910" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902863"
FT                   /orf_name="AFUA_6G02970"
FT                   /product="UPF0041 domain protein"
FT                   /protein_id="EAL85741.1"
FT                   /db_xref="HOGENOM:HBG056296"
FT                   /db_xref="HOGENOM:HBG627499"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniParc:UPI000051EF10"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ7"
FT                   /transl_table=1
FT                   /translation="MSSSRIGLRFFQNTRAAFRNAYGPFRRPGAQGRRFQTSDAGAASA
FT                   QQQSTFQRLWNSPVGIKTVHFWAPVMKWALVIAGISDFGRPAEKLSLTQNAALMATGAI
FT                   WTRWCFIIKPRNILLAAVNFFLGCVGVVQVTRIFLYRRSLEGGSTKEALKDFEHEMVDS
FT                   AKSVVGKAEAAVKKST"
FT   tRNA            617113..617210
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        join(618875..619184,619241..619607,619659..619717,
FT                   619738..619928,619980..620168,620220..620321,
FT                   620371..620445,620497..620532)
FT                   /codon_start=1
FT                   /gene_family="HOG000217379" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750835"
FT                   /gene_name="pgaX"
FT                   /orf_name="AFUA_6G02980"
FT                   /product="Probable exopolygalacturonase X "
FT                   /EC_number="3.2.1.67"
FT                   /function="galacturan 1,4-alpha-galacturonidase activity "
FT                   /function="polygalacturonase activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="pectin catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL85740.1"
FT                   /db_xref="GO:0004650"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0045490"
FT                   /db_xref="GO:0047911"
FT                   /db_xref="HOGENOM:HBG056295"
FT                   /db_xref="HOGENOM:HBG332070"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000051FB50"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCZ8"
FT                   /transl_table=1
FT                   /translation="MKFSYSFVQVVTLLLSLSPSVEGFTRSRNDACKPNHPFRPLPPSQ
FT                   PRTKTCHVVSNGHGKDDSKNIMKALHKCNNGGKVVFDANKVYTVGTALDMTFLKHIDLE
FT                   VLGKIQFTNDTDYWQANSFKHGFQNATTFFQLGGEDVNVYGGGTLDGNGQVWYDLYAED
FT                   ALILRPILFGVIGLKGGTIGPLKLRYSPQWYQLVANSSDVIFDGIDISGYSSSKNEAKN
FT                   TDGWDTYRSDNIVIQNSVINNGDDSRNKLTEYADCVSFKPNSTNILVQNLHCNGSHGIS
FT                   VGSLGQYKGEVDIVQNVLVYNISMYNASDGARIKVWPGVSSAMSEDLQGGGGLGSVKNV
FT                   TYNQMYIENVDWAIEVTQCYGQKNLTLCNEYPSNLTISDIHFKNFRGTTSGKRDPNVGT
FT                   IVCSSPNVCSDIYAENIDVKSPKGTDNFVCTNVDKSLLDVNCA"
FT   CDS_pept        join(620894..620930,620986..621327,621390..621620,
FT                   621693..621913)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056127"
FT                   /orf_name="AFUA_6G02990"
FT                   /product="Short chain dehydrogenase/reductase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85739.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056294"
FT                   /db_xref="HOGENOM:HBG325065"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000F51CDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ9"
FT                   /transl_table=1
FT                   /translation="MASKRRTSIIVTGGASGIGLGITRHFAPQPNTHITILDVTDGTPI
FT                   LNQLGTEYPSASLSFAQCDVSSWESQAAAFEKVIAEQGHIDIVFANAGITQKGDLLANI
FT                   HDVKPSKPELRTLDVNLIGVIYTVKLAAHYMAKNAPRGLGSGLSKGSIICTASNAGIYP
FT                   FPTAPLYAATKSGVIGLVRSLARPLEREQIQINALAPAVIETNIAPDSALFRSMILTPM
FT                   STATRAVAQLVGDASLTGKVLELHGEEVTFAEPPAYIDEDTGTNIEMFWKLGYA"
FT   CDS_pept        join(complement(624608..624698),complement(624214..624493),
FT                   complement(624036..624109),complement(623043..623980),
FT                   complement(622898..622989),complement(622556..622842),
FT                   complement(622125..622504))
FT                   /codon_start=1
FT                   /gene_family="HOG000217793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263281"
FT                   /orf_name="AFUA_6G03010"
FT                   /product="C2H2 finger domain protein (Zms1), putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85737.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056292"
FT                   /db_xref="HOGENOM:HBG325064"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000F51CE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD01"
FT                   /transl_table=1
FT                   /translation="MKPDSDKHFRCTICQRGFTRIDHLKRHHLRHSGIKPYSCIFCNDS
FT                   FARWYAALFVIFSQNEMCQLRSPLGTFCCSAHRASTLTFARDHAAATTFVTTTPIARKG
FT                   GIGRSLIRDSEGEGDMLANRSCQKRGIECNNERKKQVSNQGTGSDALAAKREDYEQSSD
FT                   RGSIKFLLNGGTDSFTQQFLLPPRSDRTRSLEYHNKKSLEDAGSSILGYELKDSRTDYA
FT                   PTFIESDAATLSFFQDTFIDFFNGPFGDPHKLLDDPYVGQVAYHAVVPPGQDPNLTLTG
FT                   QQLSYEPERPFATGMIQAILARAWSVPLDAKAQQELSTNLNFLLTTSRIRKFVAMYFKY
FT                   WQPSCAMLHRTSFDPEIVSLPLLTAVTFMGAMYTNDEREAYIAKRVLDFAELFIFSSEV
FT                   YASETEISSMFCGNRCLDDESSDWIQFQNFQAGFIIVVVQYWAGSRISRNRVMENRFSE
FT                   VIKVARRIGLMKCRHMPHDPMDECSWIQKECRIRTMNIISLLDCAFSFYSNYPCRISHT
FT                   EMEWDFPCQEVIFDSQHPFVEPNFRFSRDIPISAGFNNLFETPISEDGSQAHVPDHIAD
FT                   MTVLDMFILIHLLYAFINTHMTLLAPLVHKTPLPNSRIPQGLSTPSKPPQSAIPEDSTL
FT                   AGIRTALSRWRDHWLALRNTVSSHEWASMGFYKNGYNFWLVSQLLITKKKSVDVVMQME
FT                   VKCEDKLEKLKVLLQDEND"
FT   CDS_pept        join(complement(627129..627384),complement(626866..627059),
FT                   complement(626650..626814),complement(626431..626599),
FT                   complement(626307..626375),complement(625561..626253),
FT                   complement(625304..625503))
FT                   /codon_start=1
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263282"
FT                   /orf_name="AFUA_6G03020"
FT                   /product="Flavin-binding monooxygenase, putative "
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85736.2"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG300397"
FT                   /db_xref="HOGENOM:HBG655952"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI0000F51CEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD02"
FT                   /transl_table=1
FT                   /translation="MKQFFFGSDSKSRKPRPVEDKWIVEERSIDKARPLRVVIIGSGIS
FT                   GIIASIRFRQRIPNVDLCVYEKNEDIGGTWLENRYPGCACDIPAHTYQATFEPNKEWST
FT                   FYAAAPEIHAYWKRVAEKYGCMKYIKLKQAVVEAVWDDSKSKWQLKVQDIQTDTVYTDE
FT                   CNILISATGALNSWKWPDIPGLHDFKGKLQHSARWDESYDYTGKRAAVIGNGSSGIQIV
FT                   PGMLPKVAHIDHYIRGRTWLSPTFARQHVDKRGGAELENFSFTPEEIETFKKDHSAYQR
FT                   FRKEIELELQSVHGVTLLGTPEQIGAREVFLQNMKRRLSRKPEMCEDLIPSFPPVCRRL
FT                   TPGPGYLEALTDDKVDVITSKIVKVDAEGIITADGQHHPTDVLVCATGFDTTFNPRFPV
FT                   IGRNGVTLANRWQKTPETYLSLAVDGFPNYFICLGPNAALGEGNLLLLIEKEIDYFTLC
FT                   VQKMQRDNIRAMSVKKEAVEMFTRYCDQYFSRTVFSEKCRSWYKGGTEDGRVIALWPGS
FT                   SLHSMKALAHPRWEDYTYDYVNDNPNGWLGDGWTENEKLKKINVDYLNDDEIDFPTNVI
FT                   AVLDQ"
FT   CDS_pept        629031..629639
FT                   /codon_start=1
FT                   /gene_family="HOG000217794" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750836"
FT                   /orf_name="AFUA_6G03025"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27240.1"
FT                   /db_xref="UniParc:UPI0000F51CCA"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA22"
FT                   /transl_table=1
FT                   /translation="MHSTSSSEGTSSGQSTLQIHIDELSSLPLHDTIQSLVHLLPELTT
FT                   SITPTGERLVTHPTYEGTGKLDDLGALYLRAADRCTRERASFKTRLLHISLDSMIEALY
FT                   ASSQEQLDKGLEDGTVHLPPRLDGGCACCNGEPFAVILSGFHEGNALLFWEDEYKAFWG
FT                   EEESLGGRYGLGETWIRASKEQVERAMAREEVNVNPSMP"
FT   CDS_pept        join(630208..631321,631381..631403,631456..631918,
FT                   631972..632360)
FT                   /codon_start=1
FT                   /gene_family="HOG000251017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750837"
FT                   /orf_name="AFUA_6G03030"
FT                   /product="Phenol monooxygenase, putative "
FT                   /EC_number="1.14.13.-"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EBA27239.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327146"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="UniParc:UPI0000F51CF2"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA21"
FT                   /transl_table=1
FT                   /translation="MPVFTEYAASSRELRVLPSFAPPLPRLSPRFTRPEGIEKYEVVIV
FT                   GAGPAGLMLHLLLARYGLNDDSLLCIDAKPGTLKSGQADGLQPRTLEVLKSLGLADEIL
FT                   TDGCHMEEVAFWNPSPDKEKVIERTSIVPDVAVPARFQHEVTIHQGRIERILETDLLRY
FT                   SKRGVQRNTKLVDVKIDEAGDAEFPVVAEIETDGTRRTIRSKHLVGADGAHSVVRRCMG
FT                   LKLVGESMDHIWGVVDLVVDTDFPDIRRRCAIHSPAGSVMVIPRERIATGDYLTRLYVQ
FT                   VPQETPPEESQKPVNGTTAQSKGDTRARRSQVTQESIFRHAAQAFKPYYIRPKEEGAVD
FT                   WWAAYQIGQRVTDNFTVKDSKGINRVFIVGDACHTHSPKAGQGMNVSMMDSYNLAWKLA
FT                   YSLHGLTPSSAVPGQSDAVVDTYHSERHTIAQELIAFDRAFSSMFSGKIGPSEDGVEGL
FT                   THEQFLEVFSTGNGFTSGCGIEYPGSLMVDKASDDGVENPIKGTDYLSGVLRPGRRLLD
FT                   VRCKRHADGNRRHLHDDFLSTGRFRILCLTSSDLLDPKGVSAQVLTSLGSSVLPRFPPN
FT                   VIEQVVIHPRLGKTFMWQDVPNELKKHSEMRFYSGYALDDVYKIYGVDETRGALAVVRP
FT                   DGYVGMVAGLADLERVQEYLERCIRTI"
FT   CDS_pept        join(632991..633425,633488..633877,633930..634931)
FT                   /codon_start=1
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263283"
FT                   /orf_name="AFUA_6G03040"
FT                   /product="MFS multidrug transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL85734.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F667"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD04"
FT                   /transl_table=1
FT                   /translation="MTQDEDKKTENSRSRSTSVNSTDDSQHLSPTSSRESERSRSLRVL
FT                   SITRTRSESRPRRGNLDRVYSGRHLDDQSVYHSDDDVPKAHAASLPREDDDEKQGSAVL
FT                   EVRGGILNERDTDLEEGTRDQSALEKSRTAKSDRSRRDPKLVTWDGPDDPENPKNWPNK
FT                   KKWAAIITVSLFTFISPVSSSMVAPALPSIASDFHIEDQVSSQLTLSIFVLAYAVGPLF
FT                   LGPLSEIYGRVIVLQLSNLFYLVFNIACGVSRTKGQMIAFRFLSGLGGSAPLAVGGGVL
FT                   SDCFKPEERGKSVAIYSLAPLLGPAVGPIVGGFISQDTTWRWVFYATSIADGAIQIGGL
FT                   FFLRETYAPKILKRRAERIRKETGDSAYQTETERQNKTLSQTMQTALVRPFRLLSTQPI
FT                   VQVLALYMAFIYGTMYLVLSTFSSLWTRVYNESTGIGGLNYISLGLGFWLGSQLCAPLN
FT                   DRIYRRLKARNNNIGRPEFRVPLLVVGAFLTPVGLFIYGWTAQFRRHWIAPNIGACLFG
FT                   AGNIIAFQCIQTYMVDTYTRFAASALAAVAFLRCICGFAFPLFAPYMYNALHYGWGNSL
FT                   LAFVSIGLGIPAPIFLWKYGEILRKRSPYAAG"
FT   CDS_pept        join(636046..636099,636151..636928,636987..637345)
FT                   /codon_start=1
FT                   /gene_family="HOG000201905" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263284"
FT                   /orf_name="AFUA_6G03050"
FT                   /product="Oleate delta-12 desaturase "
FT                   /EC_number="1.14.99.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85733.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG041665"
FT                   /db_xref="HOGENOM:HBG559049"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniParc:UPI000051FDAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD05"
FT                   /transl_table=1
FT                   /translation="MAGKMAEVRQRDVQTETEVVQDSIPSLKSLKDAIPKECFESSLAI
FT                   SFLYLARDILYCAILTYGAFHIHLLPSLPLRVLAWATYGFFQGCVGTGMWILAHECGHG
FT                   AFSPYQGINDFIGWATHSFLLVPYFSWKITHARHHRYTGHMEKDTVFVPWTDEQLAKKR
FT                   NVRIEQLKHFAEETPIVSFLQLIGHQLGGWQLYLLTNATAGAQSWPEGKPKTGPASHFN
FT                   PVGALWTPSQRLSIAISDLGLLIMAAVLYYASTQIGAWNVVLLYFVPYLWVHHWLIAIT
FT                   YLQHTHPSVPHYTPEAWTYTKGALATVDRTMGFIGRHFFHEIIDYHVVHHLFSRIPFYK
FT                   AEQATWAIQPLLGAQYHEEKEQSFLGSLVTTFRKCIYVSATGQPGVLHFVKADEGN"
FT   CDS_pept        join(643419..643586,643661..644397,644457..644859,
FT                   644937..645224)
FT                   /codon_start=1
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263285"
FT                   /orf_name="AFUA_6G03060"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85732.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FB59"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD06"
FT                   /transl_table=1
FT                   /translation="MSDVGVDTSRVEAPVTWKTYMMCAFAAFGGIFFGYDSGYISGVMA
FT                   MDYFITEFEGLDKATTPADLFVIPSWKKSLITSILSAGTFFGSLIAGDLSDWFGRRTTI
FT                   VAGCAIFIVGVVLQTASAATALLVVGRLIAGFGVGFVSAIIILYMSEIAPRKVRGAIVS
FT                   GYQFCITIGLMLASCVDYATQNRTDSGSYRIPIGVQIAWALILGAGLLLLPESPRYFVK
FT                   KGDLTRAAEALGRVRDQPRDSELIRSELAEIVANHEYEMQAIPQSGYFGSWFNCFRGSL
FT                   WNPNSNLRRTVLGTSLQMMQQWTGVNFVFYFGTTFFKSLGTISDPFLISMITTIVNVCS
FT                   TPISFYTMEKLGRRTLLLWGALGMVVCQFIVAIVGTVDGSNKSAVSAEISFICIYIFFF
FT                   ASTWGPGAWVVIGEIYPLPIRSRGVALSTASNWLWNCIIAVITPYMVDTDKGNLKAKVF
FT                   FIWGSLCACAFVYTYFLIPETKGLTLEQVDKMMEETTPRTSAKWKPHGTFAAEMGLTDK
FT                   DMAEKTAEVVHQEV"
FT   CDS_pept        join(647076..647322,647378..647530,647581..647723,
FT                   647771..647936,647986..648407)
FT                   /codon_start=1
FT                   /gene_family="HOG000216897" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056128"
FT                   /orf_name="AFUA_6G03070"
FT                   /product="Extracellular dioxygenase, putative "
FT                   /function="ferric iron binding"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85731.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0008199"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053364"
FT                   /db_xref="HOGENOM:HBG757944"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniParc:UPI000051FFE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD07"
FT                   /transl_table=1
FT                   /translation="MVQLASTLVAAVAGLASVSLAHPGHNVKAEAAERAAFLKRSNIAR
FT                   SWGDCAAKLKARGLESRSIARREHAVEMLRRSKGLETRAPFLKARDLTTVLNTSHESSL
FT                   NVDLSTDPSVLFSSNATCVLASDVTQGPYYVSGELIRSDITENQAGVPLYVDVQMVDSS
FT                   TCEPVTGVYLDFWHCNATGVYSGVVASGNGNSNDDSNLDATFLRGLQKTDKEGVAQFQT
FT                   IFPGHYTGRTTHIHVLTHSLNETTVNANNTLQALYTAHSAHVGQIFFDQDLISTVEKLS
FT                   PYSTNTQELTTNDEDSILAEEADIIDPFVEYVFLGDSVSDGIFAWISLAMDSSKSSSVT
FT                   PAAYYTEDGGVENSSSGGSGGPGGSGSGGPGGAPPS"
FT   CDS_pept        join(648931..649202,649250..649906,649956..651366,
FT                   651417..652940)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263286"
FT                   /orf_name="AFUA_6G03080"
FT                   /product="ABC multidrug transporter, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85730.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000051EA74"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD08"
FT                   /transl_table=1
FT                   /translation="MLDMEKNQELRPDEVEEAPKPSGLRSYMRIFNYADRTSRILYAIA
FT                   MVAAIAAGSALPLMDLVFGKFVTTFNKFALGTVGPDDYMREVSKYALYLVYLFIAKFVL
FT                   VYIHTAAASIAAIRATKALRLDFLHSLMRQDMSYFDSNAAGSPSVKVTTNGNLVTNGLS
FT                   EKLSVFVQSCATFIAAFVVAFAVQWKLTLITVCIVPTIVIVTGICMGIDVKNEDKLMGI
FT                   YSRASLVAEEVFSSISTVHAFWLQPVMAKRYEDHLAELERVGMKKSPNYGVLFSTEFFC
FT                   VYAGYGLAFWQGIRMYARGEVHEPGDIVTVIFAVVVAATALTQVAPQIITITKAAAAAD
FT                   ELFRVIDKQSAIDSLSISGLAPETCVGEIEIKALDFAYPSRPDTQVLNGLNLSVPAGKT
FT                   TALVGASGSGKSTIVGLLERWYDPAAGTILLDGIEIQKLNIAWLRTQVCLVQQEPVLFS
FT                   GTIFDNVAFGLEGTSYAEAPYEQKLALVKEACRDAYAHEFIENLPRQYETQIGERARML
FT                   SGGQKQRIAIARSIVSRPSVLLLDEATSALDPKAEKIVQSALDNISVGRTTITIAHKLS
FT                   TVQKADNIAVMSAGRIIEQGTHQELIARDGAYARLVRAQDLEKADGKAQEQTDSDEETT
FT                   EKDDATSAAKLSLHQTRSVGAESLSADDKAKTAAKETMGYSLIRCLWLLIKEQPQLWGL
FT                   YSLVAIACILGGQCAQNISQTLPLTNGRGTFPAQAIILARTLQVFQLSGSEAVRRGDFW
FT                   ALMFFVVALANLFIYFLLGWMANVIIQKVGRRYRRELFRNTMKQEIAFFDLEHNATGAI
FT                   SSRLLIHASNLNELLGINSGLILINIVTVISVSVLGIAYGWKLGLVCVFGALPPLLLSG
FT                   YFRIRLEYKLEEDTSARFASSAAIAAEAISAIRTVASLTLENKLLQIYRERLTAVAEQS
FT                   VKALTFTMFWYALTQSINFLAMALGFWYGGKLISTGEYTNEQFFVVFTAVVVGGENAAA
FT                   IFQYTTSITKATGSTNYIFWLRQRVPAIDNCFSDEPPSDGSQDPGPVTVDCHALDFAYP
FT                   SRPRSNVISGIDVSIPPGKFVAFVGPSGCGKSTMINLLARFYDPTSGYIAVNDRPIHDL
FT                   SPQDHRRRLALVQQEPVLYQGSIRENVAMGMVESRDATEAQIEQACKDANIFDFVISLP
FT                   DGLNSEVGPRGTKLSGGQRQRVAIARALIRDPKILLLDEATSALDTESERIVQAALSEA
FT                   ANDGKRSTIAVAHRLSTIKDADCIFVFRAGRIVEAGSHAELLETRGSYYEMCRGQALDK
FT                   ALG"
FT   CDS_pept        join(complement(653523..654612),complement(653049..653473))
FT                   /codon_start=1
FT                   /gene_family="HOG000170996" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264284"
FT                   /orf_name="AFUA_6G03090"
FT                   /product="Cytochrome P450 alkane hydroxylase, putative "
FT                   /EC_number="1.14.14.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, reduced flavin or flavoprotein as one donor, and
FT                   incorporation of one atom of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85729.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016712"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051262"
FT                   /db_xref="HOGENOM:HBG397671"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002402"
FT                   /db_xref="InterPro:IPR002974"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000051E5B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD09"
FT                   /transl_table=1
FT                   /translation="MHLILHPKTLILLLAVLVTIVCISIRRFLARRQFARQHGCQPVAR
FT                   SLNKDPFLGLDTIPETLRAASQHRILERSVELFRLYGNTFTVKELHKYAILTIEPENIK
FT                   TILSLNFKDYGLSHRLQPFKPLLGEGIFDTDGAHWASSRALIRPSFTRGQVADLTALED
FT                   LMQDLFALLPRDGQTVVDLQELFFRYTIDSATEFLFGQSVGTLRKTPSELGFAQAFHYA
FT                   QKAIITRGMLGPLAVFYRDRKADECNRVCRAFVQRFVDDAFRAAENNGEKTPDGTKRQK
FT                   RIFSHELAARTSDKRRVLDELMNVLVAGRDTTASLLGNLFFVLAKKPEIWEKLRAEVAC
FT                   LQGRTPTYDELRSLRYVQCCVNESLRLHPVVPRNERQAVRDTVLPLGGGSDGLSPVFVP
FT                   KGTIVSYNVYVMHRRPGLYGPDAEEFRPERWEDGKLQPRWGYLPFNGGPRICIGQRYAL
FT                   TEVSYVLVRMAQEFRVLESRDPGPWEESLALTLCSRNGTRVCLVSG"
FT   CDS_pept        join(complement(656096..656110),complement(655260..656011),
FT                   complement(655059..655212))
FT                   /codon_start=1
FT                   /gene_family="HOG000201883" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264285"
FT                   /orf_name="AFUA_6G03100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85728.1"
FT                   /db_xref="HOGENOM:HBG056290"
FT                   /db_xref="HOGENOM:HBG331515"
FT                   /db_xref="UniParc:UPI000051F415"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD10"
FT                   /transl_table=1
FT                   /translation="MPPPPIYQLNPKQEQDTMALTNIPHINLLCMEERFIDAFQRALAQ
FT                   HWPETNTTPKPTITILNTSLRQVPSSTKFDLIVSPANSYGRLDGAFDDAISRVFCQPPK
FT                   HEYNTLTEATQKVLYKQWRGFAPPGTCTLVPFPDELIGENGWGCRWVAICPTMRYPDRV
FT                   TWDREIVYECVWSLLCQVEGWNRGCKKEKRIESILITPLATGVGKVSAAKWAAQFVLAM
FT                   RHFVDALRRPQRWAALSWGDLTAEVEEVKTTWELKRDGGILGQMWPELDASWYPNSRTV
FT                   MDIFERLMDIPWLPEFMIRKKSSDK"
FT   CDS_pept        join(656256..656305,656362..657259,657307..658296)
FT                   /codon_start=1
FT                   /gene_family="HOG000199911" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903116"
FT                   /orf_name="AFUA_6G03110"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85727.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056289"
FT                   /db_xref="HOGENOM:HBG328707"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051FB54"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD11"
FT                   /transl_table=1
FT                   /translation="MWPPLHLAKRCNKLKVRRLTTHHVCMALSGISTRVIPRNVTMDHV
FT                   RRYNVERSCLRCHQRKVRCDKGSPCAACVRMKVPCQYPGPNRVQRRPPKASSADVVSRI
FT                   DQLERAVTELIRRPSTASPIHDNEVNVTRAAAPERQLRQGLLVRDGRYIDEHLLSGFLE
FT                   KDQELQTAIGTPRSAGKSPGRQSPLRVEGLITNSLREHVDFQALQPSRWQAIQLWQTFL
FT                   GRVDPVVKILHIPSTQPRVFAAINQRGDALADTQALLFAICFAATTALHSDDPSREEIC
FT                   SDIRRYQQGFELALYRSSFLDTPTLISLQAMAIYQTCLRYHNSGRSNWTLHGLTTRAAQ
FT                   SIGLHRDGRHFNLSPLECELRRRLWWHIVTCDQRAAEDHGLSIIAHNEPCDTNLPSNLD
FT                   DQDLSATATVPPAPQPRWTEMTFPLLTIQINRHLHEISRKTSQGVSPDPLVRELKDYIQ
FT                   RNYLQYGDANIPIQQQGLVLADVLTTKVAVYVRQKALQIHSQGQSQCPPQESATAQETL
FT                   AMACHGLERALELQTNDLLRGFRWLTATYTQYHLLCYILWHLCVYPASVHVERAWRSVE
FT                   AIFEVVERDPTWPDPGPKWAVMSQLRAKAMRAREGLTNRQADVQEKGPENVLDWGNWDL
FT                   ELFGFGEWTI"
FT   CDS_pept        join(659721..659869,660967..661612)
FT                   /codon_start=1
FT                   /gene_family="HOG000048643" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751074"
FT                   /orf_name="AFUA_6G03120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85726.1"
FT                   /db_xref="HOGENOM:HBG056288"
FT                   /db_xref="UniParc:UPI000051EF0F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD12"
FT                   /transl_table=1
FT                   /translation="MTLQGDLLQMTLAISNGSHHCPHTRPRNTKQDVRRILDWPLDEAG
FT                   SSTIRWTLKGHESRNESPWEFFTTSAVTVFSYSLPTVMSDLPIPSWLDVSTASFLSTPE
FT                   DTTDTLDPRSLFPEEQVANNAPSYDNGSSGILCNASNALFADPLLYEDSFLPSEIHRQL
FT                   PVQFQAQQTNQMPPSLVASSPGFRSVSGGRGFRREMLQLESAPPRTITPSDPYLPTKPA
FT                   AAEQCPASNHTKATVKSNGSTHSAPRTRKRHVSIRSQLSHGN"
FT   CDS_pept        join(complement(664259..664367),complement(663878..664215))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264286"
FT                   /orf_name="AFUA_6G03130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85725.1"
FT                   /db_xref="HOGENOM:HBG056287"
FT                   /db_xref="UniParc:UPI000051E5B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD13"
FT                   /transl_table=1
FT                   /translation="MKHVAIPHVILGAIHQLSNISLFGGNPAIDLVDNDVENTRRISSP
FT                   PVTVTWSVCTVKVACGAKWATMASTSRSSTALKKLAGRDASRSRVRVMFGGLDVQIGKS
FT                   VITVGEFQMKIAVWIKWQIVKISGGLVPVLGKFNQQSAKVRYYQ"
FT   CDS_pept        664897..667260
FT                   /codon_start=1
FT                   /gene_family="HOG000217798" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264287"
FT                   /orf_name="AFUA_6G03140"
FT                   /product="Oligopeptide transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL85724.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG056286"
FT                   /db_xref="HOGENOM:HBG328266"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI000051E82D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD14"
FT                   /transl_table=1
FT                   /translation="MLDKMGRLSVFNRKRRAADGTTPSAGSNESLSPPATAAPLNDAEK
FT                   IKPVSETAAIEQETEQDPEVAALPLEVRQLVSLTDDPTLPTITCRYFLLSLLFVVPGAF
FT                   LSQMSHYRTTQAPYSVFFVQIACHYVGHFLARWLPAWTIRIPLTKWAFSLNPGPWSIKE
FT                   HVLVTLTAASGATYNLGYAPISMAELFYGERVHPAVAIFFMFAIVWIGYAFAAIARQIL
FT                   LYDPAFIWPQALMQTTLFETFRKQDTSSPLAKRQMKIFFFSLLGMTLWQFLPEYVFPFT
FT                   SSLAFLCWVAPRNPVANFIGSGMGGMGFLNLSLDWSNINWNGSSILLTPWWTQVVLFLA
FT                   FAFNCWVLLPAAKWGNLGSYKHGLMSNSLLTTNGTKYPILDLLTPDFRLNQTAYEEIGP
FT                   MYMGLQNVWATFFDYAKVTASVAWVATFGYSQVKGNLLKMFRSRDKTSQTKGEGINHQY
FT                   TDRLNVLQRSYQEVPLWWYLVLFMAGFIILIVSIACGYLWIPIWTVFVALGSAAALVLP
FT                   FAFLYAVSNYQLAVGSFNELIYGYMVHTKAGEGHRHPCGPSTYGSIAGDAWYRAQYMLQ
FT                   DQKIGHYMHIPPRTVFFSQVFGTVLGIPMNYAVMRWVLSTKRDVLTGAKPDPLHQWTGQ
FT                   SLISSNTLGVQYAVIGPAELFKQSEMRPLPWSFLLGALLPPVLYGLHRLLPRWRIDLWN
FT                   VSIFFSGLAVFYGNLSTGYTSAIIGGYVVMYWAYRKRFEVWKRYSYMIAAAFDAGFNLN
FT                   MLLIFLFFGSGKQISMPNWWGNNPDSVERCFALD"
FT   CDS_pept        join(668012..668188,668399..668706,668775..669582)
FT                   /codon_start=1
FT                   /gene_family="HOG000201861" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751075"
FT                   /orf_name="AFUA_6G03150"
FT                   /product="Putative uncharacterized protein "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85723.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056285"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniParc:UPI00005206CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD15"
FT                   /transl_table=1
FT                   /translation="MKTTTVASLLLAGTALGNPVHQKRDSVTAQVNFANNTGKPQHLAS
FT                   GILYGLPDTSNQIPTRFASALSNYKTSRQHGAKFIFLIHDLWGADGTQNSSAPYPGDNG
FT                   DWTSWDNYLTHLLSDIKANRMTDGLIIDIWNEPDLSFFWNRDQTQYLQMWGRTFHRLRS
FT                   ELAGVELSGPASAGEPLPGNNWWKNWASFVATNKSIPDQYAWHMEGGGGDLLSAQAGLV
FT                   YWQTTYGLPGRPININEYAVLDEEVPAGSAWWISQLERINAVGLRGNWLSGWKLHDFLA
FT                   SLLSKPNADNSNYDPTGTGYFPTGDYQVYKYYNLNMTGHRVGTLPSADLKLDAYAAVGD
FT                   DRVARVLVGVRIATGTWQLQLNQLSALGLPTSGTLNVHTWGFPVASNVHYGQVDGPKDL
FT                   GWYGHVYSGDSVTFPVYQTDTTSAYAFEFKI"
FT   CDS_pept        join(complement(673562..673885),complement(672346..673493),
FT                   complement(671485..672277),complement(669910..671430))
FT                   /codon_start=1
FT                   /gene_family="HOG000217799" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903117"
FT                   /orf_name="AFUA_6G03160"
FT                   /product="NACHT domain protein"
FT                   /protein_id="EAL85722.1"
FT                   /db_xref="HOGENOM:HBG056284"
FT                   /db_xref="UniParc:UPI000052045E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD16"
FT                   /transl_table=1
FT                   /translation="MEHPIANASKLKPEIRLGQALASFKAVLSTNRRARFDESIAAFKD
FT                   HPPDANDVNRLAAEINRDIQRTTRQCYGPRFVHVLQAVQQYASIGDVVVGGSQNLVASG
FT                   VWAAMLTQSASYLEKISMLFMNAGRSAPRYQDMALLYPRSKRLRDALCEYFIVILNICK
FT                   HAVDFLQKSPLSQFTSAISDSCLVSFEKDLQQWSVVIVEEVTLLSSQSLQEEARENSRF
FT                   RQIMVKLSDSRNRCQQVALRIRILDACSTYDYQTSWKQARKQGTTTWFASTSEYQRWKG
FT                   TPSSCALLCTGKLGSGKTTLLANVVDDLFCSASKGSVAYFFCRFDVSDSLTARTIIGCL
FT                   ARQLLAQQPIDLTKIDNFWNNSLADPDEQAIVKFVQKLLSVDPIYSLVVDGLDECPEKE
FT                   RKMTLEILQQLRKHLKIRMCLSFRQDAGDHAKVAAGILNAQWTLPIPENNPDIDAYIDA
FT                   ELRERLESDRLCIRNPAIILSIQHALVTGAQGMFLWATLLLDCICMEQTDEAILQALES
FT                   LPQSLSETFRRVLQQTGVSNIQHRRRIVQLVMAARRPLSVGELCEALSVIPGDTTWEPA
FT                   RQINNIHAALASCKCLIIIDEEEQTVRFAHHSVKQFFIARGDEPENLNPINPDETNKEI
FT                   GRVILTYLNYGIFDRQVSRTVVPTMSAVNVPTRIVSSVFRDSVNTKRVALELLKTRKNG
FT                   KCDIGQTLAETAMAQRRSPAESHPFLAYAKDYFRYHILGVWNCEKEMGQLWQGLLARNS
FT                   LDLRITDWLQYELQQRRVTGLDGEFVPCDVLSQLVTYRVVRKVLEETGFYGYGASTLAH
FT                   GILTDRQRWFAILVDIGINHYLGAHFQSSMIQSPLTDRDLPISSVQFLEKYKSNISQTT
FT                   GSLTVPPGSNIPSSSRPVGPMETDRWMTLAELFCLRQHQYLATILQEGQHYNSEDGIML
FT                   FLPVGNSFYNHDYGSLVVEVHPAHHDFPPAYRGGEDVDGPYVVALWPFSKAMDEPPFLL
FT                   LSQGGFWDVPWHLLRAVASYRPQQQSGILPFETMRLIFPVLGPSLADVWQQSLGTDMHS
FT                   SRRFLRFCLSQMTGIAEALVFVIQNDPEEWYISLRKITPRSIQWCKYSRSTFQWGTLRL
FT                   DLRTLIADPIERAPRQSEKAYRAPHEAKGKNGSKRDCVWRLGCIYFEFLIWAVMGSTGL
FT                   QEFREARGGSNAPFYSQTDSDHHHPGFELSPEVCRWADMLLNEPELPPEVRRFGEYLLR
FT                   DVLVVDPSARPSARQLASDLEDLQKLQTVDNLDGDW"
FT   CDS_pept        join(complement(677082..677161),complement(676125..676187),
FT                   complement(674778..675834))
FT                   /codon_start=1
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207664"
FT                   /orf_name="AFUA_6G03180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85721.1"
FT                   /db_xref="HOGENOM:HBG056282"
FT                   /db_xref="UniParc:UPI000051FFD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD17"
FT                   /transl_table=1
FT                   /translation="MIDEIEHTAWNDRTGWIMASISISYITVAKAKQIRERRPSITALR
FT                   WNNFLSCRSCFNNTVLHSWRNHDPMAIIRSTKNDLNVAEDFSIACFIAVSWYNAIELIV
FT                   LCFTTFKKRGGFYFWALLISSIGILPFGLGYILLIFDIYPGYFSVALADVGWCAMVTGQ
FT                   SLVLWSRLHLVVYSRLVLRATLAMIIIDGVILHTIGWVFEMGEQSPRSDWFTPAFSIFE
FT                   RIQLIGFSIQEIILSIIYTKASLQLLKLRPRQQYRSTLVQLVIVNILFILMDAAIVTFQ
FT                   YAGLFHVHVSFKAMVYSVKLKLEYAILGKLVHMSKMSHSNSAPTDRSDAVEMSSRRTNN
FT                   RSHLEQTRQHRESQTSIIREGAAFDGEDPADCSRVGSLKGSFPSSKEPDAACVEVGNRL
FT                   "
FT   CDS_pept        678426..679379
FT                   /codon_start=1
FT                   /gene_family="HOG000199933" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264288"
FT                   /orf_name="AFUA_6G03190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85720.1"
FT                   /db_xref="HOGENOM:HBG052723"
FT                   /db_xref="HOGENOM:HBG326147"
FT                   /db_xref="UniParc:UPI0000520933"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD18"
FT                   /transl_table=1
FT                   /translation="MKDGRHRRLTPSTVSKTTTMTRTIHIAVLDVDIPPRSLYETHGLC
FT                   SAHFRHALQDAATRFNALTPGSDIRIAVTPYDIRGGHYPDFRHLRKTQTPLSEHSIDAI
FT                   LITGGAPGVYEIDKRPWMQTLAKFLQTVFREYPAVRIMGTCFGHQLIGHALVDSGAGDV
FT                   YVEKCPLGREVGIHTVQLNRDFVDAFPLALGHLPNGQLKIQMFHGDRVMVKGGTEGVLP
FT                   ETAAVSLPAPWVNIGSTPLCPIQGMYYPGRVLSVQGHYELDACGMQSMCLEFAPLLGWT
FT                   DSKLGLFLEQVGDDYNGRQDDSEAFALAVVCFLAGE"
FT   CDS_pept        join(complement(680607..681513),complement(679418..680553))
FT                   /codon_start=1
FT                   /gene_family="HOG000106394" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903118"
FT                   /orf_name="AFUA_6G03200"
FT                   /product="Solute symporter family transporter "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85719.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051317"
FT                   /db_xref="HOGENOM:HBG397209"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniParc:UPI000052092E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD19"
FT                   /transl_table=1
FT                   /translation="MAHSNDLQVLPPSAGYGIVIGIGGIFALFMLGLTWLQNRYTTFST
FT                   HQAEEFNTASRSVKPGLISAGIVSSWTWSATLLTSSTFAYSYGVCGPMWYAAMGTLQIL
FT                   LFALIAIKIKAHAPGAHTMPEIVRARHGTVAHLTYLYNGLATNMLVGACLVLGGAQVVA
FT                   ALTGMNVYAATFLIPAVVAAYVIAGGLRSTFIADYTHTVILFVAILVFGFLVAARSELI
FT                   GSPGRLYDLLQEASREMPIARNTDGSYLAFRSVGGLVFAIDIFVSGFTTVWLDQAYWQR
FT                   AIASRPETSVKAYLLGGIAWYGIPFGFATAMGLGCAALTNNPAFPTYPHPLSPDQVAAG
FT                   LSAPATAITLLGQGGAVLMLILLFMAVTSSTSAELIAVSSLLTFDVYKTYFRPRTDSAT
FT                   LVRVSHWAIALYALVLSAFCSILNAVGLSLTWVLTVLGVIVGGAAVPVGLILLWSRMST
FT                   VAAIVAPWIGFACGIVVWFVTSTKRSGAINVETTGDGTNAVAGNLASFGVGVVSAVLLS
FT                   YLFPEKYPCVDAQVVPGIEGVAPTPQEDTRQPPKAADGDEKATSAPAKNDIVEFLQDEH
FT                   IEPMDPVLVRKAERLAQGASLVFILIAVILVPFTLFGTSYVYSKPFFTGWVVVSLIWIW
FT                   ASVIICVVYPVVESAGALGDISRGLWMDMKALTGVKKQSLQTNAV"
FT   CDS_pept        join(complement(682968..683093),complement(682787..682912))
FT                   /codon_start=1
FT                   /gene_family="HOG000201826" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056379"
FT                   /orf_name="AFUA_6G03210"
FT                   /product="Conidiation-specific protein (Con-10), putative "
FT                   /protein_id="EAL85718.1"
FT                   /db_xref="HOGENOM:HBG216201"
FT                   /db_xref="HOGENOM:HBG752117"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniParc:UPI000051F40B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD20"
FT                   /transl_table=1
FT                   /translation="MPANQNPGNFANRPQEEVESIARKGGQSSHQGGFASMDPRKQRDI
FT                   ASKGGHASSGSFQPGDERAREAGRKGGRATGDVDEPEE"
FT   CDS_pept        683854..684132
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264289"
FT                   /orf_name="AFUA_6G03220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85717.1"
FT                   /db_xref="HOGENOM:HBG056281"
FT                   /db_xref="UniParc:UPI000051F8CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD21"
FT                   /transl_table=1
FT                   /translation="MPSQPAYFQLDQFSIMPFDGFSFKLQLAAHRCLAVCRDKETAKHV
FT                   ITRYGLAAWGAVVSLWLPEAIIWAVFGEEGKLKSPSDRLLLGLSSHR"
FT   CDS_pept        join(685289..685370,685438..685691,685741..686478)
FT                   /codon_start=1
FT                   /gene_family="HOG000196187" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264290"
FT                   /orf_name="AFUA_6G03230"
FT                   /product="Cell wall glucanase/allergen F16-like "
FT                   /EC_number="3.2.1.-"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85716.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG056280"
FT                   /db_xref="HOGENOM:HBG592277"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000051E5B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD22"
FT                   /transl_table=1
FT                   /translation="MMLPLLAVSAFASLGAAQTYTSCNPTNSLKTWSLSTDFTQGSSDG
FT                   WTAISGNVTYGSNGAEFTINKRYDAPTLETNFYIFFGEVEVVMRAANGTGIVSSIVMES
FT                   DDLDEIDWECTGTDTTQIQTNYFGKGNTTTYDRAIWETVSSPQDEFHTYKVVWTAAAIT
FT                   WYIDGTAVRTLEYADAVDGKNYPQTPMVVKLGIWAGGDPSNSEGTIEWAGGETDYDEVP
FT                   FTMYVKSVNIINYNPAASYNYTDKTGSYTSIVASNSTTGSGIHSSNSVSVFAPSSSTST
FT                   FTSSRALIATASTYPASVQTSSSGVVSLSSSSASSSSAAASSTSGSASAVFTGAAVTNL
FT                   PSFFFTVFFALAIALAF"
FT   CDS_pept        complement(686544..688214)
FT                   /codon_start=1
FT                   /gene_family="HOG000201805" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207665"
FT                   /orf_name="AFUA_6G03240"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85715.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG056279"
FT                   /db_xref="HOGENOM:HBG333956"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000051E5C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD23"
FT                   /transl_table=1
FT                   /translation="MDIYGTAVTAITQVYQVTIFIKGVVSDIKAFDDDRAEIQLKLNLQ
FT                   LTTLLFFKRICFHPEHGLLLPGKLDPFIADTVEGLLVQMRKTLAEYELVAAKYGLIDDE
FT                   LAIEPDKPATTQESLLERAKSKARSLKLKGYDWSLFDKKRLNRILDAYTKWSEDLRNIM
FT                   LHMSQDTLAKMAESDHQGLRSSGLEPVMKRRTLAAAKAPADYQSLTGTLAEEGKTMGGF
FT                   RLGKWTASESEAMPVIVEYHEYESRLKRDDLEPDEIEELKEPIRNLAWLLQNTTFSGTS
FT                   ANSLDQPKIYALECLGFLDQPTDERTVFLYKLPPSEPTTPDTTLTTLHAFINAVDSQTK
FT                   RPLKKPSLNDRFSMAHSLALTVANLHASAWLHKNIWSRGILLFLETPAGTSAAGLYAHR
FT                   LAPSPKDNTRIVSYLSDWGYARSVQQGTEMRSDFEVEPNLYRHPDRQGRPSHQFSREHD
FT                   IYALGVVLLEIGLWVTMSRLMEARIREAETSGRLPRSKKVLEDLIALAQQGLPKEMGVG
FT                   YTKAVLACLKGEFRGREGPALAVDFQEKVVDVLAGGINM"
FT   CDS_pept        join(688416..689611,689656..690576,690620..692348)
FT                   /codon_start=1
FT                   /gene_family="HOG000201794" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264291"
FT                   /orf_name="AFUA_6G03252"
FT                   /product="Protein kinase, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85713.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG056277"
FT                   /db_xref="HOGENOM:HBG325062"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0000F51CCB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD25"
FT                   /transl_table=1
FT                   /translation="MTGLSSYDEILNSLEEDSYYAVSSNDLSPSLQAWSNNTDLEELDL
FT                   SSLNLSSSSDSSSWIDPLESAITDTRNGSSPVLSTLSQFTALLAQTGIHGPRILKAFNL
FT                   SRRGTKIGAGAQFTVFTDPIYEGQVIKRVNVPLSSKAEQRFAASTDYRLQLRTLGLEVL
FT                   SLCNPMLRAHPNITSLLAWGFDFPFADMAVPVLFMEAAMMPLSDFLGAETRAVEVRYQL
FT                   SLDVANGLEALQNLNIVHGDVKPENVLVFAGPSDRVPFRAKLSDFGVCLDLEAPDAKFM
FT                   LSDYRGTQAWLAPEVVSEDLDRFGGFSSELMFRFDAYSFGLVLLSVFTGNGAAPVLDEH
FT                   PENVPDQVFELLYGQEDIPSNIRIELRKAIAKLLSEDPRKRPLPSPGLIKTDSPTYAAW
FT                   LSSIQLTPTNTHAGIMDPIYNKGPLFWYRLDESIRTELEGQYALMQEGNAPPFPGDVLF
FT                   GLAQTITGAKPSYLDRLLTYLTEAARAGYSPARGVYAQIMEAHGQKPEFAEDVLGEWML
FT                   QAVSEGYFFASPSYSKGRIEEARERFRANGGFCSDPFLAKKDVVEAAGDRTKALRRTME
FT                   NGSVVDRKGNTILHAAAALGAIDAVRGLLDDGQLPVNVENEKGETPLYKACQAGHAKIV
FT                   ELLLDRGADASTMTRQDKLSPMHWLFMISDASIPEIARRMVEGGADINATIEPVVKENS
FT                   AGFPEKIQILHYPFELPHGTPLHWACFFRNLTAVEALISLGANINASYHASDASTTPLF
FT                   LTAYFGEPSLAKYLISHGADVHLVDSMGRNALHGITKYFPERHGYLPHHWHYWIRHGSW
FT                   EHHLTQMTELVKILVDAGADLNANDKGYPPLTPVAAAADLGVWDGGVICALLDAGADLG
FT                   ESVLSAGNTVLHSWASIVGPRLAYPDSYLSTMKKIVSATPDIDIPNKFEKDTPLHLLAT
FT                   TYHPEEEFEAACEMFLAHSPPADINAKTRRGATPLTIALETDLDPVRRGLFLLHKGADT
FT                   LVLNARGRDIFFSIVNNAALTDQATHDLIRTFLQHRNPDIQQAYAKHYLPNSNSYHTLF
FT                   AAAERGKPLSLALLLSLGLSSRINDLEGSKRPPWTVLDQALHGAEISRRAHMRRLADHK
FT                   PGAHRNRALEQDIVYDEAQGPPARAAEAYRGFPAVIRILRDAGGKRACELDGSSTATGE
FT                   YIEQPWEWDLTEIYSYGFTPKTQPNLEQWSGLYEEARYSEQWQKGRLNAWKEEYEEGRW
FT                   RPDVRMLEEEEQSFVNELVCCLAGEGRVTLEAVDGQKKQWQVEMEGGKIVKKQGKK"
FT   CDS_pept        join(692479..692527,692595..692974,693025..693897,
FT                   693945..694022)
FT                   /codon_start=1
FT                   /gene_family="HOG000167484" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264292"
FT                   /orf_name="AFUA_6G03260"
FT                   /product="Aspartic endopeptidase (AP1), putative "
FT                   /EC_number="3.4.23.-"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL85712.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG056276"
FT                   /db_xref="HOGENOM:HBG323988"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000051EF02"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD26"
FT                   /transl_table=1
FT                   /translation="MSSCRFSNTLKTATASPCKYLHTTTTITMATRIKLLPNPHYRKSG
FT                   TKSYVHLMRKYRFTPTKGGRYFLSSSLHQTGRQYTHLPVGGRARIQHVLRKRIADTDET
FT                   SDVGADDVQNDTMYLAPVSIGTPAQTIHLEVDTGSADLWVWSTHLAPATIAQHKTGTVF
FT                   DPSKSSTFEEQSGSTWKVSRDDGSFAFGTVGTDTISLGGLRVEHQAIELADSLSAQYEQ
FT                   GTGDGLLGLAFSHINTVRPQPVRTLVENMVAQEDIPKSAKLFTAKLGCWQGANEPDEGE
FT                   PFFTFGFIDQDIVTASGEEVYYTPIDNSRGFWLFDSASATVNGKTIARSGNKAIADTGT
FT                   PLALVDDETCQAIYDAIPGAHYDDESQGYIFPSTTTADKLPVVSLAVGDKQFVVQREDL
FT                   GFAEAKSGYVYGGIQSRGSMAMDILGSTFLKGIYPIFDVGNLRFGAVQRKELHQNLSAP
FT                   Q"
FT   CDS_pept        694435..695010
FT                   /codon_start=1
FT                   /gene_family="HOG000217800" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056380"
FT                   /orf_name="AFUA_6G03270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85711.1"
FT                   /db_xref="HOGENOM:HBG056275"
FT                   /db_xref="UniParc:UPI000051FDB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD27"
FT                   /transl_table=1
FT                   /translation="MLTHIQHLPLELREKLALLPESPSREEIYVLWTHLLQRYFPFRLH
FT                   GSLPNLADLPDETAVKYALGNHQESESSHIALAVGREYGPFDRLSFLHVFCQAETKEKW
FT                   HLAEMQDKLKEEMMKSSHCEIARRRGMTIHGAIVVSRQVEFYKMKRDGSFECMTWLAQE
FT                   KKRLHILRDMRTITSHLMQINYEVRLRD"
FT   CDS_pept        join(695806..695879,695924..696035,696082..696355,
FT                   696402..696448,696494..696709,696757..697536)
FT                   /codon_start=1
FT                   /gene_family="HOG000217801" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207666"
FT                   /orf_name="AFUA_6G03280"
FT                   /product="Swollenin, putative"
FT                   /EC_number="3.-.-.-"
FT                   /function="cellulose binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL85710.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="HOGENOM:HBG056274"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR007112"
FT                   /db_xref="InterPro:IPR007117"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR014733"
FT                   /db_xref="UniParc:UPI000051EA79"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD28"
FT                   /transl_table=1
FT                   /translation="MTLLFGIFLARLAVAAAQSSCVSAWGQCGGISYTGSTCCQSGNTC
FT                   AEINSYYYQCIPATAVSTSTTTVTSPSSSGSSSANTSGYTTTTVLPSPTATQNPYPPAN
FT                   ASSCGSWALVDNVCCPYYCLSDNESESCTSSCTGGCGSPDSSMCKSGTMWGEQHTVTSN
FT                   EDWHYSRSTHFGLTSGGACGFGLYGLCTKNSVTASWTDPMLGSTCDAFCTAYPLLCKDP
FT                   ANVTLRGNFAAPNGDYYTQFWPSLAASGNPDNYLSCGECFEVIRTKPDGTDYAVGESGY
FT                   TDPIVLEVVDSCPCNANSKWCCKRPPPPPFFSPPSNGQNLTRPGGSGADHCGEIDFKYG
FT                   CPLPEGSHHMDLSDIAMGRLQGNGSLADGVIPIRYRRVPCPKPGNIYIWLHDGAGPYYF
FT                   ALSAVNTNGPGSVISIEVQAGGSGPWVALEHDPNYTSSRPQERYGSWVLPQGKGPITVP
FT                   VSMRLTAPNGQQVVKEGAITSYTPPATAVEGFWYIDLGVQFT"
FT   CDS_pept        complement(700473..702185)
FT                   /codon_start=1
FT                   /gene_family="HOG000178932" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056381"
FT                   /orf_name="AFUA_6G03290"
FT                   /product="Isochorismatase family hydrolase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="NAD or NADH binding"
FT                   /function="hydrolase activity"
FT                   /function="magnesium ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85709.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056273"
FT                   /db_xref="HOGENOM:HBG324171"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="UniParc:UPI000051EA73"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD29"
FT                   /transl_table=1
FT                   /translation="MTIKKLRLGLAIGHGTGRELIAVFKKVIHALASKHSLHVDFIESS
FT                   RIYHSYHTLTVSGEEKDLIKHIADETTQDADEYRTFCETAAANGIAAIFRTAIHAQSLY
FT                   LVRDQLKAVKIEHFSLGDSNALLFIRDEAQGFYAGVNEYDNGNHSITRSSPFSRSTFDQ
FT                   ILAYALERAAEEWGVENVPESVTLVYKFHLFDGVFQAWAPHWRSRFGIDVDFIQPDTMN
FT                   RNLMAWGIQGRRIIIAGNEYADIIQPVFLKWFGNSTIETMCAENVYLSPNLHCLGEYQT
FT                   VHGSADAIAGQGLVNPFATIRAAAAILERHGGCSGAGFRHQTEKAIQSLLRRRLTTPDQ
FT                   GGSCSTDAVVEHFLRAITDLTDATTPDVHSDTAEAGLISNARIGQKSAVVIVDYQNDFI
FT                   ASTPTPAVSELSRTIPRLIRCARKEGREVIFVRFLGNTSFQGPSWQHRDALLGKSEKCV
FT                   EGTWGAELGPGITPAPGERIFDKKALFDPFLVPEFAEYIAQQGLEHLVLAGLYSDVCID
FT                   ATARTAFQKGLWVTVVEDCTAALHANQVDHLRFMEKVYGARVGTVAILFGVKA"
FT   CDS_pept        702641..703534
FT                   /codon_start=1
FT                   /gene_family="HOG000178921" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207667"
FT                   /orf_name="AFUA_6G03300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85708.1"
FT                   /db_xref="HOGENOM:HBG053570"
FT                   /db_xref="HOGENOM:HBG332305"
FT                   /db_xref="UniParc:UPI0000520932"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD30"
FT                   /transl_table=1
FT                   /translation="MTKIDVINSGFNLGNELDYMLDRSYTAASRLNYQFYLWKDTLRFN
FT                   LHPSIQLPKDESTPVRIADLATGTAIWLLDLLRDPAVARYKSIRLDGFDIDLANAPLPE
FT                   WLPTPITLRQLSLFETVPGDLRGNYDVVHLRLLVLVVQNSDPLPIINQAYQLLKPGGYI
FT                   QWDDLNYPDGAVVKANALRDVATPAHDAFLRFARSNGRNDWVLDLPRHLMSRHGGFEDA
FT                   HIRNYTDRVELRKANGDQYILVMEEFSARLKRAGKMEDAHNIDLMIRGLAEESRRGVGL
FT                   SMPKAVCVARKKGGRA"
FT   CDS_pept        704042..704680
FT                   /codon_start=1
FT                   /gene_family="HOG000178943" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264293"
FT                   /orf_name="AFUA_6G03310"
FT                   /product="Putative uncharacterized protein "
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL85707.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG056272"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000051FDB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD31"
FT                   /transl_table=1
FT                   /translation="MFLLPGIAAFPQFQRVVELARQGGIVLDLGCGLGQNLRLLAACGV
FT                   PSNQMWALDLSPQLWRLGYELYRDRDRMLATFIPGNFLHEDDCLGLRELYGQVDIMIAG
FT                   QFLHLFSWEGQKQAGKRIVALSKRGTVLIGYQQSRRRAREYMRPWGMMFYHNRDSFLQM
FT                   WREISLETSTDWKVEATEVDLAEWGMEAEDTEWMPADRQGLNFVLTRVH"
FT   CDS_pept        join(complement(707780..707977),complement(707641..707716),
FT                   complement(707275..707585),complement(706131..707213))
FT                   /codon_start=1
FT                   /gene_family="HOG000169396" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207668"
FT                   /orf_name="AFUA_6G03320"
FT                   /product="MFS multidrug transporter, putative "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85706.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG024032"
FT                   /db_xref="HOGENOM:HBG032742"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E82C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD32"
FT                   /transl_table=1
FT                   /translation="MAEEDVLSERNGLDESGQVSPNGIKGRTPGLPDFTLGRRGILAFF
FT                   TLSVLTLMVALDGTSISVALPTITQDLKGTAIEAFWSGTSFLLCSTVFQPNFASFSSIF
FT                   GRRPLVLVALAFFFVGTVVAAVAKNFTYLLVGRSIQGVGGGGLIALSEVIVTDLVPLRL
FT                   RGQYFGILSAMWSVGSVTGPILGGGFAQDVSWRWIFYINFPFIGVGTLAILLFLKLNII
FT                   PTSLAEKLRKIDFVGTVLFVGSLASFLIPLTWGGVLYPWNSWRTLVPLIIGACGLAVFA
FT                   YYEVRFAADPIIPPTIFQNRTATVSFLGSLLQGLVLWCALYYLPLYYEAVKEYSPIVSG
FT                   VALFPETFTVAPSAMVVGILTTRWGHYRWAIWLGWLLSTLGVGLICFIKVDTSIPAWIF
FT                   LNIVPGIGLGLLFPSLGFAIQASATSDTLAIAVGMFSFFRAMGQAIGVAIGGVVFQNRM
FT                   YHNLLQYPSLAPRASEYSQDAAGLVQVIREMPAGAEKLMLQTAYTDSLRIVWAVCCAVC
FT                   GVGLLTSLLTESYDLNRALESNQTLRSEKDAIADEESG"
FT   CDS_pept        join(709739..709898,709954..710441)
FT                   /codon_start=1
FT                   /gene_family="HOG000217802" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264294"
FT                   /orf_name="AFUA_6G03330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85705.1"
FT                   /db_xref="HOGENOM:HBG056271"
FT                   /db_xref="UniParc:UPI000051E824"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD33"
FT                   /transl_table=1
FT                   /translation="MSDTIITRADDLPEPKELAEAYELELQSQNGRSIRFGELVAGKGA
FT                   QITTIVIFIRHFFCAYDQDYVRVVSPRLTNFVLSTLPNPTGPSQLIIIGCGDSQRIVPY
FT                   VSETAAAFPIYTDRTGKIYKKLLMKRTTSHITQPPSYAQVSFFGALGKTFGQMFRSGWQ
FT                   AFRGGSWSQNGGEWVFRGGKSFYVHRMEHVSDHLTADRLLEVLSLDEPAQTK"
FT   CDS_pept        join(710762..711306,711356..711521)
FT                   /codon_start=1
FT                   /gene_family="HOG000201783" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207669"
FT                   /orf_name="AFUA_6G03340"
FT                   /product="Putative uncharacterized protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL85704.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG056270"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI00005206CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD34"
FT                   /transl_table=1
FT                   /translation="MDKELSILCFGASLTAGYYHFGCEYHPYALRLKEKLQAAFPTTKF
FT                   TVDEDGLPSDLVIKPGRFLPRIKEKCVFSRLSFLRCSLTIAVDGSNYDWVIVLGGTKYV
FT                   ASSIRLEGLDAHVSSDLGRGYPASKIYPALQEVWEVALDNGAFVLALTIPECSVASTTL
FT                   DQRRNEVNSSILSHKAQGFYAFDLHGKVPYHSAAEEFRKRIWDDGLHFTAEGYDLVGEV
FT                   VGEHLIALLKDQGL"
FT   CDS_pept        712545..712883
FT                   /codon_start=1
FT                   /gene_family="HOG000253040" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751076"
FT                   /orf_name="AFUA_6G03345"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27238.1"
FT                   /db_xref="UniParc:UPI0000F51CE1"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA20"
FT                   /transl_table=1
FT                   /translation="MASKRGIFPLYANIHHGIISRQYGLRRCPQPIASFSSHFAVANKQ
FT                   SGPHKGQSQGNHPQNTEIPSFSFDSLGPAKTTKTVVLVILGVFGTIESWFWAQAIWRWW
FT                   KGDDEDAK"
FT   CDS_pept        713240..713785
FT                   /codon_start=1
FT                   /gene_family="HOG000179065" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264295"
FT                   /orf_name="AFUA_6G03350"
FT                   /product="GNAT family N-acetyltransferase, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="N-acetyltransferase activity"
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /protein_id="EAL85703.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="HOGENOM:HBG056269"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000520939"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD35"
FT                   /transl_table=1
FT                   /translation="MTSSTPPIPTQTWTKDAYFISTDSSLIPLETLNDWFASDDIYWTN
FT                   SLPLDILKQLVENSMCFGLYYTPDQPDKADAEPEFIGIARFVTDYTTFVYITDVYVLSS
FT                   HQGKGLGSWLVECMGEVIDAMPYLRRSMLFTMDWARSVPFYKKILGMSVQESKNGEGMA
FT                   ILMKKGNGYPKYDYEKGV"
FT   tRNA            complement(713928..713999)
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        complement(714435..715511)
FT                   /codon_start=1
FT                   /gene_family="HOG000294684" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264296"
FT                   /orf_name="AFUA_6G03360"
FT                   /product="ToxD-like zinc binding oxidoreductase, putative "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85702.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG447528"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E5C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD36"
FT                   /transl_table=1
FT                   /translation="MKAIVTNRFLPKRLLSFALGRSLGNGALIADIPIPQITENEVLVK
FT                   VCAVALNPIDFKDIDFVSPRNSVAGCDYVGLVTKVGKNSAQRWKVGDRIAGFVHGGQYP
FT                   DVGSFAEYLKVDGDLAWKVPETMSYAEAATYGVPAATAMLALAYLGIPWADIEKGRDLH
FT                   TNQSPFLVYSGGSNVGLFAIQLAKRAGLKVVVTASPRSFDLVKRYGADAVYDYRSPTAA
FT                   AEIAKAYPSITRALDCFSEGGSTAFCASVMKSGKVIMLLDRGQPKKPDIEYKSLMVFTV
FT                   FGRQFSILAPLGPSFPVVPSDRQALQQFYAALPKLCHDVVKPPPITNTQGGFREIFEDL
FT                   NKLRKGEARGTKLVVEFE"
FT   CDS_pept        join(complement(716864..717122),complement(716270..716802),
FT                   complement(716131..716214))
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264297"
FT                   /orf_name="AFUA_6G03370"
FT                   /product="Short-chain dehydrogenase/reductase, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85701.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000F51CCC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD37"
FT                   /transl_table=1
FT                   /translation="MSQKTVFITGCSEGGIGDALAKAFHQKGMRVFASARNLAKVQHLK
FT                   DMGLDIIRLDVVDEESIREALETVKAATGGTLDFLVNNSGLGYSIPLLDSDVSVAKKMF
FT                   DVNVFGVVTVTQAFAPLLIASKGTIINIGSVLGKMPLPWQAYYNASKAAVALLTDQMRI
FT                   ELSPWGVRAILVNTGAVRTKFFDNLPNTPVLPESSLYYPAKDVIEPALAGSEVEKNAMD
FT                   VNSYAEAVVNNATRSSPKKHLWIGGGALLTWLASTFGWSTIWDLLLPHFINLPAITSKI
FT                   RSAEKVEQDR"
FT   CDS_pept        join(721183..721281,721312..721374,721426..723321)
FT                   /codon_start=1
FT                   /gene_family="HOG000048642" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264298"
FT                   /orf_name="AFUA_6G03380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85700.2"
FT                   /db_xref="HOGENOM:HBG056268"
FT                   /db_xref="InterPro:IPR021514"
FT                   /db_xref="UniParc:UPI0000F51CCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD38"
FT                   /transl_table=1
FT                   /translation="MLAHSTTRWDLPNRVPRLLRRLKALADMSALIQPQQGKRQAPFSG
FT                   WKLEILACLGKPLPQWPFRVSINTLLSIYGGVMKAATIYVVGSCIGQLQWSWFSSERPL
FT                   IDLSRLADLSHGDLFGAFRWLGSNHIREPFITLGAIVAIASLAFEPFIQQLTSYGDCSV
FT                   PLKNLRVAPNIPRTNYIVQRSGVSSAQSGDPEIAQAILLGLVGGPNPLASTGCTAGNCT
FT                   FPTAYTSAGICSTCEDISSNITVTKTCRGENSSVVDCANATYQQSVVWADRITSASYGG
FT                   VELTNVSWTPMQNESLLFHVDTALYPQWPKFVMFGVVIVWGETTYSQAKVNPLTTEPLH
FT                   GCEDPSTNNTWACRGYGSAYCKLRFCTRTYNASVEAGILVENNIEESPSSTKELVSPPP
FT                   EALAGASAATLGLLDLRCINDVELRELRNVGYNISSASPRWAGYVVDHDLFQLDGNKYN
FT                   DIGPDSPFPQSLLAHRCLYMMSLRFQTNWFYVAGALSGNVSTGRIQSSRSTIGPKVLQN
FT                   IEPLSTLSGDGGPILLYSNSKVDFGSISAKLSNVATHMTTMVRQTGNVNHSAPAERVVF
FT                   HYATCLNVHWIWIILPSIAAGCVVALLAAVILLTAHGGTRIWKGNILALLFHGPGGAGW
FT                   SSMPVSGEDGDNVLSKLNTNQGMEQRAREIKVKLDQSSDSAQLLKAGEMK"
FT   CDS_pept        join(725580..725630,725725..725899,725969..726098,
FT                   726154..726199,726257..726586)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056382"
FT                   /orf_name="AFUA_6G03390"
FT                   /product="Glutathione S-transferase family protein,
FT                   putative"
FT                   /EC_number="2.5.1.18"
FT                   /function="glutathione transferase activity"
FT                   /protein_id="EAL85699.2"
FT                   /db_xref="GO:0004364"
FT                   /db_xref="HOGENOM:HBG056267"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000F51CDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD39"
FT                   /transl_table=1
FT                   /translation="MASFYAAETPERVKKAQLTLTKGLHLITSLTPNGRKVHILLEELK
FT                   DTYGLEWMISLIDLDKNEQKKDWFLRLNPNGRIPILIDNNTCPPHVVMKSSAELLYLVN
FT                   LADKDNIFWFLDLIDKCNIIFLGIMRTKALTVASENCCRCTTYLKSVFQGDMVAAHGSI
FT                   WLGRVRANTALLISMPGPGCEIFDALDSRRMSWLRYLIYNSGWIALRRDQLWSEVWGSG
FT                   MMRMCIQSYCLRLRDYLLRCA"
FT   CDS_pept        join(complement(729157..729251),complement(729078..729109),
FT                   complement(728865..729031))
FT                   /codon_start=1
FT                   /gene_family="HOG000201772" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264299"
FT                   /orf_name="AFUA_6G03400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85698.2"
FT                   /db_xref="HOGENOM:HBG056266"
FT                   /db_xref="HOGENOM:HBG325058"
FT                   /db_xref="UniParc:UPI0000F51CD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD40"
FT                   /transl_table=1
FT                   /translation="MSSFATPSPHSPRPFFKRPAYPSFKVGRVGKLYLPAMAVVAAGFG
FT                   IANYLNDFQAQQARYQLQEEERIRQNQKLMDAYGDKDSLHDVQHALEAYEIQ"
FT   CDS_pept        734987..736564
FT                   /codon_start=1
FT                   /gene_family="HOG000217012" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903119"
FT                   /orf_name="AFUA_6G03430"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85696.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056264"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051FFE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD42"
FT                   /transl_table=1
FT                   /translation="MMDDKHGRYGACDRCRGQKLRCVGAGKPIPNSSSRLLRNEIPCDR
FT                   CRRAKVECYSVRPAPRRAASNVKEQMIATQAASERSSSLAYHTSGPVVSPPNSLVTAAS
FT                   KPHPNSLSFNHPRSDAVAAPGGLQTRRQSRDTDSLGDMPSMPHEWMAYLHDHKMDDRQG
FT                   LGMETPPLIESDLNLSRDPAMDSMHEHNMMMELIHQDHQEEWNSGPPELEAYPDPIVPP
FT                   NPAPLKARKLTSPDCDDYPYGHTRRSSHTPTQPPEPAGRSCIQELAQFNEMLLRDKCSL
FT                   EDTSARRGYKDSWLSIGRTLHHCQQFFSILKRIKYSRPDSQLSADRARSQWSSLPEGTS
FT                   LADGAPTDSPQARRSLARGATPCSSSLARSSSTSSAASTSYLGLSTLLSILFCYTYILQ
FT                   AYEDILTSILHAVTRPTPTIPPTLSGLRIDGFQLDGHHTLQLECLLHVSYNLLEKIENI
FT                   LFGSAGPEELSNPVKYGILGDKLSAGLIDALFEHNETNGLLHCQGKREVAAKRLIREIQ
FT                   AALKQLDL"
FT   CDS_pept        join(complement(738294..738342),complement(736781..738225))
FT                   /codon_start=1
FT                   /gene_family="HOG000169862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207670"
FT                   /orf_name="AFUA_6G03440"
FT                   /product="Fructosyl amino acid oxidase, putative "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL85695.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG056263"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000051E82B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD43"
FT                   /transl_table=1
FT                   /translation="MSIPNSFIIVGSGVFGLSLAYALSLDDRFADKKIILVDRWNFEPP
FT                   NATGSVHNPAAANADTSRVIRRDYPHGPYASLALEAMKHWRGKFGENNRYVNQRLLFSG
FT                   EGSSLTTPPKALETVNYIKKAYAISCELTPGGRDAVQVLDSLDEVRAFLGNTPSHPPHL
FT                   PVNKDPAARDLRGYVSNDCGWADAGASIEWLRQEVLRLGRVECVVGEVESLVYSDDQRA
FT                   VKGVKLVDGKVLTAELTVIAAGARSSHILGIPKLCDVYSEFVAYIQLTKEEADELRRRQ
FT                   WPILVNCHRGVFAVGPDHDNCLKFGHFSYSGIVDVLREASIQVPTRPDGWEAQQKYWSD
FT                   PRFAFGGEVKVSALGDVDDYENPAAQRALADYRLFLLELLGPTGLQGVDTLGLDQSDNL
FT                   LNNIANRPFTRVRKCWYNDTPALDFVVDYHPSYGKTLFVATGGCDHAFKFLPIIGEKTL
FT                   ALILRNRGDSAVSLPAGVEPSLEELSELWRFPVELLQDN"
FT   CDS_pept        join(738919..739274,739349..740093)
FT                   /codon_start=1
FT                   /gene_family="HOG000217011" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207671"
FT                   /orf_name="AFUA_6G03450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85694.1"
FT                   /db_xref="HOGENOM:HBG056262"
FT                   /db_xref="InterPro:IPR017805"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="UniParc:UPI000051F66F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD44"
FT                   /transl_table=1
FT                   /translation="MSSNVQDIRGWPPPFANAAYQPDASSRRARYGGLQVHNLRQATTA
FT                   NSLVPSIIQGLRAEDRELPSLLLWDDQGLSLFNAILDSPEYYLANKEWALLHNEVHNIV
FT                   ASISSGDRLVELGAGNMKKTALILHTLQSQRKYIHYIACDVDRVALQRGLRNLQAIFPA
FT                   STSSIKIQGLVATYEDCAAWLQRNPGSGHTSLMWLGNSLANFPPPEASEYIRSFLSTGA
FT                   SLILALDGCQDHEQIARAYEGPSNQKFVLNGLRHANDVLGTDAFDVRNWSFLGRWNPEL
FT                   WMHESFYAAKRDLTLKIGRETFVFRKGETIRSIRSGKWPKPKVVDICREAGGDVVDWWM
FT                   NPDESYGKSTTLMGYLARVLIDSVSD"
FT   CDS_pept        741171..742895
FT                   /codon_start=1
FT                   /gene_family="HOG000217010" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903120"
FT                   /orf_name="AFUA_6G03460"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="D-alanine-D-alanine ligase activity "
FT                   /biological_process="peptidoglycan biosynthetic process "
FT                   /protein_id="EAL85693.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008716"
FT                   /db_xref="GO:0009252"
FT                   /db_xref="HOGENOM:HBG056261"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniParc:UPI000052092D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD45"
FT                   /transl_table=1
FT                   /translation="MLRASASGAKCAVKLIVPLHRGFIVRSDIIPLRLRDSEYVESAVS
FT                   FAEPLQTYSGKKVAISSRSDLTTYFAAAAAGLILRQGSTHASDAGSQALFQMVESDLAN
FT                   RLSFPWIQPGTPRRRTLALVDANSSHPQDGLGFYRAARELGINVVVLENAGHWLEDPAQ
FT                   AHWREAFIPTRLTNPPEEDVGDHILASLRAYGKPVDGIVTFADSFWYYIARIAHEIGVE
FT                   TAPPDSMRIATNKFLTSKYVGHDAYLASNVDEALRIAKEVALPYPLIVKPCDGWSSEGV
FT                   SRVESPDAFPAAVKSIDTSRHGTEFVMEPYCDGPEVDVNLVLLDGEVLFAEICDDLPKS
FT                   ADVNGLTVGSLTNFHELYSVYPSALPSKELELLIHSFVDTLLRLGIRNGVMHLEGRVQN
FT                   SSMEYREQNRMMHLQPRAPQATRPEPSAWLIEINPRPLGMTGSHIIESTYGIDYWGLAA
FT                   VLGVGDKDRARALSQPYRDGPQYTCVMVFIPADFPPSSQGIFDTDDICADLLARRPDLA
FT                   QHISRCATLVRRGQKVAHPTTGRHTFLAYFNVFSRAGREEALDLARQVREEVRYSFL"
FT   CDS_pept        join(743567..743776,743843..744944,744995..745847,
FT                   745909..747252,747323..747671)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264300"
FT                   /orf_name="AFUA_6G03470"
FT                   /product="ABC multidrug transporter, putative "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85692.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000051EA6B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD46"
FT                   /transl_table=1
FT                   /translation="MTPPQMVSQLDDARLDERQRAILDRQLHGLGGETKQRKNVFAYAT
FT                   VSDRIVLSVSSICAVLAGALNPLVPVIYGLLVSVYDGFAAGTVSASELRSKTATFSLYY
FT                   VYLSIGLFAFTYVATVGFYYTGERMARALRTTYLAAILRQNMAFFDLLGPGEITSRIMS
FT                   DMGTVQEAVTSKLAVMLTAIATFCAAFVVAFIMYWKTALIISPFFVIMIVTETLGGAYM
FT                   VRHHKRAMELYSQAAGIAEEAIAAIKHVTAFGIQTLLSQRYLSVLEQAAKADRKAENMV
FT                   AGMIAWMNAMPNLIYALAFWAGSIYLTRGQMSVAEVSATTLAVTIGSFAIIRIAPSAQA
FT                   LLSGIAITGEILKSIARRSPQDPLVKEGDEPSTVVGDIVLDRVGLIYPSRDDVDILQDV
FT                   SLRCAAMKKTAIVGSSGSGKSSILGLVERFYEPTSGTVLLDGRDIQSLNLRWLRRQIAL
FT                   VDQMPVLFNATILENILYGCSDMVSQWSESEQLDRVVQASKKANAHDFISALPDGYHTH
FT                   VGEKGLQLSGGQRQRVAIARALIRDPKILLLDEATSALDSKSEAMVQEALDAAAEHRTT
FT                   IIVAHRLSTIQNADHIIVLDHGKVVEEGTHHALVAQNGAYAALVQKQQIGDTHDHKAPD
FT                   GARLSIEDDDDEDSRYGGNTEYVDEKDIRTEEVALSSAAHDEGTQRDSLKLSALQTIAF
FT                   IARLSKRDWKVLLFGLANAILAGLTIPVQSVFFAKILTVIGFPPPQYPQLRSEVDFWSG
FT                   LYVMLTGTTFLFWMGVEIALSYATQKLARRVREVCFRSILVQDMAFFDVPGNSPSALSS
FT                   VLSKSTNDLAGLGGPVMGGILTFLSTILAGIVLALAIGWKLALVCTATIPIVVACGWLR
FT                   LQVLSTFDSKVRQSGIESAAYAGELVRTVRTVASLGLEEHALARYEGILAKQAAKSLRS
FT                   ILLASALYAASASVVYLCAALAFWYGGTLIASHEYSTFQVYICFVSLISGSQIAGSIFT
FT                   YAPDASKAMHASREIQDIMNLKPSINKVAPTGPPPAHEGTEKNQPQQNLSACRVEFEHV
FT                   SFTYPSRPTRRALDNLHITVEPGQTLALVGQSGSGKSTCVSLLERFYDPDQGRILIDGQ
FT                   DIKLRDVDEYRRDISLVSQETIIFSGTIRDNITVGLAGQEVSDDEILEACKQANILEFV
FT                   QSLPDGLSTLVGTGGSMLSGGQKQRIAIARAFLRKPKILLLDEATSALDSQSEAIVQEA
FT                   MDAIRKDRTTIMVAHRLSTVQNADVICVLQDGKLLEIGTHEQLLGKRGKYWEMVSMQSL
FT                   H"
FT   CDS_pept        join(748395..748766,749139..752014,752228..752451,
FT                   752541..753511)
FT                   /codon_start=1
FT                   /gene_family="HOG000217009" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207672"
FT                   /orf_name="AFUA_6G03480"
FT                   /product="Nonribosomal peptide synthase, putative "
FT                   /EC_number="1.14.17.-"
FT                   /function="L-aminoadipate-semialdehyde dehydrogenase
FT                   activity"
FT                   /function="acyl carrier activity"
FT                   /function="ligase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85691.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0004043"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056259"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000520460"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD47"
FT                   /transl_table=1
FT                   /translation="MLLQDVHHREQLDDDVENAFSKINGTARQASPFADEPSIDVPSTH
FT                   LPVVTPRSKTANDRTGLAKSLPYASLGASRSTIDEQDVLIQTWAILLHQYAVSDTVAFA
FT                   IIGKSDPSGYSGRRASTQVVCLPHLFLDSARATPHAPAVHGWDGRLTYAELDQLSNSVA
FT                   RQLLRRGVRKGQFVPFSFEKSIWMVVAIIGILRAGGVVASIDPSQPQSRAREIIQETGA
FT                   TVIVASTAQASVFAGLVDTVVPIADDTVHPAANDTGLHPSLPPVHPEDPAVVIFTSGST
FT                   GKPKGIVIQHGAVTTRMVAEGRAFQYHGARTLQFAASTWDIFMTDIFTTLAFNGCVCIP
FT                   SEEDRRFNLARFCAEYDVSLALITPSLANLLEPTGFPTLKTLIFGGEALKEEVTRKWEA
FT                   VDGISLHQGYGPAETGPCVAGRLAERPEILGYALDNSVCVLVDPSNPNRLVPLGAVGEL
FT                   VVGGPSLLREYINDPRKTEAAVIENPPWALDLMTPVRRFYRTGDLLRYSVDTLDGRLEF
FT                   VGRTDDQVKYHGQRIELGEIEHHLSRLPGVEACVVVLAKAGFFKDRLVAVVQAGKSSGG
FT                   SSYGTQLSLRSDPNITITHMRRFLSSRLPEFMIPNELLVVQELPHNNSMKLDRGRVAKW
FT                   VADMQSQPSEAVPKPHTRGNELLAHESTARTIAREYARIVAGDSVARRREYEDRDFNLQ
FT                   EGGIDSIQIMSLSMFLTEHFGFQVPMADILSSRATVRSIASLIDANSSPGRGQPLNTQE
FT                   TARLPLRSNGPAPSQQALERNGSRVFLTGASGFLGIEILRQLLARPKTHVYALVRGSSE
FT                   SQARERLVQKAISAGWWQDAYRTRLHVWHGDLTQPQLGLSQLQWQMLQGKASPSIDAII
FT                   HNGAKVHYSQDYETLKKTNVSPTVELLKAVHDREEPLHSFVFVSGGQQLSFDDREDEKN
FT                   AAKSLKGSGYARSKAVSEQIVRRFANQKGSKARHVRIVKPGFIIGDAERGLANQSDFIW
FT                   RLIAACVELGFYNGDEADSWLFISDITRVAQVILHSVFEDDSQPVTKVLDGLRFKTLWA
FT                   LLQDKFGFELQPLSRREWLARLKHSVATKKEKHVLLREQFPALHHGVVPFNNAAGTVVH
FT                   REAAESTHRYMTSFPYELGRDDPASAAKTQRLQDRFAELAAFMNADPDEIAFGQSTTFL
FT                   LRSLGQALKPLLNSDCEIIVSILCHEGSAAAWVALAKDLGIAIKWWAPPPGDDPVLSLD
FT                   TLRPLLTPKTRLVACNHVSNVVGTIHPIRQVADLVHRIPGAVLVVDGVAWAPHRPIDVK
FT                   ALDVDFYCFSWYKVFGPHVAQLYGRRSAQKRALAGISHFFLSEMPGLDWRLRLGANSFE
FT                   LEEALVPITRYLKRVGWDNIIAQETVLQDVFLAYLRRRPRVFRIFGEQSSDPAKRVPVI
FT                   TFEVIGHSSTVVANKVNQRGRFRVVSGNCWAPRPTHDVLGLGADGLIRVSFVHYNTVAE
FT                   VQEFCTELDSVLETLNAGI"
FT   CDS_pept        join(754181..754236,754317..754567,754654..754923,
FT                   754997..756186)
FT                   /codon_start=1
FT                   /gene_family="HOG000251017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264301"
FT                   /orf_name="AFUA_6G03490"
FT                   /product="Phenol 2-monooxygenase, putative "
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85690.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG051032"
FT                   /db_xref="HOGENOM:HBG327146"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="UniParc:UPI000051F8D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD48"
FT                   /transl_table=1
FT                   /translation="MSNASDHVDVLIIGAGPAGLTTANSFNGSNCRVRLIDWKPAPLET
FT                   GRADGLKSISLEVLDSFGIGDRVLNDCQPCEEIVLWNPGKDGVIARTMTIPDKVEELGQ
FT                   IERVMVENLYRHKTVQVNWNTQPVRLHIAPVTKDEPEAHPLTITVQNKETLGQETIRAK
FT                   YVVGADGAHSWLRKYLNIGFSGDVTDSTWGVMNLVPKTDFPDIRKVFVVHSRAGTVMGV
FT                   PREDKLVRLYISMDGGNRHTSIDAKSITAENLLQAARAILAPYRLDAARIPWWSAYCVG
FT                   QRVADEFARHNRIFLAGDAVHTHSPKAGQGMNTSIQDGYNIGWKLRYCLEQKASPALLS
FT                   TYQTERRPIAQALIDFDRKYLESFTRRDITHQEFLEAYLAGQRFTTGIQIQYPPSLIVT
FT                   AKHLHAPSHPLATNLAPGKRLPDFQMVNQSDAVPIQAYHRFTSDGRFRLLVFPGDISQA
FT                   LAFGRFSRLGDWLTSHLPPSSGLEIITIHGARRADVELMDLHPAFRPWSDEEGWNYWTV
FT                   YADDDSYHKGHGHVYERCGISKEDGVLVLLRPDGYISLIASFDETHELIDFFDGLQSGP
FT                   RTVPQPERRANL"
FT   CDS_pept        join(756989..757449,757516..758464)
FT                   /codon_start=1
FT                   /gene_family="HOG000217804" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751077"
FT                   /orf_name="AFUA_6G03500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85689.1"
FT                   /db_xref="HOGENOM:HBG056258"
FT                   /db_xref="UniParc:UPI0000520455"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD49"
FT                   /transl_table=1
FT                   /translation="MSGLEILGIAASILQIADLGATVSVKLCTFYRQLKSADQSAQSLS
FT                   SEVALTCSILRQLGENLKQDEQTRLYSAQAFDTAQEVLRECEKVFRRISAAVDESRADA
FT                   TRNALQRAAKRLGFVLMEKELEVLRGNLERLKSTMLLLLNVIMYAGQVRSRAESSVLKE
FT                   QRGLIQVLVEEKKASEARFDQLVKALESADINHHGSGGPDTLPPYEFLAQEDALRELRT
FT                   YHQLVKRLLHEVDACRSGIERSRYARFRNGVVKVHAAEVEGFRRAHGEIVTRLFEDPLF
FT                   SLAPETDTVEAQTPEDDNAEAEGLHRKDAAAKRKRVKLTRHSISPPEASERDRLPLEPS
FT                   GVNYPYAGQIEHSAPSLEVVNERIDADRARDRGFCDYEGTIEGVRPRIGSNTASGRAFG
FT                   RQIRPVVQQQPGQQQQGPPRSEITPLERYMFEVDVIPAPTTKTEDVEEAAETVDDLLLK
FT                   WTTLGQNDLLA"
FT   CDS_pept        join(759084..759208,759252..759282,759330..759467,
FT                   759524..759551,759600..759619,759664..759916,7
FT                   59977..760989)
FT                   /codon_start=1
FT                   /gene_family="HOG000174927" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056383"
FT                   /orf_name="AFUA_6G03510"
FT                   /product="Flavin containing polyamine oxidase, putative "
FT                   /EC_number="1.5.3.11"
FT                   /function="polyamine oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85688.2"
FT                   /db_xref="GO:0046592"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG325057"
FT                   /db_xref="HOGENOM:HBG382229"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI0000F51CE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD50"
FT                   /transl_table=1
FT                   /translation="MRLRDALPFVAGWILQTCEGYVAQQVPLGDHGRCARTTVAILGGG
FT                   MTGITAAQALANASIDDFLILEYRDRLGGRLRHAEFGEDENGNPYVVELGANWIHGVGM
FT                   GVRENPIWQLARKHNLTVTCSNYSSIRTYNETGYTDYRHLQREYAEAYRIASRDAGRIM
FT                   TENLQDQTARTGLALAGWRPRKDDSAAQAVEWWNWDWESAQTPDTSSLVFGLAAENITF
FT                   QQFGARNELVIDPRGYSAIINGEAATFLASENGEPSMDPRVRLQTQVTQIEYSDKGATI
FT                   RNRDGSCVEAAYAICTFSLGVLQNDAVIFRPALPGWKQTAIYKYTMGTYTKIFMQFEEM
FT                   FWPNDTQFFLYASPTARGYFPVFQSLSMEGFLPGSNILFVTVVDAEAYRVERQSDPETQ
FT                   AEILHVLRQMFPDKHIPEPKAFFYPRWSEEPWAYGSYSNWPVGTTLETHQNLRANVQRL
FT                   WFAGEATSSAYFGFAHGAWYEGKEVGEHVAALLQGKCVTLQGQKACGERRHYEVLHGTT
FT                   PLEAYNAINGWPMSSVDL"
FT   CDS_pept        join(complement(765239..765294),complement(764649..765188),
FT                   complement(764416..764599),complement(764308..764364))
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207673"
FT                   /orf_name="AFUA_6G03520"
FT                   /product="Short-chain dehydrogenase/reductase family
FT                   protein, putative"
FT                   /EC_number="1.1.1.47"
FT                   /function="binding"
FT                   /function="glucose 1-dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85687.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0047936"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000051F8CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD51"
FT                   /transl_table=1
FT                   /translation="MASRGRLQGKNAIITGAAGGIGLETSILFAREGANVLMADISAPA
FT                   LEKALAKVKEVVPNAPRVETIKCDVSKESEVQAMVESQDSWGGTDVMFNNAGIMHADDA
FT                   DAVDTPEKIWDLTQNINVKGVWFGCKHAVLSLRRHKKTRGSIINTASVVALVGSATPQL
FT                   AYTASKGAVLALTRELAIVHAREGFRFNALCPAPLNTPLLQDWLGDDQPKRHRREVHFP
FT                   TGRFGEAIEQAHAVVFLASDESSFVNGSDFVVDGGMTKAYVTPEGPATAAPKNLGH"
FT   CDS_pept        join(765935..766370,766432..766688,766735..766787,
FT                   766837..767608)
FT                   /codon_start=1
FT                   /gene_family="HOG000005159" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903121"
FT                   /orf_name="AFUA_6G03530"
FT                   /product="Glutamine synthetase, putative "
FT                   /EC_number="6.3.1.2"
FT                   /function="ATP binding"
FT                   /function="glutamate-ammonia ligase activity"
FT                   /biological_process="glutamine biosynthetic process "
FT                   /protein_id="EAL85686.1"
FT                   /db_xref="GO:0004356"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006542"
FT                   /db_xref="HOGENOM:HBG423373"
FT                   /db_xref="HOGENOM:HBG553755"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniParc:UPI000051FB58"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD52"
FT                   /transl_table=1
FT                   /translation="MSASTSSCKVTLENVAEILKNDTKVKLAGVDVDGQLRGKLISKKK
FT                   FLSIAADGFGFCSVIFGWDMHDRTYFKELAISNKENGYRDLVAVPDLSSFRRIPWENDV
FT                   PFFLVSFFDPETKAPVCACPRGLLKTALSKVEAAGYRAMAGAEYEFYQFRAPGDYSTPE
FT                   RNASATAAFLQKNPVEALPALTEGMFGYSLTRPIHNQEYYYGIFDACEQFNCEIEGWHT
FT                   ESGPGVFEAALQFGEAKEMADKAGLFKYVVKSIGAKHGITPAFMAKPREGLPGNSGHMH
FT                   ISLVTEDGKNAFLRPTPDPSPPYPDVAHLSDLGRHFLAGILTGLPDIMPLFAPTINSYK
FT                   RLVENFWAPVTVSWGLEHRAASIRLITPPTASAKATRFEVRVPGADANPHFVLAAIVAL
FT                   GWRGVEKKLEIPVPPLSKDEDMGGASDQGVRLAKTLKEATVAFMRKESVAREVFGDQFV
FT                   DHFGGTREHEVHLWEEAVTDWFVFPACMTTGMMLTQDREVRRYIETV"
FT   CDS_pept        join(768975..769335,769387..769811,769866..770066,
FT                   770118..770471,770527..770805)
FT                   /codon_start=1
FT                   /gene_family="HOG000238464" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264302"
FT                   /orf_name="AFUA_6G03540"
FT                   /product="Malate synthase AcuE"
FT                   /EC_number="2.3.3.9"
FT                   /function="acyltransferase activity"
FT                   /function="malate synthase activity"
FT                   /biological_process="glyoxylate cycle"
FT                   /protein_id="EAL85685.1"
FT                   /db_xref="GO:0004474"
FT                   /db_xref="GO:0006097"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG007100"
FT                   /db_xref="HOGENOM:HBG649056"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniParc:UPI000051ECA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD53"
FT                   /transl_table=1
FT                   /translation="MSQIEVQLKDVAILGAVNNEHRKILTKEACAFLAILHRTFNPTRK
FT                   ALLQRRIDRQAEIDKGHLPDFLPETKHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMV
FT                   VNALNADVWTYMADFEDSSAPTWANMINGQVNLYDAIRRQIDFKQGNKEYKLRTDRALP
FT                   TLIARARGWHLDEKHFTVDGEPISGSLFDFGLYFFHNAKELVARGHGPYFYLPKMESHL
FT                   EARLWNDVFNLAQDYIGMPRGTIRATVLIETITAAFEMDEIIYELRDHSSGLNCGRWDY
FT                   IFSFIKKFRKHPNFVLPDRSDVTMTVPFMDAYVKLLIKTCHRRGVHAMGGMAAQIPIKD
FT                   DPVANDKAMESVRADKLREVRAGHDGTWVAHPALASIASEVFNKYMPTPNQLFVRRQDV
FT                   NITANDLLNTNVPGKITEEGIRKNLNIGLSYMEGWLRGVGCIPINYLMEDAATAEVSRS
FT                   QLWQWVHHQVTSSEGKKIDKAYALRLLQEQADSLAAKSPKGNKFQLAARYFAGQVTGED
FT                   YADFLTSLLYNEISTPGTASKL"
FT   CDS_pept        771750..772142
FT                   /codon_start=1
FT                   /gene_family="HOG000217805" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207674"
FT                   /orf_name="AFUA_6G03550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85684.1"
FT                   /db_xref="HOGENOM:HBG056257"
FT                   /db_xref="UniParc:UPI000051EF15"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD54"
FT                   /transl_table=1
FT                   /translation="MSQRPTSSHDSSAPHHIPVDDCLTYDTGYRPNLPGQRTWWVFCPV
FT                   TGAFDNSYALLGAMIECVARGQATLAPAWDRTFAGGIWYDFDCGADVLDGRLLMDMAVD
FT                   DMQRRIERYMSTNDGQMGCKPALGFR"
FT   CDS_pept        join(complement(773547..773834),complement(773173..773496))
FT                   /codon_start=1
FT                   /gene_family="HOG000201761" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264303"
FT                   /orf_name="AFUA_6G03560"
FT                   /product="IgE-binding protein, putative "
FT                   /protein_id="EAL85683.1"
FT                   /db_xref="HOGENOM:HBG051349"
FT                   /db_xref="HOGENOM:HBG325733"
FT                   /db_xref="UniParc:UPI000051FB4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD55"
FT                   /transl_table=1
FT                   /translation="MKIPVLFSLLTLASAVSIPIRNNGHSNSYSYHTSNSTKFSVMSAR
FT                   SGSPIHLLPMNAAHGNFWLGESPSTFCPEPVEKVSGCPPGTTTRFASANALDVAVPGGQ
FT                   RIYVDPRGALRFTTAHSGSIPPGSSTGPFVHSAGTPFGHFAYKGQGAKGFIACPKSNGT
FT                   ATHWQVYASVANVASGAECLGFNALAVPSNDTRAAAWEYI"
FT   CDS_pept        join(complement(777339..777911),complement(777110..777281),
FT                   complement(774907..777065),complement(774625..774822))
FT                   /codon_start=1
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264304"
FT                   /gene_name="bglE"
FT                   /orf_name="AFUA_6G03570"
FT                   /product="Probable beta-glucosidase E "
FT                   /EC_number="3.2.1.21"
FT                   /function="beta-glucosidase activity"
FT                   /biological_process="cellulose catabolic process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="EAL85682.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0008422"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0030245"
FT                   /db_xref="HOGENOM:HBG390192"
FT                   /db_xref="HOGENOM:HBG749096"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000520212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WD56"
FT                   /transl_table=1
FT                   /translation="MAPPDSTHGGSFRDHLKTNDRSSTSKGKQRYSPLQEAIPEEISSF
FT                   RSPSEYADTDSDSDLERSGSYKLRPVDRYGSHHSSAFIPVIREENGVETYLDSITEAEQ
FT                   ELLSASKQYDLVDDDDSSDFDSDEEATLRYRLKDRLKRRRARLQAWQPVKYARIWWRTL
FT                   LAVVVTLVVVVWGFLSFAVSHREEPTVWPMVPSDSWFPSPKGGTLKHWEESYKKAQSLV
FT                   RNMTLVEKVNITTGIGWQMGLCVGNTGPADIVKFPSLCLQDGPQGLRFADHVSAFPAGI
FT                   TTGSTWNRELMRERGVAMGREARLKGVNVLLGPSMGPLGMMPAGGRNWEGFGSDPVLQA
FT                   VAAAETIRGIQSNGVMATAKHFVMNEQEHFRQPFEWGIPTALSSNVGDRALHEVFAWPF
FT                   AESIRADVASVMCSYQMVNNSHACENSKLLNGILKDELGFQGFVQSDWLAQRSGINSAL
FT                   GGLDMSMPGDGLHWVDGKSLWGSELTRAVLNTSVPVERLNDMVTRIVAAWYHLGQDTWE
FT                   RPPPEGNGGPNFSSWTNDEVGWLHTGSNDGSYARVNHYVDAQGTGPEAHSIIARKVAAE
FT                   GTVLLKNVDRTLPLSRNASSPSGGILRVGIYGDDAGPALGPNACPDRGCNQGTLATGWG
FT                   SGTVEFPYLVSPIEALESAWSTEIESTAYLRNAVMPADAVDKDLCLVFVNADSGEGYIS
FT                   AGGIHGDRNDLFLQKGGDTLVRTVSSNCGGGQGKTVVVIHAVGPVVMESWIDLPGVHAV
FT                   LLANLPGQESGNALVDVLFGEVDASGRLPYTIGKSLEDYGPGAQVLYEPNAPVPQVDFL
FT                   DALYIDYRHFDRHNITPRFEFGFGLSYTTFELLDLSISPLQQKSRSVPPRPADAVAPPV
FT                   YDISLPDPASALFPAGFQPVFKYIYPYLSNLDGTAPHNYSFYPKGYNETQRPSPAGGGA
FT                   GGHPALYEEMVSVKLQVSNTGDRKGQEVVQVYVSFPPDFPERVLRNFTKIELEPSERRE
FT                   VQMTLSRKDLSYWSTREQNWVMPEGKFQIWVGRSSRDLPLMGEY"
FT   CDS_pept        join(complement(778857..782146),complement(778741..778798))
FT                   /codon_start=1
FT                   /gene_family="HOG000180957" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264305"
FT                   /orf_name="AFUA_6G03580"
FT                   /product="mRNA-nucleus export ATPase (Elf1), putative "
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="chromatin binding"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85681.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG056255"
FT                   /db_xref="HOGENOM:HBG325362"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015688"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000052045F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD57"
FT                   /transl_table=1
FT                   /translation="MPHSEMSAPVVVSKTPSGVPPTVEEVSSLMNTIFTAETSQQSLDA
FT                   AYGLTNLLIQSVGTFGLQRYNILPEIKRAATDKKSGARRESAMLIIGALFERFPREHPL
FT                   SEVVFLLQDGGVLNLALDSLADKGAVVRDAAQYAIDALFDCLKPESLVNALIPALSAYL
FT                   NKSSGKWQGFVGAYALLEKMAIKAQIGMGTMEEERQKDLLRSAMGKTLKELIPLVESGM
FT                   HDLKNEVAKQASKTMTALTTLLDNDDVAPRIPLLIKTMEQPSEQTLQNAIHALSQTTFV
FT                   AIVTSPVLALLTPLLERSLNAPTTPQETLRRTVVVVENLTKLVHDPAEARTFLPKLKPG
FT                   VQAVKDRASLPEVRELATRAMNVIDKAMGDSSLAAGSVAKTTAEDVLTVLEAKIKENGG
FT                   LAVPSEHTLFELGKSYIAEMVREDVNARMHDRIPACVGPYLRGLLQDDKHEAVASAVQE
FT                   HFIEEDHRKFGKPVPDDPNEVEIVNANFSLAYGGMLLLSHTNLRLLKGHRYGLCGRNGA
FT                   GKSTLMRSIANEKLEGFPPQDVVRTCFVEHNQGEDADLSIIEYVSKDPKIAEAGQEHIS
FT                   RILLEFGFTDGPEGRQNQRVGSLSGGWKMKLALARAMLMKADVLLLDEPTNHLDVANVK
FT                   WLQEYLKKHTDITSLIVSHDSGFLDEVCTDIYHYEGKKLVHYKGNLAAFVKQKPEAKSY
FT                   YTLSSSMVQFKFPPPGILSGIKSNTRSILRMTNCSYTYPGASKPSLVDASLSLSLSSRV
FT                   AIIGGNGAGKSTFIKMLTGETIPQTGKVEKHPNLRIGYIKQHALEHVEMHLEKTPSQYL
FT                   QWRYANGDDREVFLKQTRILTEQDKAQMEKPVDLGDGRGPRRIEAIMGRQKWKKTFQYE
FT                   VKWVGLLPKHNTMISRETLVELGFFKLVQEFDDHEASREGLGFRVLEPKAISKHFEDIG
FT                   LDPEIANHNQISGLSGGQKVKVVLAGAMWNNPHLLVLDEPTNFLDRDSLGGLAVAIRDF
FT                   KGGVVMISHNEEFVGALCPEQLHIADGRIVARTNTAVALDRFEDSAASSPQPGSTVANS
FT                   AATSAAPSAVNSGAEDQGELKFKARKKKKMTRAQLKEREARRRLRHLEWLQSPKGTPKP
FT                   PDTDDEAE"
FT   CDS_pept        join(783347..783394,783453..784601,784666..784866)
FT                   /codon_start=1
FT                   /gene_family="HOG000130831" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI16264306"
FT                   /gene_name="mcsA"
FT                   /orf_name="AFUA_6G03590"
FT                   /product="Citrate synthase Cit1, putative "
FT                   /EC_number="2.3.3.1"
FT                   /EC_number="2.3.3.5"
FT                   /function="2-methylcitrate synthase activity"
FT                   /function="acyltransferase activity"
FT                   /function="citrate (Si)-synthase activity"
FT                   /biological_process="cellular carbohydrate metabolic
FT                   process"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="EAL85680.1"
FT                   /db_xref="EMBL:CAI61947.1"
FT                   /db_xref="GO:0004108"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0044262"
FT                   /db_xref="GO:0050440"
FT                   /db_xref="HOGENOM:HBG127450"
FT                   /db_xref="HOGENOM:HBG309523"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="UniParc:UPI000050BF2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q50I20"
FT                   /transl_table=1
FT                   /translation="MAMTMRSTRHASKLAQTARLALTNSRRYSTAEPDLKTALKAVIPA
FT                   KRELFKQVKERSDEVIGEVKVANVIGGMRGLKSMLWEGSVLDPEEGIRFHGKTIKDCQK
FT                   ELPKGTSGTEMLPEAMFWLLLTGQVPSTNQVRAFSRELAEQSHLPQHILDLIKSFPRSM
FT                   HPMTQLSIAVAALNTESKFAKAYEKGLSKADYWEPTFDDSISLLAKIPRVAALVFRPDE
FT                   VDQVGTQALDASQDWSYNFAELLGKGGKENQDFHDLLRLYLALHGDHEGGNVSAHATHL
FT                   VGSALSDPFLSYSAGLLGLAGPLHGLAAQEVLRWILAMQDKIGTKFTDDDVRNYLWDTL
FT                   KSGRVVPGYGHGVLRKPDPRFQALMDFAATRPDVLANPVFQLVKKNSEIAPAVLTEHGK
FT                   TKNPHPNVDAASGVLFYHYGFQQPLYYTVTFGVSRALGPLVQLIWDRALGLPIERPKSI
FT                   NLLGLKK"
FT   sig_peptide     join(783347..783394,783453..783488)
FT                   /db_xref="UniProtKB/TrEMBL:Q50I20 "
FT   mat_peptide     join(783489..784601,784666..784863)
FT                   /product="methylcitrate synthase"
FT                   /db_xref="UniProtKB/TrEMBL:Q50I20 "
FT   CDS_pept        join(complement(786433..786646),complement(786292..786359),
FT                   complement(785988..786237),complement(785658..785881),
FT                   complement(785080..785526))
FT                   /codon_start=1
FT                   /gene_family="HOG000217806" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903122"
FT                   /orf_name="AFUA_6G03600"
FT                   /product="Integral membrane protein (Pth11), putative "
FT                   /protein_id="EAL85679.1"
FT                   /db_xref="HOGENOM:HBG056254"
FT                   /db_xref="HOGENOM:HBG327871"
FT                   /db_xref="UniParc:UPI000051F8C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD59"
FT                   /transl_table=1
FT                   /translation="MGWVYNLETPDPHSQVPRVIAICLVFPIVAFLAVLLRLYVRIHTK
FT                   RAAGVDDYAALFSSILAIAYGAISIAQSRWGLGLDAKYFPKENVVPFSRVQYAGGPVYT
FT                   LALLGFKVSLLASYLRIGGFVKAYRTVIIAVIVACVCNQLAFTFVLCFACRPIARQWDM
FT                   SIQGSCIDTVASYYGTSLAFDCIIIALPLPVLITLRLQRRQKAALLAVFALGFFVTIIQ
FT                   IIRIFTIKNLKTYTDSQPIVLWSVIEISLGVIISCIPTYGPLFHSLSLISSTRRRHADG
FT                   YRSQSYRLNSQSNHPTGYIHGSGSRPFDSSIPATTTIMSTAVEREQERERDKVSSDGDS
FT                   EERILAPCAQTNPKGHSQSRAQRSGSETTLEELKGMRETGIHTVTEVTVESHSVKECGW
FT                   N"
FT   mobile_element  787740..788336
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  787743..788333
FT                   /mobile_element_type="transposon:mariner_ant1 transposon
FT                   family"
FT   mobile_element  788414..789250
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(complement(791471..791742),complement(789961..791404))
FT                   /codon_start=1
FT                   /gene_family="HOG000159116" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751078"
FT                   /orf_name="AFUA_6G03620"
FT                   /product="FAD/FMN-containing isoamyl alcohol oxidase MreA "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL85677.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG050884"
FT                   /db_xref="HOGENOM:HBG323919"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI000051F8D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD61"
FT                   /transl_table=1
FT                   /translation="MFPSTNRSWSILAGLLALASTASASNASQTACRCFPGEACWPSPQ
FT                   VWSAFNQSIDGRLVATVPLGTPCHAPNYDAATCEALKAQWQLPEIHYESSSSIMAPFFT
FT                   NGTCDPFHPVSKPCTLGNYVVYAVNVSRPEHIRTAMQFATKHNIRVVVRNTGHDYNGKS
FT                   TGAGALAIWTHHLKDIEIKDWSDQHYQGKAIKVGAGVQGIEAYRAADTNGLEVVGGECP
FT                   TVGLAGGYTQGGGHSALASRHGLAADQVLEWEVIDGQGNFLVANRDNEHADLYWALSGG
FT                   GGGTYGVVWSMTSKAHAGTPVSGLNLTFTNAGISQDTFYEAVALYHSTLPAIVDAGAMS
FT                   VWYFTNTSFSISPLTGPNIPVAKLRELVRPFTDGLTRLGITYTTYAAQFDSYLAEFEAM
FT                   QSPIEVGIAQYGGWLIPRSVVQTNNAELTAAYRAITSDGATFIGVGLNVSTAVTGDVSN
FT                   AVLPAWRDTLIDTVITTPWNWTAPTADMIALQHKMTDEYIPRLEALAPQSGAYLNEADF
FT                   RQPNFQTAFYGANYQKLRAIKAKYDPNSLFYGTTAVGSDEWTVTSDGHLCKATP"
FT   CDS_pept        join(complement(794196..794205),complement(794017..794145),
FT                   complement(792628..793969),complement(792141..792558))
FT                   /codon_start=1
FT                   /gene_family="HOG000044189" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264307"
FT                   /orf_name="AFUA_6G03630"
FT                   /product="Very-long-chain acyl-CoA synthetase family
FT                   protein (CefD1), putative"
FT                   /EC_number="6.2.1.-"
FT                   /function="ligase activity"
FT                   /protein_id="EAL85676.2"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG058423"
FT                   /db_xref="HOGENOM:HBG712034"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000F51CE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD62"
FT                   /transl_table=1
FT                   /translation="MSLGVAAAAVAGGATLAAYLNAKFHITKDISTLYVAWKSNRSFEQ
FT                   AAAKGLGNVWFVFLETAAKYPDMVCMWTREGIYTYRDVQNLACQYAHYFLAQGVKQGDL
FT                   VAFYLQNRAEFMIAWLALCSIGCAPAAINYNLTGDALVHCLKISGAKLVLVDDDEACRA
FT                   RIDDSRAAIEGPLGMELIYLDHSFASQVSSFPTTKPPKEFAQSMSGADPAILLYTSGTT
FT                   GMPKGCAFTMARLYSTLALRRGSMEDTDGPGGDIWYSCMPLYHGTAAVAMMVCLTTGVS
FT                   IALGKKFSVRNFWRDIRDSHATVFVYVGEVARYLLAAPPSPDDRNHSVRCMYGNGLRPD
FT                   IWEKFQQRFGISAVAEFFNSTEGLFGLFNLNKGPFTAGSVGHHGLLMRAIMHNTFVPVA
FT                   IDPTTGDVLRDPKTGFAMRAPYDQGGEILVNVPNEQAFQGYWRNESATSKKFLRDVFTK
FT                   GDLWYRSGDALRRQSDGRWYFLDRLGDTFRWKSENVATAEVAEILGRYPGIQEANVYGV
FT                   LVPHHEGRAGCAALHLSPEAREAFDFRGLAAFARARLPRYAVPVFLRIVETSAHIHNHK
FT                   QNKVPLREEGIDPAKIGSKVPEGRDDKFYWLPPGADGYVEFGKREWETMLAGSARL"
FT   CDS_pept        join(complement(796440..797211),complement(795920..796392))
FT                   /codon_start=1
FT                   /gene_family="HOG000221021" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264308"
FT                   /orf_name="AFUA_6G03640"
FT                   /product="Aminotransferase, putative "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL85675.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG344231"
FT                   /db_xref="HOGENOM:HBG649839"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051F673"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD63"
FT                   /transl_table=1
FT                   /translation="MDSSPPKSLRESLRQALLRREAKSSRRRLTVLPQSSVDFSSNDFL
FT                   SLSTSPAFRGRFLDLLHRAPPLYPFASGGSRLLDGNSTDAEELEKFIAEFHSAPSGLLF
FT                   NSGFDANVGVFSCIPQPGDLIVYDELIHASAREGMRLSRAGKRVPFSHSSPDSLDEVLQ
FT                   SHIAADPLIQRGSRSVFIAIESIYSMDGDIAPIQDFLRVVDRLLPQGNSYFIVDEAHAT
FT                   GVFGPRGAGVVQSLGVEKRMFIRVHTFGKALASHGAIVLCCPDTRDYLINYARSLIYTT
FT                   AMGFPFLASIRAAYELLVEGQTEPHQTKLQQLVAYFRDRLAELDAGDSAAFQVDHFPTS
FT                   PIFSVRSRFPRQLAAACQQKGYVVRAIMAPTVPAGRERVRVCLHAGNTMEEIDGLVDTF
FT                   KVWLSQTMEKKVARL"
FT   mobile_element  complement(798042..798878)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(798956..799552)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(798959..799549)
FT                   /mobile_element_type="transposon:mariner_ant1 transposon
FT                   family"
FT   CDS_pept        join(799968..800252,800301..802463)
FT                   /codon_start=1
FT                   /gene_family="HOG000201750" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264309"
FT                   /orf_name="AFUA_6G03660"
FT                   /product="Onanonoxo-7-onima-8-eninoihtemlysoneda "
FT                   /EC_number="2.6.1.62"
FT                   /function="adenosylmethionine-8-amino-7-oxononanoate
FT                   transaminase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="EAL85673.1"
FT                   /db_xref="GO:0004015"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG317140"
FT                   /db_xref="HOGENOM:HBG342737"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0000520454"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD65"
FT                   /transl_table=1
FT                   /translation="MPPVRAALWRTLRAHQVYGANTDVGKTIVSTILCNAVQRRRAEKA
FT                   AFLKPVSTGPLDEADDRHIQRHAAGALTKCLHQFDEPVSPHIAAQKKNLVIPRDDEILG
FT                   SVHKTLSEWARTGVTFALVETAGGVHSPGPNGSSQADLYRPLRLPVVLVADSRLGGISS
FT                   SISAYESLLLRGYDVNSVLLFRDDYYKNHEYLGNYFRNKSIPLVPLPQPPKRPSSQDAA
FT                   SLARDEEAMAGYYQRVAQESDVQGLLDELAVRNAERLDRLESMASRAHHTIWYPFTQHH
FT                   GMTAKDITVIDSAHGDYFQTFESSGNADQGNLQPTFDGSASWWTQGLGHGNPELALSAA
FT                   YAAGRYGHVMFAGNVHEPALSLAELLKDTLGNPRLQKVFYTDNGSTGMEVAVKMGLRAA
FT                   CHRYGWDASKEQISILGLKGSYHGDTIGVMDCSEPSTYNQKVEWYRGRGYWFDFPLVKL
FT                   SQGTWKVEIPKELRDALGEDLEFSSLNSVFDLETRVRSEVGQRYRDFIRTTIEDLVHKQ
FT                   GMKFGSLIMEPIILGAGGMLFCDPLFQRCLADVVRGHPELFTNNPTAANSVGSETSWSG
FT                   LPIIFDEVFTGLYRLGRKSAASFLNVHPDVAVNAKLLTGGLVPLCTTLASEEIFQAFSS
FT                   PEKSDALLHGHSYTAHAVGCTVAVDSLRAMTKMESSGSWDAYRGDWKAVDVSGEDNSPE
FT                   VWSVWSRDLLRDLSYADSVESVFALGTVLSISLRDAQGGGKFSHEDHFSPDSSRLTCDL
FT                   VPTTLGYTSTAAKGLQQRLSAGGPQFNVHSRVLGNVLYLMSSITSKPETVRGLEELLRS
FT                   ALL"
FT   CDS_pept        803567..804814
FT                   /codon_start=1
FT                   /gene_family="HOG000239957" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903123"
FT                   /orf_name="AFUA_6G03670"
FT                   /product="Biotin synthase, putative "
FT                   /EC_number="2.8.1.6"
FT                   /function="biotin synthase activity"
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="biotin biosynthetic process "
FT                   /protein_id="EAL85672.1"
FT                   /db_xref="GO:0004076"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009102"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG286276"
FT                   /db_xref="HOGENOM:HBG405569"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000051E5C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD66"
FT                   /transl_table=1
FT                   /translation="MSLSLSRSLHRALLRRSYGTVQAPPSAASLAANRIPPALQEATAA
FT                   TAPRTNWSREEVQQIYETPLSQLTYAAVGRSLISYFSMDTDFCKATVHRRFHDPAAIQM
FT                   CTLMNIKTGGCSEDCSYCAQSSRYNTGLKATKMSPVDEVLKAARIAKDNGSTRFCMGAA
FT                   WRDMRGRKTSLKNIKEMVSGVRAMGMEVCVTLGMIDENQAKELKDAGLTAYNHNLDTSR
FT                   EFYPSIITTRSYDERLRTLSHVRDAGINVCSGGILGLGEADSDRIGLIHTVANLPSHPE
FT                   SFPVNALVPIKGTPLGDRKMIPFDKLLRTIATARIVLPATIVRLAAGRISLSEEQQVAC
FT                   FMAGANAVFTGEKMLTTDCNGWDEDREMFERWGFYPMRSFEKEGSTQPAVEAPSAAAPA
FT                   PAAHDSVSAAPAAASS"
FT   CDS_pept        complement(807119..808177)
FT                   /codon_start=1
FT                   /gene_family="HOG000217807" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207675"
FT                   /orf_name="AFUA_6G03680"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL85671.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056251"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003E6160"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD67"
FT                   /transl_table=1
FT                   /translation="MSVVVLVSKPTAHFSELASHHRVRVIITLAKATMSHPDLSTILEV
FT                   YPECEVTCYGYAPSQRRRCRMRTRKDNRDRASYLLEEGTRYLQRGLPVDGLLIELAPLV
FT                   LCTRFHQYQADDLVRDWRAKLREFQQQTLLNAMLKSLQELVDSRARSRAARSAGRRLPE
FT                   RVSSPTRLERSAAIVTEEEPAAPEREEEEEERGDREDEPEPEPEPEPELTPSRSSTETS
FT                   SPAVEAHVAEPTVPQTESRRVTRKPIEGDCTICLCPLREQDSDENGEGSEDRDDENEDD
FT                   AAGTGSGTASDEHDAPEEHDDDDLVYCKNQCGTNYHKACIDVWHATQRTFETPRGDPIG
FT                   LSCPYCRAAWSS"
FT   tRNA            complement(809244..809379)
FT   CDS_pept        join(complement(813129..813362),complement(812810..813075),
FT                   complement(810702..812757),complement(810027..810653))
FT                   /codon_start=1
FT                   /gene_family="HOG000265621" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264310"
FT                   /orf_name="AFUA_6G03690"
FT                   /product="Sodium P-type ATPase, putative "
FT                   /EC_number="3.6.3.7"
FT                   /function="ATP binding"
FT                   /function="sodium-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85670.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0008554"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG456486"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006414"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051FFD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD68"
FT                   /transl_table=1
FT                   /translation="MGAQKKQSSDNSQALSQPAHALRYEDVLRELAVDPDQGLTVGEAK
FT                   RRLQQYGPNELEGGEGVSIVKIVIRQIANAMMLVLIIAMAVSFGIQSWIEGGVIGAVIG
FT                   LNIVVGVYQDYAAEKTMDSLRSLSSPTGTVTRDGKTSTIPANEIVPGDMIELKVGDTVP
FT                   ADLRLVDAMNFETDEALLTGESLPVQKEVDTTFDPDTGPGDRLNIAYSSSTVTRGRARG
FT                   VVISTGMQTEIGAIAAALRASDSKRRPVKRGPEGETKKRWYVQAWTLTCTDAVGRFLGI
FT                   NVGTPLQRKLSKLALALFAIAIIFAIIVMGVNGFRNDKEVIIYAVATGLAMIPACLVVV
FT                   LTITMAVGTKQMVERHVIVRKLDSLEALGAVTNICSDKTGTLTQGRMVAKRAWIPSVGT
FT                   FSVGSSNNPLNPEEGDLSLLPDPPVKVGPDAHGEPSRPEDLLKDNPLLEQYLNVAAMAN
FT                   LAHVHRSEHNEWQARGEPTDIAIQVFASRFNWGRDRWTKGEKPVWRQKAEYPFDSTVKK
FT                   MSVIFKNTNDDREMIFTKGAVERVIEACTTVTWTAGSDPIALDENIKEEILQNMEALAK
FT                   EGLRVLCLACRENHNPVKGEVVPAREEVEKDLTFCGLIGLYDPPRPETAGAIDECYRAG
FT                   ISVHMVTGDHPGTARAIAAQVGIIPANMDSLAKDVADAMVMTASQFDKLTDEEIDALPT
FT                   LPAVIARCAPNTKVRMIDALHRRGRFAAMTGDGVNDSPSLKRADVGIAMGQSGSDVAKD
FT                   ASELVLTDDNFASIINGIEEGRRIFDNIQKFVLHLLAENVGLALTLLIGLCFKDDNGQS
FT                   VFPIAPVEILWIIMITSGLPDMGLGMEIAAPDIMDRPPQSKQGIFTWEVIVDTMVYGVW
FT                   MAALCLASFSLVLFGWGDGNLASGCNSDYSPECDGVFRARATTFVCMTWFALFLAWEMI
FT                   DMRRSFFRMQPNSKRYFTQWMFDVWRNKFLFSGIMIGFVTTFPILYIPVINDVVFKHVG
FT                   ISWEWGVVFVEAILFFAGCEAWKWCKRIYFRHTSQKETGRERVLRDFSRYTTMSRSETQ
FT                   ATGDLNVEKSMV"
FT   CDS_pept        join(complement(816320..817408),complement(815810..816262))
FT                   /codon_start=1
FT                   /gene_family="HOG000217810" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207676"
FT                   /orf_name="AFUA_6G03700"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85669.1"
FT                   /db_xref="HOGENOM:HBG056250"
FT                   /db_xref="UniParc:UPI000051F8D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD69"
FT                   /transl_table=1
FT                   /translation="MRRPADLQTALLPGCTHDSSLQAANSLVLSGSDRSRLNYLQDSVL
FT                   VTILGKQWPWSTVSYTYHRVAVKEPMVMSMILATTASEIHRSRLHDSDSTCLYSAAGDF
FT                   SDIDGRVHYGTALSRLREALAEGVKTSSKLEAVFITLWLMIDYENRFGSGASTINIHLQ
FT                   GIESILHNHILPLLKYEDCSAAAITAESPGAAGLLFDNSAEGASLTERVARSPVDSVAG
FT                   PSAGKLVYTAVPLFLLWTLYFFTPGALFFGPGAVYEPGFEKVNDDLYRLFRLFLHAEDE
FT                   NTRLNLENLYRISRQSPSKFWGEAYPAKAQLDDLENYPGLALYHKSHVVQFRITELFRQ
FT                   ARGTPWNEAPYQQTVDEIIRIANEFEMLLSSAKAAPSCDIVGDGRRVMETIYWAAITYY
FT                   STIVYFHLCFDRLLPDNLQTVLMPQEKAVSLVLELSLKLHRSRPHLMVRITWPLFMAGV
FT                   ATADRIYQDWVSIRLRELGRYGQNYSRISQRFDEIIRGSDPFAYSQKQLPYYNAD"
FT   CDS_pept        join(818174..818266,818314..819110,819160..819299,
FT                   819352..819569)
FT                   /codon_start=1
FT                   /gene_family="HOG000251261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903124"
FT                   /orf_name="AFUA_6G03710"
FT                   /product="Amidohydrolase, putative "
FT                   /EC_number="3.-.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL85668.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG164372"
FT                   /db_xref="HOGENOM:HBG487162"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="UniParc:UPI000051E821"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD70"
FT                   /transl_table=1
FT                   /translation="MQLSVSQQLFIGSVRNAIHKYDAQLKDINNKIWSNPELAYEEHKA
FT                   HDHICELFNTLEGYEVRRKAYGLSTALEIEYKHGAGGRVVVFNAEYDALPNIGHACGHN
FT                   LIATSSIAAFIATCEALKIHCPEGLGYTVRLLGTPAEESGGGKVRLLDNGAYKDVDACL
FT                   MVHPMPLIPNAPDLLCIAATVPGGFLANDKVRVTFTGKPAHAAAAPWEGINALDAVVSA
FT                   YVNISLLRQQLRPAERVHGIIVNGGDRPNVIPMSATVDYYIRSDTVKSLKVLTNKVIKC
FT                   FEAAAVATGCKVDFEWGISYADLKTNRPICQSFVSAMRAMGHHALYDNAGQPNTSGGGS
FT                   TDMGNVSYAVPGFHGMFTIAAEGVNHTPEFTAGAGSQASYRRCLDCAAGMAVVACQMLV
FT                   DNDFAAQVKEDFQRDA"
FT   CDS_pept        join(820001..820143,820192..820717,820778..820996,
FT                   821103..821195,821251..821316,821373..821585)
FT                   /codon_start=1
FT                   /gene_family="HOG000048641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207677"
FT                   /orf_name="AFUA_6G03720"
FT                   /product="MFS allantoate transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL85667.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG056249"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051ECA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD71"
FT                   /transl_table=1
FT                   /translation="MGNMSSEKTLQNNKHADDLGEGAMQQIQECSAFSSTAEKRLVRKI
FT                   DIMILPIMTFACMMAFLDKQALSYTAIMGLRTDLNLKGSEYSWSGSIFYFGYLFFSYPA
FT                   SILMVKFPLGKYLACNLFVILPKRLGLILTMNSMLWAIVLACHAATTNFAGLMVARFFL
FT                   GCTEASVSSGFSLITSLWYRTSEQPLRHGIWFCGNSISMIIGNLVAMGIWQIKTGLQPW
FT                   KWLFIIFGIVTFLWGILMFFRLPDTPNTASFLTEAEKLLATERLKANNAGYKRNKIDTS
FT                   QIIEAFIDPKTWLLAPHSLRLRLLNLQDLAAGYARWRCNPRLRLTLLHHILQNPQLPLH
FT                   RHRRSRLYQHPRQRPCLRHRVHRRAVRRPPSHGGVLGQHAPEPGNGCFEYRRVQQAGDC
FT                   QRDLFRHVLHGEYCWAAVVL"
FT   CDS_pept        join(complement(823572..823850),complement(822681..823458),
FT                   complement(822445..822629),complement(821958..822392))
FT                   /codon_start=1
FT                   /gene_family="HOG000159916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056384"
FT                   /orf_name="AFUA_6G03730"
FT                   /product="2-methylcitrate dehydratase, putative "
FT                   /EC_number="4.2.1.79"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="2-methylcitrate dehydratase activity "
FT                   /biological_process="propionate catabolic process, 2-
FT                   methylcitrate cycle"
FT                   /protein_id="EAL85666.1"
FT                   /db_xref="GO:0019629"
FT                   /db_xref="GO:0047547"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="HOGENOM:HBG006969"
FT                   /db_xref="HOGENOM:HBG298383"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="UniParc:UPI000052092C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD72"
FT                   /transl_table=1
FT                   /translation="MSASCSALRRLTHRSPRTLPSRIVSVSRPSSRIVARNSFTKAVNP
FT                   CAPRVSQFSTMTALQHGAPAAPTERNYDPEIKDMADYVHNYSVNSDLAYDTARLVFLDT
FT                   LGCGLEALRFKECAKLLGPVVEGTVVPNGTRVPGTPYQLDPVNGAFNIGAMIRWLDYND
FT                   CWLAAEWGHPSDNLGGILAVADWISRTNRAGGNLGNGKIVKVKEVLEAMIKAHEIQGVL
FT                   ALENSYNRVGLDHVVLVKVATTAVVAKMLGLNEKQTADAITQAWVDGQSLRTYRHSPNT
FT                   MSRKSWAAGDACQRAVNLVLKVQKGEGGVPTVLSAPVWGFYDVLFKGNKFKFQRPYGSY
FT                   VMENVLFKVSYPAEFHSQTAIECAQIINRKLAAMGKSAKDIKEITNRTHEACIRIIDKQ
FT                   FKAMDNFADRDHCVQYMVATMLAFNRLTAEDYADGSEAATSPLVEDLRKRIRCVEDPQF
FT                   TRDYHDPAKRTIPNALTVTLNDGTVLEEVVVEAPLGHRFRREEAKPEILSKYKRHLEAH
FT                   FDQARIDELLKIGLDRSSLENYDVDKYVDLYVKDKMVVAAQ"
FT   CDS_pept        join(complement(825227..826689),complement(824712..825135))
FT                   /codon_start=1
FT                   /gene_family="HOG000201738" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264311"
FT                   /orf_name="AFUA_6G03740"
FT                   /product="C-5 cytosine methyltransferase DmtA "
FT                   /function="DNA binding"
FT                   /function="methyltransferase activity"
FT                   /biological_process="DNA methylation"
FT                   /protein_id="EAL85665.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006306"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG056248"
FT                   /db_xref="HOGENOM:HBG327867"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="UniParc:UPI000051EA62"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD73"
FT                   /transl_table=1
FT                   /translation="MNRPTNDSLHSQEPPQPSEPICLDDSDDNSSVCDTYSNTDSSVTI
FT                   DNDPDRSFFLDDEQFHPGGGRRTPTPFHIGPQTHQEIIDLTSGPELLVTEGDYLTDECF
FT                   ERLLRDWSRPGPAAAPLPIREASEWEKRPIDHACVDGIVYKAGHSLELHNGLFLRIETV
FT                   LQDTAEEIFFQGRHLIRTWNHKGTYIPKWSNELVWIVNESTEVPLSFVKRFINIRFTNC
FT                   CHVEQDLQKRNRPNDLFCRLKENLKSSQAAVEYLSFEDSDEGFAIGSMSLRHSWRGETR
FT                   PFGSADANSQPQSPIIVLDADPVIDLTGIEKEDARVQKKHRKYTFGDGFCGAGGVSCGA
FT                   SKAGLHIKWAFDKSENAITTYRLNFATAVCEACDIFCFLTNKLEELKVDVSHGSPPCQT
FT                   FSPAHTINSVNDDDNSACIFSCADMIKKSRPRVHTMEETSGLFDRHKETFHRVIQDFIE
FT                   IGYSVRWRILNCMDYGVPQSRRRLIIIASGPGEVLPPFPKPTHGLPGSGLSDYTTINQM
FT                   IANIPPNAPDHDIEGARSRGLRNGTRVPFDPNQQAKTVTCSGGENNYHPSGTRGFTNRE
FT                   FACLQTFPLDYRFGAREVRRQIGNAVPPALSKAIYREIIKSLQRTDEQELRG"
FT   CDS_pept        join(827896..827980,828049..828501,828561..829248,
FT                   829306..829831)
FT                   /codon_start=1
FT                   /gene_family="HOG000033687" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751079"
FT                   /orf_name="AFUA_6G03750"
FT                   /product="Amidophosphoribosyltransferase "
FT                   /EC_number="2.4.2.14"
FT                   /function="amidophosphoribosyltransferase activity "
FT                   /function="metal ion binding"
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="purine base biosynthetic process "
FT                   /biological_process="purine nucleotide biosynthetic process"
FT                   /protein_id="EAL85664.1"
FT                   /db_xref="GO:0004044"
FT                   /db_xref="GO:0006164"
FT                   /db_xref="GO:0009113"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG392416"
FT                   /db_xref="HOGENOM:HBG410483"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI000051ECAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD74"
FT                   /transl_table=1
FT                   /translation="MCGIIGLILANPKSSAAVDLHEALYLLQHRGQDAAGIATCAAGGR
FT                   IYQLKANGMAAKVFNDGARVADLPGFMGIGHLRYPTAGSSANAEAQPFYVNSPYGICLA
FT                   HNGNLINAPELKRYLDLEAHRHINTDSDSELMLNIFADELSETKKARVNREDLFASLSR
FT                   MYERCQGGWACTAMLAGFGILGFRDSYGIRPLVLGSRPSLDGPGTDYMMASESVALHQL
FT                   GFSNFRDIQPGEAVIIEKGGEPVFRQVAPKKAYAPDIFEYVYFARPDSVIDGISVYRSR
FT                   QRMGDRLAARILDVLGPEIVKDIDVVIPIPETSTTSAAAVARYLDKPYCQGFVKNRYVF
FT                   RTFIMPEQKTRQKGVRRKLNAMQAEFKDRNVLLVDDSIVRGTTSREIVTMAREAGAKKV
FT                   YFASCAPEITHAHVYGIDLASPSELVAHGRDANSIARHIGADSVIFQTLDDLIGACAEI
FT                   TKENGLSEPVNFEVGVFCGNYITPIDDGYFDHLEKIRGEGRKIKAVDRAKEAVTHGFAN
FT                   EEDYQIAANGVKLDQHGKIVPAKYPGESEVLQAGFNRCNKPMTHEEEPPKVKDRMDISI
FT                   HNIADHE"
FT   CDS_pept        830413..831825
FT                   /codon_start=1
FT                   /gene_family="HOG000201727" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903125"
FT                   /orf_name="AFUA_6G03760"
FT                   /product="HhH-GPD family base excision DNA repair protein "
FT                   /EC_number="4.2.99.18"
FT                   /function="DNA binding"
FT                   /function="DNA-(apurinic or apyrimidinic site) lyase
FT                   activity"
FT                   /biological_process="base-excision repair"
FT                   /protein_id="EAL85663.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003906"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="HOGENOM:HBG056247"
FT                   /db_xref="HOGENOM:HBG327866"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniParc:UPI000051FB4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD75"
FT                   /transl_table=1
FT                   /translation="MTRRVTRSAAAREAALFAAKAQDVKPQLTDSNGPDVSPKTGKSTP
FT                   GRKRKLPIEHPEKLSKSSKTSKPKGSLPSLNVNDDLPHNLGSVSQPHESINVEPKLNKQ
FT                   DPGIEEEEDLDNLASDLQKTVDKATEGLPQQIKISKKKNPYGLTPGATPFPEWARPTPE
FT                   ECEEVNRLLSSAHGEVIPPSKIPEPSLTVTGCGEVPSVLDALIRTLLSGATTGRNSALA
FT                   FGGLVQRFGILEEGIGKGSVNWDAVRQAPLKDVFEAIKRGGLAEIKSRKIKAILDMVYQ
FT                   ENQERKEFLVKGESDGSSDLMPGEKEYEIACADQNFLSLNHLHTLSTEDAMTELVKYPG
FT                   IGPKTAACVILFCLQRPCFAVDTHIFRICKWLGWVPPGKATEVTAFSHLEVRIPDYLKY
FT                   SLHQLLIRHGKTCPRCRAITGQSSAGWEDGCVIDHLVTRTGKKKEGNTNVPVASKRRTG
FT                   RKIRAETDGSDE"
FT   CDS_pept        join(832223..832483,832562..832743,832815..834282)
FT                   /codon_start=1
FT                   /gene_family="HOG000271512" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056385"
FT                   /orf_name="AFUA_6G03770"
FT                   /product="Oxidoreductase (Msc7), putative "
FT                   /EC_number="1.2.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85662.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000051E5C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD76"
FT                   /transl_table=1
FT                   /translation="MDSLASLVPPALAPLIDTLATNAQLLGVAVISVAAIYLGYAFVLN
FT                   SKEAAVTFNIPLPAEVRANWTGKKWEDVQGEEKKVLEGQVRGQWSDKLIMSYCPADGRV
FT                   LGTGIKPNTADDVNRAIQAAKTAQVEWAKTSFADRRKVLRTLLKYVLDHQDEIVAACCL
FT                   DSGKTKVDASFGEILVTAEKLKWTIDHGEKALTAESRPTNFLMMYKKNVVTYEPLGVVS
FT                   ACVSWNYPFHNFISPVISAIFAGNGIVVKPSEQTAWCTMFFLEIIRGALSSCGHSRDLV
FT                   QSVVCLPDVAGALTSHPDISQLTFIGSRPVAHKVCESAAKALTPVTVELGGKDPAVILD
FT                   DPRTVSEVSSIASVLMRGVFQSAGQNCIGVERVIALPGIYDKLLDTVAPRIQALRLGSV
FT                   LLDSRPKDARQKPNTPDMGAMISPASFDRLESLIEDAVRQGARLICGGKRYNHPRHPYG
FT                   HYFTPTLLADVTPSMRIAQTELFAPVFVLMRAESVSHAISIANSTMYALGASVFGYNQK
FT                   DVAACVSQIKAGMVSVNDFASYYAVQLPFGGVKGSGYGRFAGEEGLRSVSNIKAVCVDR
FT                   FPRLMATRIPPRVDYPIQKGDDDKQNGTGAWELCKGVVETGYQLTLAGRLGGILRLLKN
FT                   M"
FT   CDS_pept        complement(834400..835821)
FT                   /codon_start=1
FT                   /gene_family="HOG000201716" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264312"
FT                   /orf_name="AFUA_6G03780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85661.1"
FT                   /db_xref="HOGENOM:HBG056245"
FT                   /db_xref="HOGENOM:HBG331376"
FT                   /db_xref="UniParc:UPI000051EF01"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD77"
FT                   /transl_table=1
FT                   /translation="MLTPIRVRGRRKKALAQNSNHAQGGKARPSGPKGGRPLMSREARL
FT                   DSSQARNNKRARLWAARPSKRRKTLSLLETLPVELIEKIFLYSLNVNLPRASPSLAAAV
FT                   SSERIYRMLILLGFWNDSASEAEDPDSAISRILRPLDYAPLQDDDRENLQTSVLRCRWC
FT                   TMPRLLMQLSDMTNLTIQRHWVNAGIEMTRDQQESLDRFLARENDTSTYEGTDKDGNHY
FT                   TLSITPFVSINIACQETDEQQTHKILSIKHFPEKLLLGASGEGFSDDHATHLEIMRVAC
FT                   GLSRSDHLETDVSVSRESLHQGVHIALVEHNTRALATLLKIDEYIFRSNAAVAGGLPYS
FT                   IPPEHFRTAVRVARNDPALFQTLLRASAESVPADDPEITEWAMNLGDPFGHWLLDLMLR
FT                   LPQQIETANANPAEGALFYLGRANGQIELARRYLQDVLNVDELPSWMEASDDLFRQWRV
FT                   ITTTTGRDRFVESQY"
FT   CDS_pept        join(836798..836818,836874..837062)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264313"
FT                   /orf_name="AFUA_6G03790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85660.1"
FT                   /db_xref="HOGENOM:HBG056244"
FT                   /db_xref="UniParc:UPI0000520220"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD78"
FT                   /transl_table=1
FT                   /translation="MGAVVSCIQGVFRSIGACLMGIVNTIGAVLKAIINGVVSLCNIVI
FT                   SCLTCGYCGNRGRMRSSRHRRSRV"
FT   CDS_pept        complement(837304..838380)
FT                   /codon_start=1
FT                   /gene_family="HOG000201705" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264314"
FT                   /orf_name="AFUA_6G03800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85659.1"
FT                   /db_xref="HOGENOM:HBG056243"
FT                   /db_xref="HOGENOM:HBG327864"
FT                   /db_xref="UniParc:UPI000051F66E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD79"
FT                   /transl_table=1
FT                   /translation="MSERIIQPHEIRQGHDSEQLNQVSSPGQAQSRLECLPVELLQKIF
FT                   LYSLEFSLPRASIYLARALSNPTLYTWLIRLSFSSSNESSKNGFFTTEFLPPPLDFFAL
FT                   STEERSDLQSAILACRWCTLELMRKCQREYIEHAVRLKCHGLVFAPEDRDSIAKIGEHF
FT                   HDLSRYDQGHRGRLGKGDLVFRAQDPETNAEYRIAVWFNFGAFQIRRPNPFHTELDLFR
FT                   LPCCAGDTPARMPSKLLCSPWTEAKLEFLKLLCTEVYIDDDEEFERSGRLLRQVIRSRD
FT                   YGTFKVLVELFIRIRIYKYPRRWPIQRSHFKAALKYADSPNDPFLNFLIRERWDDLPSS
FT                   DTKLKVEVLAKGGLCSPA"
FT   CDS_pept        join(complement(840085..840093),complement(839611..840036),
FT                   complement(839212..839544))
FT                   /codon_start=1
FT                   /gene_family="HOG000201694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751080"
FT                   /orf_name="AFUA_6G03810"
FT                   /product="ATP synthase D chain, mitochondrial, putative "
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL85658.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG056242"
FT                   /db_xref="InterPro:IPR008689"
FT                   /db_xref="UniParc:UPI000051F198"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD80"
FT                   /transl_table=1
FT                   /translation="MAAIRIANPLFLQRSAALKIDWVKVTSSLGLRGQTAASLQAFKKR
FT                   NDDARRKVQLLSEQPQTVNFDHYRSILKNQAIVDEIEGYVKNFKPATYDVNRQLKAIDA
FT                   FEAQAVKSAEETKGKVEAELRNLEKTLENIETARPFDELTVDEVAAAQPEIDEKTAALV
FT                   SRGRWMPAGYKVGYNLLDICFRTKRLTDDNFLDRSASVTCPLFKLSAFASHFPIFYPTA
FT                   IGITRRKLFVKPVNEWLPFLIPGSVFLLVDGSV"
FT   CDS_pept        join(complement(841093..841323),complement(840931..840989),
FT                   complement(840546..840870))
FT                   /codon_start=1
FT                   /gene_family="HOG000239674" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056386"
FT                   /gene_name="egd2"
FT                   /orf_name="AFUA_6G03820"
FT                   /product="Nascent polypeptide-associated complex subunit
FT                   alpha"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85657.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG236848"
FT                   /db_xref="HOGENOM:HBG628290"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR016641"
FT                   /db_xref="UniParc:UPI000051EA66"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WD81"
FT                   /transl_table=1
FT                   /translation="MADPRVEELPDEEVPKANVEDAGSDSESEAGEESSIPAGAAVTIH
FT                   SRNEKKARKAIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAKI
FT                   EDLNSQAQASAAQQLAAAEAAAGEHAGHDHDHDHGKGKAPETEAKKEEEEDDGEEVDET
FT                   GLEAKDIELVMAQANVSRKKAVKALRENDNDIVNSIMALSI"
FT   CDS_pept        join(complement(842568..842693),complement(842184..842483))
FT                   /codon_start=1
FT                   /gene_family="HOG000201693" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264315"
FT                   /orf_name="AFUA_6G03830"
FT                   /product="Ribosomal protein L14"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85656.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG166121"
FT                   /db_xref="HOGENOM:HBG499844"
FT                   /db_xref="InterPro:IPR002784"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniParc:UPI00003E614E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD82"
FT                   /transl_table=1
FT                   /translation="MADIDVKVAQWKLVEVGRVVLIRSGPYTGKLAAIVEIIDHKRVLV
FT                   DGPSTEENKIVPRHALPLAHATLTPFVIPKLPRAAGTGPVKKLWEKNEIDGKWAKSTIA
FT                   QKTERAERRKNLTDFERFKVLRLKKQVRSVCETMGEL"
FT   CDS_pept        join(complement(844938..845225),complement(844309..844872),
FT                   complement(844032..844280))
FT                   /codon_start=1
FT                   /gene_family="HOG000201672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264316"
FT                   /orf_name="AFUA_6G03840"
FT                   /product="ER to Golgi transport protein Yif1 "
FT                   /protein_id="EAL85655.1"
FT                   /db_xref="HOGENOM:HBG380294"
FT                   /db_xref="HOGENOM:HBG745098"
FT                   /db_xref="InterPro:IPR005578"
FT                   /db_xref="UniParc:UPI000051EA65"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD83"
FT                   /transl_table=1
FT                   /translation="MYRQSFAPPPAQSPPLHHPVPQHVSTVPMMRSPPPPASQQPPSSG
FT                   YGNPYQPSPAQGGSGTYAPGFSGFINDPTAQMGFQVGKTAMAAGQEYMEQNFNRYVSIP
FT                   ALKHYFNVSNSYVLNKLALVLFPWRHKPWSRQQARLTTSSAGPNGQIAQQQYSSMFLPP
FT                   RDDLNSPDMYIPVMALVTYILLSAVLAGFRGQFHPELLGSITTTAIAVIVFEILCLKLA
FT                   MYILSINNESQLLDLVAYSGYKFVGIIATLVMSEILTPGRGTGGWVGWVVFMYTFLANA
FT                   FFLLSSPLTSFQLRSLKYVLLPDSTSDASMRAGSMHTVARSQRNRRTQFLFIYSYVIQF
FT                   IFMWVLSREGPATPASAAAKGAGSLS"
FT   CDS_pept        join(845529..845753,845805..846090,846149..847587)
FT                   /codon_start=1
FT                   /gene_family="HOG000201671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903126"
FT                   /orf_name="AFUA_6G03850"
FT                   /product="Signal sequence receptor alpha subunit, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="receptor activity"
FT                   /function="signal recognition particle binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle receptor
FT                   complex"
FT                   /protein_id="EAL85654.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005047"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005785"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="HOGENOM:HBG235775"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007222"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI000051ECA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD84"
FT                   /transl_table=1
FT                   /translation="MLEAFEVLTTSGVVLWSKSYAPVGAHVVNSLINDVFIEEKVRAQN
FT                   QAASSAAPIYKKEKYTLKWKQVKDFNLIFVAVYQSLLHLGWIDKLLDNVSTIFIDLYKD
FT                   ELRSTRARIIEYPFDKYFDQQVRELEDNAGAPTSESLVVEINERKDPLVSSDNGGPPPP
FT                   PVPGLLKAQRPVAQGVATSDEGSPPQTPDLSRSSTPISGHLLTAKGGPAGRASRRARKA
FT                   ANASATASSGDESIRKGKTLKSGKKMRKWDADGFADEDDGKVLDYSAPADGEDAPAPVV
FT                   EAVAQESWGRRTGKGQFVLKDLGDEVHSILENADHEKTKSSSSTGFVGSGVNALGGFFR
FT                   NIVGGKVLTEADLEKPLKAMEDHLLKKNVAREAAVRLCQGVQRELVGKKTGNFQSVDAA
FT                   LRSAMESSLRKILTPTSSLDLLREIDAVRSPTSKGQAPRPYVISIVGVNGVGKSTNLGK
FT                   ICYFLLQNNYRVLIAACDTFRSGAVEQLRVHARNLKELSTRENAGEVELYEKGYGKDAA
FT                   NVAKDAVEYGAANHFDVVLIDTAGRRHNDQRLMSSLEKFAKFAKPDKIFMVGEALVGTD
FT                   SVMQARNFNQAFGTGRNLDGFIISKCDTVGDMVGTLVSMVHATGIPIVFLGVGQHYGDL
FT                   RGLSVPWAVNLLMK"
FT   tRNA            complement(847760..847831)
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        join(848615..850033,850090..850383)
FT                   /codon_start=1
FT                   /gene_family="HOG000201650" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264317"
FT                   /orf_name="AFUA_6G03860"
FT                   /product="MFS transporter, putative "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85653.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG056241"
FT                   /db_xref="HOGENOM:HBG327861"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000520928"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD85"
FT                   /transl_table=1
FT                   /translation="MRETEQNSLNRRHSTTQHYQTFDTPPPKSRGRPNSGQSELSGGNS
FT                   NLQQHGSGSDDESRSPLPKKQMAVLAMIALCEQTALNSISPYLPDMAASFPGVESQSVG
FT                   IYVGTIASAFALAQFITNYFWGWLSDRVGRKPVILLGTILTAVCMLAFGFCKTLWQAIL
FT                   VQALMGVVNGNQGLVSTCLGEITDRSNQSKAFTYLPVLYGIGGITGPLIGGLLVFPRNP
FT                   LDSNKPNPYPYAGPNLVCAGILMVDFILTSLLLEESLEDTEILPTFKRRIRAIFVWLWE
FT                   WTSQARRARQSYLPHEYRSVQQHASEQDHDSELDSASEVSSHQGATHESLLKNDIWNRD
FT                   TVLLLLTYLIFALGNVSFNSLFPIFSHASPPTGRALTPREIGLSQGFAGLATILFQVCI
FT                   FGRLRDKMGNRWSYRAGLFGFVLSFILMPFVGYKGDDADGRLTKKTAFMAIELCFVLLV
FT                   KTVAAVGGLTSALLLITNSAPDHAVLGALNGLAQTLAAAGRAAGPFLSGGLFSLASRIQ
FT                   PKGELLAFGVFAAVSFIGFVLSFGIKGRSLEAQDWESDDDDNYKSDDEHPSTP"
FT   CDS_pept        join(complement(853119..853272),complement(851556..853067),
FT                   complement(850827..851506))
FT                   /codon_start=1
FT                   /gene_family="HOG000201639" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264318"
FT                   /orf_name="AFUA_6G03870"
FT                   /product="Tetratricopeptide repeat protein "
FT                   /function="binding"
FT                   /protein_id="EAL85652.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG056240"
FT                   /db_xref="HOGENOM:HBG325055"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0000F51CE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD86"
FT                   /transl_table=1
FT                   /translation="MALCEEENEHYGSDYVDSQGKFVRNQTQGTPPSPSRRQSFLQRIF
FT                   GRTVPKGLSRAKSTSNRGRKLLKRVNTVRLSFTQRGSKNESHTSLESEGSSSDVKPAAK
FT                   TQRRADGVRTAVSEAEYMDLLRNCQNIFIHIQHLSGGAMVHDASGRQRLLQMDEVAQLF
FT                   LQLKNELSASTAYSKALITRMRADAALKQGNSKAAVVDFHDALRTLESEPALDTERLFR
FT                   ASILHSMGHAYRSLDMAAESEACYLEALGLYKRSFGRDHPTNFAVLHDLGALCEKDGYA
FT                   TEAAALYERSFAGRLKTLGQHAPETLSSMQRLASLKVSLGDLESALLLLERAVPALDTV
FT                   FGLQNETTLNAMNKLSLLYQKLGLVKESRMICGKTIPHCKTIFGVASAITRDAVIRYIQ
FT                   SSDNFDLPPEILDILDQYRNSSDPEALRVIHRLGRSYMDAGLNRDAADLFEALFEDLLV
FT                   VRGPEAPETFDALSALCVSREHLDSVDKAILAYQQLIQMASATPDDHHSRKRIGYAQKR
FT                   IVELNRRREVLATERKEWGLHEPGKCENCVTSTKNLCNSCKIFRFCSEPCHKASLQKHL
FT                   PYCIPSVSLRESKSLAVKPRCPPWVRDQALSKIRPLDRDRTVDVLASYTFYFDPRNFTT
FT                   FRMKLSSLTNTLIIFSLDSDIRFATIDSSLSPSSSGHGNTSSSSPTTASANPRGIQWLT
FT                   PQRQEAICYIPPEAPDTPAKYVLVSPGKEMFKSAIQKRISVRGSNGEKEHFRSLSVPDS
FT                   ELIEYAQGLLLSGYLEEAFMYVIEWEWK"
FT   CDS_pept        join(complement(854534..854711),complement(854322..854466),
FT                   complement(854189..854266),complement(854005..854019),
FT                   complement(853901..853933),complement(853633..853838),
FT                   complement(853472..853584))
FT                   /codon_start=1
FT                   /gene_family="HOG000217811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903127"
FT                   /orf_name="AFUA_6G03880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85651.2"
FT                   /db_xref="HOGENOM:HBG056238"
FT                   /db_xref="UniParc:UPI0000F51CEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD87"
FT                   /transl_table=1
FT                   /translation="MARADIDNRSPLQAEAKRNFENQIVLSPSSHNASVALGARTRVLR
FT                   ASDVLLSLAGKTEKETLGDEDSPGVESFAETVRLFPPLTNDDGAPNGAVDSKCPDCDAV
FT                   FSSPCELKQHYLTRFCPGAAVAIYLMMRDRGSTTSCKSCGEECNISYEPVLNDPRDDIN
FT                   LRDIQKDRVNGAHSRSPSIAQKNLTGSKFHIATNTAGEQSFAQRARKLRDSWSLRKISQ
FT                   SDEDELIAVSFAGLYDLERGRSTLFSDSAVLKV"
FT   CDS_pept        join(856876..857109,857166..857478,857529..859234)
FT                   /codon_start=1
FT                   /gene_family="HOG000087851" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207678"
FT                   /gene_name="catA"
FT                   /orf_name="AFUA_6G03890"
FT                   /product="Catalase A"
FT                   /EC_number="1.11.1.6"
FT                   /function="catalase activity"
FT                   /function="heme binding"
FT                   /biological_process="hydrogen peroxide catabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85650.1"
FT                   /db_xref="EMBL:AAB47761.1"
FT                   /db_xref="GO:0004096"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0042744"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052085"
FT                   /db_xref="HOGENOM:HBG339355"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="UniParc:UPI0000520467"
FT                   /db_xref="UniProtKB/Swiss-Prot:P78574"
FT                   /transl_table=1
FT                   /translation="MATKIAGGLHRAQEVLQNTSSKSKKLVDLERDTADAHTQQPLTTD
FT                   HGVRVSNTDQWLRVTNDRRTGPSLLEDQIAREKIHRFDHERIPERVVHARGTGAFGNFK
FT                   LKESIEDLTYAGVLTDTSRNTPVFVRFSTVQGSRGSADTVRDVRGFAVKFYTDEGNWDI
FT                   VGNNIPVFFIQDAVKFPDFVHAVKPEPHNEVPQAQTAHNNFWDFVYLHPEATHMFMWAM
FT                   SDRAIPRSYRMMQGFGVNTFALVNKEGKRHFVKFHWIPHLGVHSLVWDEALKLGGQDPD
FT                   FHRKDLMEAIDNKAYPKWDFAIQVIPEEKQDDFEFDILDATKIWPEDLVPLRVIGELEL
FT                   NRNVDEFFPQTEQVAFCTSHIVPGIDFTDDPLLQGRNFSYFDTQISRLGINWEELPINR
FT                   PVCPVLNHNRDGQMRHRITQGTVNYWPNRFEAVPPTGTKGSGVGGGFTTYPQRVEGIKN
FT                   RALSDKFREHHNQAQLFYNSMSEHEKLHMKKAFSFELDHCDDPTVYERLAGHRLAEIDL
FT                   ELAQKVAEMVGAPIPAKALKQNHGRRAPHLSQTEFIPKNPTIASRRIAIIIGDGYDPVA
FT                   FTGLKTAIKAASALPFIIGTKRSAIYADGEDKTSSKGIIPDHHYDGQRSTMFDATFIPG
FT                   GPHVATLRQNGQIKYWISETFGHLKALGATGEAVDLVKETLSGTLDVQVASSQSPEPVE
FT                   WYGVVTAGGKQKPESFKESVQILKGATDFVGKFFYQISQHRNYQRELDGLASTIAF"
FT   CDS_pept        join(complement(860621..862946),complement(859681..860560),
FT                   complement(859559..859578),complement(859391..859473))
FT                   /codon_start=1
FT                   /gene_family="HOG000201627" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264319"
FT                   /orf_name="AFUA_6G03900"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL85649.1"
FT                   /db_xref="HOGENOM:HBG056237"
FT                   /db_xref="HOGENOM:HBG327859"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000052092B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD89"
FT                   /transl_table=1
FT                   /translation="MLPSLKMSTTDPFGAPPSDSEHSITSISKCDPSPSQPSDGEWTDD
FT                   DDFAISPLSDRSPPRGNHWTRFFPELSSHFSLVSPISTTTPKVTPFSLLADMQAIDHQN
FT                   RQNSSDSGTRTDSPSLSEDTFDTTSSCYSRRSSVTSLGSELAGCPYKSADAFSVISPAA
FT                   AGVFDDDIAPMLVGPASKLAVESPSLDEVRNKPLPREPPIALAPLSVRHNGPRPFQACQ
FT                   RPSSDWPCTTNPASPATRLSHSQRTLSQAAQELENFLAGITEQRHNEPQLFSSQISNGP
FT                   LQISRGNMDMIATRPAPRPPTNIASVKSKDNSSQKISPEQPERDLQKPMKKTKYKGPFS
FT                   FSVPGFSRKYTNTHLRSFSSSSLKSEMESPSFRPQRPPRPETIHDEAEDTAEVAQSPFL
FT                   PVPSQRQRSSSFCSERELRLRLPRLQTKQVRSHEDLVSSSSSFVEAERVAERSMPSIRA
FT                   NNVEEKIFVASSKSGRSNTSDSLFELDGGMPQRMIYELDAGLPSPHPKINISVHKPSKT
FT                   TAVQLPDDIALKILEQVASLDDLFHLAVVSKQYYRVFKQHELHLMKTTVYRMSPPAWEL
FT                   REMSPPWDSEWQILVDPDAPVPEYTPTLYLQRYAQDIYTLAQLKSLILARCNTFLRQET
FT                   INGLTGKDDTRAAEIDDAFWRIWTFCRIFGCGKNRENDIVGQMDWLNGGVMAHDRNSIM
FT                   TTSLTEPFGMNNVLFEPPEGFGRGNGEGLSQSQLYDMTEIWTCLAVLLQPIHGRRTEAR
FT                   KAGVFAGLDIAENDTAKEEAMIEEWTYYVLTLGPSAVLSIGSICAFDDSEATFQTAQSI
FT                   GLTKWEPADSSISRSTFLKEAVSRAYKVREGSPSLPGSRLSNASSTSSRSSAGRKTTSQ
FT                   ASSNTSDSNQINRRRQAVFAAQLRNRRTQQQNNPGNPITFAEERPISSYAMIMSRLEGL
FT                   PSNQPLPPAPPRQQVASSASLTPRYYPPAPIQYSQPLLPPPPPPTANPVAYRPQVLDPV
FT                   DQAIHVMVHELGFKEEDVKWALKITDTGEGIDANAAVALLTREQERYEQRRSGRFAFRS
FT                   KSPSLLESVINSQESVNSGWRPIMILPAPVFACRFDTHYAHSLQDIYCPDTFQI"
FT   CDS_pept        join(complement(866211..866309),complement(865767..866084),
FT                   complement(865531..865680))
FT                   /codon_start=1
FT                   /gene_family="HOG000201616" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264320"
FT                   /orf_name="AFUA_6G03910"
FT                   /product="Integral membrane protein, Mpv17/PMP22 family,
FT                   putative"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85648.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG327857"
FT                   /db_xref="HOGENOM:HBG472290"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI0000520466"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD90"
FT                   /transl_table=1
FT                   /translation="MSLPPIATATLQAALVNAGSNVLAQGIRAWRDETPFELDLEALFH
FT                   FTTCAFVLSPLTYVWLEGLESRFPGSSEDTSVTQSTAEKHGSKQGKQKLNVKNIVAKVV
FT                   IDQTIGGAINTVVFVMTMGLLRGQDFEVVKAQIQNDFWPIMFAGFKLWPFVSILNFTVV
FT                   PADKRLLVGSLFGVIWAVYLSLMSG"
FT   CDS_pept        join(complement(867967..868744),complement(867475..867906),
FT                   complement(867127..867413))
FT                   /codon_start=1
FT                   /gene_family="HOG000201605" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207679"
FT                   /orf_name="AFUA_6G03920"
FT                   /product="Iron-sulfur cluster-binding protein, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85647.2"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056236"
FT                   /db_xref="HOGENOM:HBG325053"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI0000F51CEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD91"
FT                   /transl_table=1
FT                   /translation="MEALTPPTLTLVTLLTAFFFLYRAWLRAVYPKTPLIGRSELFLHV
FT                   PEADNTQAVSKESDFPENWLNSNDIFELERRAVFSKVSPNRHAQGSKFTPPNPCGSQSW
FT                   LYLSHRSQFTKPGDYQSFEVAGFPIFLILGKDGEIRAFHNVCRHRAYTVANKERGSSTV
FT                   LGCRYHGWSYNTKGELIKAPHFEQILGFDKSQNGLFAIHVQQSTDGFIFVNLEADAPGE
FT                   LLETDRLVDFVKCNGPIPQSRWIGGRAIEGVFNWKMAIVSERQFSSAVILPELARLVPS
FT                   PLLARVKHYLNGKTAGDPDVLIFPNVSFHIIKDTKYWYSLSFHPASERKTLVRYDLYCF
FT                   QNTDGDVNSQLISAKLIEMITEQVAELESQYQLRVRGAEDSSQGGVIATTTEDRDFRSC
FT                   LGKSNLQNVILEQLKRHTKLEKLQGMEVHPAMRQPRMTAKSQEADQRKSITSCSQLRSR
FT                   MIKNSFTDSSQFAESSNVMARNPQVWPGSRHSHWSDQSRK"
FT   CDS_pept        join(complement(870545..870588),complement(870335..870449),
FT                   complement(870220..870293),complement(870014..870137),
FT                   complement(869779..869960),complement(869309..869724),
FT                   complement(869118..869248))
FT                   /codon_start=1
FT                   /gene_family="HOG000048640" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751081"
FT                   /orf_name="AFUA_6G03930"
FT                   /product="Putative uncharacterized protein "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="iron ion binding"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85646.2"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056235"
FT                   /db_xref="UniParc:UPI0000F51CD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD92"
FT                   /transl_table=1
FT                   /translation="MQLLFLSAGQTPSYAKRYTHPIGHLPFFCYNGTVSWLQCPEIRRL
FT                   KRWKKHQMHVLFRLHGIAASRSISSNAGQSSTRFLTIGEKVEYEIAQQSIIAFRSSGDA
FT                   AFPGPDEIQVVSVRTGRKLRSHVTSTGLVFSTLSDEAPNFEEYFPGLEALLERVDFTKL
FT                   PYRRSIKYEGHFNWKTMVDGYQECLHCQYTHPSFSVYYPPTFYTVNNHQNFSQHIADPK
FT                   KPDDGLFLYFFPICTLNVYGGGMSSFRVCPAEDPSQTRMEFDYYHSESGNKFEEYYQFV
FT                   RQVAMEDYELCEKTQGNLEKGVYTEGILNPEKENGVSFYQDRVFELVCQQHAAESASHD
FT                   LSAPRLKESEINAEKVGAAAL"
FT   CDS_pept        join(871289..871441,871521..872910,872969..873231,
FT                   873282..873600,873658..873998)
FT                   /codon_start=1
FT                   /gene_family="HOG000201594" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056387"
FT                   /orf_name="AFUA_6G03940"
FT                   /product="GTPase activating protein (Gyp7), putative "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85645.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG056234"
FT                   /db_xref="HOGENOM:HBG327854"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI0000520465"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD93"
FT                   /transl_table=1
FT                   /translation="MAGSGTKFTPPPSPPSPTASFYDVSDAEEDEYNSISSTSGRGVKL
FT                   LFSKSKVYVHPTPSSKDNIPGFIALLQQKPAPTPSSDIASTNSAKTTADLSSYLLAWVP
FT                   ESSLGDAYSTYVKVDLSGDSSPPKQRYLVPPLPTTTTYKDPIGLYAFAVPLSEIYSLLV
FT                   RPPSLGWWFGSLVINTRAGDSFPALFFHDSECESTILQKKKRTRESFDPFDENGGLFWG
FT                   GDEVLRWLRKYVEVQRSSVDNSVYLINPCEEDRISFARPLSSYDGSVTKQGHDAAAGPH
FT                   QPGGSAGRDAGMDPFMKALKETRWKVLEQLSKITTFTRRTANELADNTMIPPQVRRLMK
FT                   SPEIQTLQDEFDSARLYLARWAMSIAEQSERERAQRIWTARDVLEMENSSVGDFEILEL
FT                   ETGTMAIQERRRTVTLQEWEDFFDATTGRLNVTVDEVKERIFHGGLDPNDGVRKDAWLF
FT                   LLGVYPWDSSRDERQALMNSKRDEYIRLKGAWWERMIEGSSTTEQYEWWKEQKNRIEKD
FT                   VHRTDRTIPLFAGEDIPHPDPDSPFADVGTNVHLEQMKDMLLTYNEYNPDLGYVQGMSD
FT                   LLAPIYAVMQDDAVAFWAFVGFMDRMERNFLRDQSGMRAQLLTLDHLVQLMDPQLYLHL
FT                   QSADSTNFFFFFRMLLVWYKREFEWVDILRLWETLWTDYFSSSFHLFVALAILEKHRDV
FT                   IMDHLKHFDEVLKYVNELSNTMELVPILTRAESLFRRFERTVEAIDKKNNFPAPSTHQR
FT                   KPTQESALNKGKSPQRPQSVGYSSGVSAGPASSSAAGDNAESKVISPELRQLLSKEILW
FT                   KQPHPTSSK"
FT   tRNA            874333..874413
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        join(complement(876950..878813),complement(874930..876899))
FT                   /codon_start=1
FT                   /gene_family="HOG000201571" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056388"
FT                   /orf_name="AFUA_6G03950"
FT                   /product="Phospholipid-translocating P-type ATPase,
FT                   putative"
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85644.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG176466"
FT                   /db_xref="HOGENOM:HBG720821"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000051EA64"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD94"
FT                   /transl_table=1
FT                   /translation="MPSSSEYLHPHGRTSVAGDSGSDDDLDLEELDPTTATIHKSPRLS
FT                   KDEATRQRGYGSGIALRNLRVGGGSRGWKRSASGIRNRDSEEDTHGLLEDQEGGALRSS
FT                   HASSRNFTDDDAPLLDNPRRSSTRSFAGDGPVRRRGSQSRFFGFKAANIFSGPSSWSHR
FT                   NDENNATKPPREVFVGQSQRSKYPANIVSNAKYTPWSFLPRTLYNEFSFFFNIYFLLVA
FT                   LSQIIPVLRIGYMSSYIAPLAFVVSISLGKEALDDIGRRRRDAEANSEEFTVLSFDKPV
FT                   GRRAFATPANNYSDSDEVFEITKKSRDLKVGDVLKVRKNQRLPADVVILKTISNDSVTA
FT                   RRSSSAEVTADLMRPDPESVQPSEVEPSSSAAADEIGTSSASDTFIRTDQLDGETDWKL
FT                   RLPSVLSQSLRLRDFTRLKVTASAPDKRVNEFLGTIELGSQSGFYDPLVDKAQTGGEAS
FT                   SEDRQANSAPLTIDNTAWANTVLASNTITYAVIIYTGSQTRAALSTSPSRSKVGLLEYE
FT                   INNLTKILCALTLTLSIILVALEGFQPNNDKEWYIAIMIYLILFSTIIPMSLRVNLDMA
FT                   KSVYSRFIQRDKDIPGTVVRTSTIPEDLGRIEYLLSDKTGTLTQNEMELKKIHVGTVSY
FT                   ANDAMEEVASFVRQAFAGNTLTTPSAAFGAQAGLGAAPRTRREIGSRVRDIVLALALCH
FT                   NVTPTTDEEDGVKVTNYQASSPDEIAIVKYTEEVGLKLSYRDRQSIVLETTETGSVVVR
FT                   VRILEIFPFTSDSKRMGIIVQFETANSILESSNEDAEIWFYQKGADTVMSSIVAANDWL
FT                   DEETANMAREGLRTLVIGRKRLSLQHFQEFSAKYKQASLALQGRDVGMAKVVSEHLERD
FT                   LELLGVTGVEDRLQRDVKPSLELLRNAGVKIWMLTGDKVETARCVAISAKLVARGQYIH
FT                   TVAKVKDPSAAQEALDFLRNKTDCCLLIDGESLSLMLGQFRSAFISVAVLLPAVVACRC
FT                   SPTQKAEVAELIRQYTKKRVCCIGDGGNDVSMIQAADVGIGIVGKEGRQASLAADFSIT
FT                   HFHHLTKLLVWHGRNSYKRSAKLAQFIMHRGLIISACQTMYSIASHFDPKGLFINWLMV
FT                   GYATVYTNAPVFSLVFDRDVDEHLANLYPELYKELKSGRSLSYRSFFGWVLVSVYQGAV
FT                   IQGLSQILLNTISGPRLISVSFTALVINELLMVAIAITTWHPVMIFCLIGTALVYAASV
FT                   PFLGDYFDLEYVITVDWVWRVAAVCSVSVIPVWAAKLIQRSWKPPSYRKVRG"
FT   CDS_pept        join(879872..884795,884847..885421)
FT                   /codon_start=1
FT                   /gene_family="HOG000048639" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207680"
FT                   /gene_name="sec16"
FT                   /orf_name="AFUA_6G03960"
FT                   /product="COPII coat assembly protein sec16 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="EAL85643.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG056233"
FT                   /db_xref="HOGENOM:HBG327850"
FT                   /db_xref="UniParc:UPI000051FB4D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WD95"
FT                   /transl_table=1
FT                   /translation="MAQPEGVLAWNPAFRPEDNDSVATDLARLALDSGKEVSETTDVDT
FT                   HVSPPAEEFTDENGSIESKTAISADTSDQGAPDLVDSNTPAADNGSKPDTEEPDKPSRD
FT                   ESIFMQTDKSRAVEDVTENVPTENGNVDITSGLEEHVAEEPHYEGPEKSTGLAGRNDAQ
FT                   DLFEGNDTAWMDEAEGEVNGATVNGEASGTRPGFWDSLGDNERDNEDDFFNQLKTQTKP
FT                   IYSPPETEARFEEGIPLLGQGAAPQNNHAHKGESQVDDVFGDDEDDESGFFSEIQKRTS
FT                   AEGPPPITRKSTSQVIDSINAVSDSMFSKQLPAAAELNNSLAVPTADGEIKNSPSEEDL
FT                   AARWQAELSDDADETMPTEDDLAARWQAELDDDDDDLLLDDDTTNAQRPPEAANIDHMN
FT                   DTSMLQSPFGTPENLARPKVQPVSYTPHQPSTSDLLSGIPAQNTAAQPTNASMSSYFSA
FT                   QAPPNPVTTRAESFAERSKEGYKSPYDIPEDLARPRRAVANSRTVVAQPGTVPKPPPRS
FT                   SSIPAPPLKASTVSPAPLGTSSTAPTAPQKNFFEELPLPPPRPKSRPASSGRYTPNAPV
FT                   SAPSLPQSIPPPANQYSNVPGAPQSNIGPPDPPQLQQPERLDPYSNLLAPNVPSAPAVP
FT                   STASRYSPRPPGVQAGVKPPPSPRYSPAPPQSTNAVAAAPRNRYASQPASISGQGAALQ
FT                   FQPRTSSPLAYHEKIHYEDQGQSEERPQLQSTASPPPLNHSHPSEQPVSSENKGPSGVD
FT                   VLENVPPLSTRPQSPPKNPYAPSAYTNEFANRVAPVSTGPPIAGMTGVLNSSTEESPFV
FT                   PPRRSQTQSPSQTLSPRLSVPSLDPFQRPASVHGSTSPTRTVNPYAPAPVPTHNRAPSQ
FT                   VLEFIPPTDGQQLDSLERWKGAPIFKFGFGGAVISCFPKHIPRYSAGQAAPMIKSCPGE
FT                   VRISQLNDWLPAAEGIVQHPGPLKGKSKKKDLVAWLSSKIAAFENADIPDFDRLSPDAS
FT                   KLREEKTLLWKVIRVLVENDGVLEGSVEAQKSLRNLLFPNLQDSGPNQSLGDVFTPSAT
FT                   LQPLNAPSQPDAVDSRSVDLLRDTLVLGEREKAVWAAVDKRLWGHAMIIASRMDRSVWQ
FT                   QVVQEFVRREVRSATSRTESLAAFYEILAGNIEESIDELVPPSARAGLQMISKVDGHGP
FT                   AKNSLDGLDSWRETVGLVLSNRSPDDQRALVALGRLLLSYNRTEAAHICFILSRVAVFG
FT                   GLDDPQANIVLLGVDHQRLSSCAALYNDDSILLTEAYEFATSVLAGSSVSTLPHLLAFK
FT                   LIHAWSLAERGRKSEAQQYCDAIAAALKATTKPSGYHNQHLFFGVDELSARLRETTSDG
FT                   GSSWISRPSMEKVSGSMWAKFNSFVAGDDSDAASTGSVKAEEIGPFARVSGTPTISRSP
FT                   SVSDIYGSYPVAAAQPLPATGPSRYQPVSQYAPSASPEQLRGRSSMDSQRSASFGYPLG
FT                   QRRGSQEPSTPVDTNMFHGMPMYGSPPVAGYQSTPPQSSYMPLAPVAEDSASGAQQESF
FT                   SAHSQVSDNAPSHRSSTYAPEPFGHPFDTQAVSTTSQPDQGGYMPPTSSGAYEPPSFES
FT                   NTESADGAQDESTEEDKPKKKSIMDEDDDEDLAARAAAIQKAERARRDREADEAFRKAA
FT                   EADAKKPPPATGKKGWFSGWFGGKKDDNSGGGPIRAKLGEENSFYYDTELKKWVNKKDP
FT                   GSAAPTRGTPPPPKGSAPPSRSMSGSGGPPPAMATPPPTGASGSRPSSSAGAPTSVSAS
FT                   PAPPSLGAPPPAIPRSVSTGAVLPTPPSSSAGAPPRPATSLSNASSIDDLLGAPQARKG
FT                   PAARGKKKGRYVDVMAK"
FT   CDS_pept        join(complement(887111..887153),complement(886931..886995),
FT                   complement(886126..886873),complement(885976..886052),
FT                   complement(885469..885657))
FT                   /codon_start=1
FT                   /gene_family="HOG000201572" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264321"
FT                   /orf_name="AFUA_6G03970"
FT                   /product="Cell cycle checkpoint protein (Hus1), putative "
FT                   /protein_id="EAL85642.1"
FT                   /db_xref="HOGENOM:HBG117679"
FT                   /db_xref="HOGENOM:HBG327851"
FT                   /db_xref="InterPro:IPR007150"
FT                   /db_xref="InterPro:IPR016580"
FT                   /db_xref="UniParc:UPI0000520211"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD96"
FT                   /transl_table=1
FT                   /translation="MRFRSQLTNIVTFTNGIVRFTIIPDQGTQVWAQLPVDAIFDEPTY
FT                   TLQSNSGVINLEVPIGALHRALRSATGATSAQLRLTKKGNIPLLALTILSSSWTTGSNA
FT                   VGITNLVSGTAAAGVTGPRERETVITQEIPVKVLHESAVEGLHEPRCRDPDVHIILPSL
FT                   AHLKSISERFSKLAGDARPAASGGIVSSTLTSPKLELSANMHGSLRLAIATDALRISSV
FT                   WSDLVNPPLDPAGMSQREIEQLPSERMRALGSDDEAGWAKVRIDAKDWSRVLSIGRLSP
FT                   KVVACFIHETALILYVYLPQSWNGEDSCLTEVVQRNCVRQTYMQTCKEKSCKAPPKQAA
FT                   IIQAEPGMQASKQTQHQWLYDRTEYMHITLCKK"
FT   CDS_pept        join(complement(889003..889153),complement(888882..888907),
FT                   complement(888393..888803),complement(887487..888329))
FT                   /codon_start=1
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264322"
FT                   /orf_name="AFUA_6G03980"
FT                   /product="Hexokinase, putative"
FT                   /EC_number="2.7.1.1"
FT                   /function="ATP binding"
FT                   /function="hexokinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="EAL85641.1"
FT                   /db_xref="GO:0004396"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG130961"
FT                   /db_xref="HOGENOM:HBG522186"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniParc:UPI000051F40A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD97"
FT                   /transl_table=1
FT                   /translation="MEKGLRTQPDLLSGAPEKLVIALQGLEELFAADRFLLRKITDHFV
FT                   KEMEKGLSAEGGDIPMNVTWIMGYPTGKEQGKFLILDMGGTSLRVSQAQLLGSDRDMES
FT                   IQEKYSIPQSIKQGTADDLWDFVADCVQKFLQSRLSESERSKVLPLAFTFSYPVIQSSI
FT                   KVGVLQCWTKDFCVSGVEGHDVVFQLEAAFERKKIPVQVVALVNDTVGTLFAAAHRDQE
FT                   VKIGSIASTGCNAAYMEEVAAIPKIQSCGLPSGALVAINTEYGAFDKSRRILPRTRFDD
FT                   EIDRTSAHPGQQLYEKMVSGPYLGELLRLVMLELHEAKLLFVGQDVSCLRQPNALEVSL
FT                   FPTLEEDISECMENARKCLWEKTGLDPAPHELKACRYLAELVGTRAARLYSCGIAAICK
FT                   KRNIERCHIGVDGSIFGHYQNYRKRAAQALRDIFAWPDDLEDPIVFGFYKDGSGVGAAL
FT                   IAALALERSDGTVLSRTE"
FT   CDS_pept        890356..894840
FT                   /codon_start=1
FT                   /gene_family="HOG000201583" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056389"
FT                   /orf_name="AFUA_6G03990"
FT                   /product="GAS2 domain protein"
FT                   /biological_process="cell cycle arrest"
FT                   /protein_id="EAL85640.1"
FT                   /db_xref="GO:0007050"
FT                   /db_xref="HOGENOM:HBG056231"
FT                   /db_xref="InterPro:IPR003108"
FT                   /db_xref="UniParc:UPI000051F8D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD98"
FT                   /transl_table=1
FT                   /translation="MATSRVSPVRPSVRFSPTESHHYRKRSLSRSPDRSAAPKYETIDP
FT                   LLSNLSPESTLLALTSTDAVPKNEKAAHDILWKSISQVSPAERALGIRAAIAAQRLGEW
FT                   YREVQAWDWPKRADAELGKGFMPPSSSNVNSEEQGYYGSLPSVVVKQHEDRIEEIRDGM
FT                   ETLDVDELKEHVLNAHIPARSRPSSSNSTVSVPPPLTYVQLSDFTAVITATILRALPLL
FT                   SRLNNLLTTWDVRLLVLRQIPGLLRALHLAQSEVDSAMDLLKATAPPSENDPLYSRENY
FT                   HAKRTSLEAIVLSAGRRMDIVLDALEGREDSLPESWIDELEAVESDFSTWVMEAEKRTV
FT                   ENEWLRMRSTTSESKEAQRVQNKQNRLSNIPEEEDSKFPVADSSDPSPQSSCSLPMETI
FT                   NEGDGDQLLVEAISDAVTHNQNSAQGLNALDPSQSHLDSSEFVSLSGPDTKISNEPSEQ
FT                   STIEIAIDAVLPVDVDMPRPESSEIVKSFSEDSSDDSIGGSSDKPSNDRPSQSTPSVCQ
FT                   IRPAVSEAASEEVSLEELVAAATQRHGNTTVLQIPEQGRSTSIEQSSGEMTDDTSSSKK
FT                   HQAPRDLQCSLPIDHFVANRPGAECLSVSSELVPENTYLVSHVEEKLCSSQLSASAQEV
FT                   SSIATRLADSSYKEHKVPLKEPSFATTKNDSFRIAESETPSLRTTGTSMEQTDAVCGIN
FT                   ENQTSSTTAGDNSQEERKQFSDGLSAVATPSDSGRQLSVEPLEDKVAPTVSSNLAEVAF
FT                   TEETSAAELLDRQGLNVDIGRAIDPFDSEKSSPIENEAATLASVIAEAATTRAPSTSTS
FT                   LKREESFSRSATSSPEPAKPVSNSRNDKASAVDPGEPQQSSETVPPPKIRLESPIKLSK
FT                   TRPQSLNISKGNSKSQARRTSTASAGSLSDYPSLTSSPGIREPRTASSNGTPLLLETPP
FT                   PFQDLSLASDYVSVGTDHTLREERLRRLDNQKVPNATVSHNRALSLPLQRFINERLDMQ
FT                   YESGAGGDLNGALGYRRASVASIDLRPQSEQHATDLQSSKDGSTVPTNNLKLLASQHME
FT                   LSQRRQSTSKLDDATPKPSKAWANNANAFARDSVIPSPSLESTVRNDTVRIRKQMITHP
FT                   SLENIGAYHSNVQPLRDTGFPRMETSRPSTPSKQMRRPKNQLDEKISSILDTIPARIHL
FT                   ISSEDHDFDEASVAPSLPVKHGERFRSMTPQGTLSRSGTPTPSLTLTAAPSRRRHSHAP
FT                   EDGSVKLYHLHRGGKAAPTKLFIRTVGEKGERVMVRVGGGWADLAEYLREYAIHHGCRA
FT                   VSETPRAEVQGPSSREPPARTSPGSTLTPTANTGRRTPSRPASVISNRPSSSLAVRKTR
FT                   RVSNVSDRPDLRSVSAGHAFVTSYSPLSTVSSRRRLSTSSTNSFGATSFASENHRATFA
FT                   NSPSIPLGLAGPKPRSRRVSISPESEAWVEDVLGQARRSSSSRPVKYVLPPNEQEPVSA
FT                   SARTLPKSRSISDIGRAGSSRRVALRGLGNPRD"
FT   CDS_pept        complement(895956..900722)
FT                   /codon_start=1
FT                   /gene_family="HOG000201296" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207681"
FT                   /orf_name="AFUA_6G04000"
FT                   /product="GTPase activating protein (Tsc2), putative "
FT                   /function="GTPase activator activity"
FT                   /function="binding"
FT                   /biological_process="positive regulation of GTPase activity"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85639.1"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0043547"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG056230"
FT                   /db_xref="HOGENOM:HBG327832"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR018515"
FT                   /db_xref="UniParc:UPI000051E5C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD99"
FT                   /transl_table=1
FT                   /translation="MSPDEVSLPSPYKSTAASLVDVFKTLGVARSRSQTPLSLEDDSSH
FT                   SLSHTTDARRNNFLVLGFESMHRGSVVSSSSDTPRAPDFETSLRNLSQTQNLAHAIDEA
FT                   EHVSRSLQWFTSDQSIALWEAGSYLIHNPDSPDARRSGSMLIEAVAARQDLSPSGRRIV
FT                   FEAISCSSEPDVIPARVQSLISLSDHGRKLDFTSSSILPILSSCAVPLYELISSSRLKA
FT                   RKAKVGKVNGLGYDETALDDLLQFAVDLITLQRKRPSAEEVESLLDQIFTICKKTSVAA
FT                   DIKNSLAVFDAVILYADVPDGSFVPMLEVLCSIHASVKSLSGPTSRAVRNLAKSRWQTE
FT                   MINTLDSFLMDLSGEESRNINVLRGTVYIFTDLVRAHGQDGIPQLRFEHLMDCLEVVIR
FT                   KDDSRLEADVLELCLNILDGDFAHVALESSWSGFVRVLNSCSLRAIGECEERAASISSS
FT                   QSPFSKTSTSEDAKSNILANAVQIAATVESLWDRLSREQKLEATRFLMNLCEHIEPSQA
FT                   ELVINTMRSENLCLPSRSDWVNYCQRLIRCFIRSRNKPSDIRISALDLLKDTFSTYDAL
FT                   VFFKGEGLLHLMLEKFSEEDDILFLESLVSFIVDTSALVVDDATFKFLVDTLSSPMNKD
FT                   LDNPELFSPLASDAPSHQRRSSTELPPTLHPVSSHHQSLELSLSSVCTAGLVRIFLRSL
FT                   NMSAGKAITVFEKLLNIAQSLERPADCRLNVLRLLFRLRCDSSGAVVVTSMSENDFLAD
FT                   ASGRSGVDNSARTQASESAVGDQATSEENLRLSAQGRQSISRESLANILSRSAGRNTAA
FT                   HSRSSVLTPPVWTFVSSQVLPENPPADSSPYVYAYTTPDLSPQSEYEPTQKVPLKANMW
FT                   LETVITLLLREKNWEIYSYVLTHLAPQLSNRGLFRNAVPQIKLLRSVMCDQVKNESFRE
FT                   PPVSTGVKKTDVAGYIFDCLSVLVSYHEVFAKSEEDELVRAFMMGIIGSWGDTSRRCVH
FT                   ALSVCCHEIPLSVTKSLNGIFDKMAKVITMSNLAVHILEFLSLLARLPDVYVNLRDEEI
FT                   RTVFGICIRFLQTSREHRVRAGDSSNRPSQTSSRLAGGVKEIATPGEPSDPSQQDGMSR
FT                   YIYTLTHHVMVFWFLSLKLQDRAKHVNWITSRLIFRDEYGQERVEEQSQVFIDLMQRVA
FT                   FSDLGETIPYETFPPSPSDGPVSKKSWVVGMSIVTVETAGVSGLTQITKRQASGTTYAM
FT                   YQQRTAPVLPHQVPTSPDAHTHSDDMRTAVLPSHVLLQLTTTAFPTPTVMQPIPLPDDD
FT                   MTRRALSIFDRNDIVDGHKIGVIYIDDGQTTESEILSNTIGSPDYEYFLSGLGTKVPIR
FT                   GAQFNTQGLHPDVDGEFTYAWRDRVTEIVYHVATMMPTDFDRDPACINKKRHIGNDFVN
FT                   IIFNRSNVPFNFNTIASQFNFINIIISPVCRIASASGAATPTPGDFERTSYTVKVMSKP
FT                   GLPEISPASTAKVISGKNLAAFVRILALNASVFSLVWNSQGGEHVSSWRNRLREIKRLR
FT                   ERALGSQLQMSEAAEGAYPGQRRNTKPNIFSEEVPSRITPVKTDFATDWNAAADANILQ
FT                   NLDFSRWGR"
FT   CDS_pept        join(901498..901567,901635..901945,902004..902174,
FT                   902257..903581,903635..904084,904141..904320,9
FT                   04378..904822)
FT                   /codon_start=1
FT                   /gene_family="HOG000201317" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903128"
FT                   /orf_name="AFUA_6G04010"
FT                   /product="Chromosome segregation protein Cse1, putative "
FT                   /function="importin-alpha export receptor activity "
FT                   /biological_process="cell proliferation"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85638.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008262"
FT                   /db_xref="GO:0008283"
FT                   /db_xref="HOGENOM:HBG022680"
FT                   /db_xref="HOGENOM:HBG327833"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR005043"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051FDAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA0"
FT                   /transl_table=1
FT                   /translation="MAADLGAVAQLLEASLDPRQNKQAEATLRQEEQKPGFSLQLLQIT
FT                   ASTSYPYNTRLASALCFKNFIKRNWTDEDGNYKLQLDEVATIKRELISLMISVPAGIQS
FT                   QLGEAVSVIADSDFWERWDTLVDDLVSRLQPKNPAANIGVLQVAHSIFKRWRPLFQSNE
FT                   LYTEINHVLNKFGNPFLALFEGLDSFLEENRSNKENLIQGFTQFNLMVKLLFDLSCHDL
FT                   PPMFEENLSGIASLLLKYLTYDNALLHTDDDTEAGQLEFVRAGIFEALTLYVQKYMDVF
FT                   SSHVGQFVQSSWSFLTTIGQETKYDILVSKALQFLTSVAGMPEHASVFQAEETLGQIVE
FT                   KVVLPNVSLRESDEELFEDEPIEFIRRDLEGSDSETRRRAATDFLRRLAEQFEGPVTKV
FT                   VLRYSDHYLAEYSKSPATNWKAKDTAVYLFSAIAAKGVATASHGVTATNPLVSITDFFQ
FT                   KNLAADLVVDESAHPILKVDAIKYLYLFRSIITKDQWQEVLPLLVKHLGSPNFVVYTYA
FT                   AIAVERVLYLADSQGQPIIAPATVTPLAKDLLQHIFSLIQKDPAPEKVQENEFLMRCAM
FT                   RVLIVIKEDVVPYTDIVLQHLINITDVISKNPSNPRFYYFHFEAMGAFIRFAAPANPEK
FT                   LEQALYPPFANILQGDVQGIVQSERNRGLGTSLSANVCAEFMPYVFQLFAALLEANPSG
FT                   SLPNYYQNLIAPMLMPVMWESKGNIPALVRLLSSIIPRGSQFILENQQLVPILGIFQKL
FT                   LSTKANEGFGFDLLESVVENFPPTALEQYFVSIMQVILTRLQNSKTEHLTLRFVRFYHF
FT                   ISAHDDKGYSADYFIQVTDKVQADLFTPIYLNIILPETQKLARPLDRKTAVLSFTKTLA
FT                   NSEAFANRYKKGWAFTCEALLKLLELAPLPASKDDIIAEHDVEDMAFGVGFTALNTVRP
FT                   QPRDPWPDTGADLKAWVGRYLKEADKKHNGRVSACVQERLGAEARTVLSSYIA"
FT   CDS_pept        join(complement(905631..905849),complement(905149..905556))
FT                   /codon_start=1
FT                   /gene_family="HOG000217812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751082"
FT                   /orf_name="AFUA_6G04020"
FT                   /product="Peptidyl-tRNA hydrolase domain protein "
FT                   /function="hydrolase activity"
FT                   /function="translation release factor activity "
FT                   /protein_id="EAL85637.1"
FT                   /db_xref="GO:0003747"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG056229"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniParc:UPI0000520453"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA1"
FT                   /transl_table=1
FT                   /translation="MPHPATPTTLQQSLSILRTSLLPKAIHPPPSLRRSFTLASSLSAK
FT                   QLPPRLKIDDADLTVSYLKGTGPGGQKINKTNSAVQLIHKPTGIVVKSQATRSRSQNEK
FT                   IARQILADKVEELLKGDASRNAIRAERARKKKASKMKKTRRKYRELGKGAQNEKHEDGD
FT                   EVDVEDDTGDGSEVQGAPHVSRCDAEDSTTQKTCDNHAAEQKQLG"
FT   CDS_pept        complement(908793..909044)
FT                   /codon_start=1
FT                   /gene_family="HOG000201340" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207682"
FT                   /orf_name="AFUA_6G04030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85636.1"
FT                   /db_xref="HOGENOM:HBG056228"
FT                   /db_xref="UniParc:UPI000051FB57"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA2"
FT                   /transl_table=1
FT                   /translation="MYVIFPIGWMYYFGTNLDERFSVPGFWPTAEQSHKIPFEKEEIDR
FT                   ELARMRTVDAVRRERRLRREAMEAQAQAQVAAQVENAE"
FT   CDS_pept        join(909784..909974,910029..910665)
FT                   /codon_start=1
FT                   /gene_family="HOG000027948" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264323"
FT                   /orf_name="AFUA_6G04040"
FT                   /product="Peroxisomal D3,D2-enoyl-CoA isomerase "
FT                   /EC_number="4.2.1.17"
FT                   /function="enoyl-CoA hydratase activity"
FT                   /function="isomerase activity"
FT                   /protein_id="EAL85635.1"
FT                   /db_xref="GO:0004300"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="HOGENOM:HBG060041"
FT                   /db_xref="HOGENOM:HBG327837"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="UniParc:UPI0000520938"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA3"
FT                   /transl_table=1
FT                   /translation="MAAEDLITLTYKERIAIITFNRPEKLNALNADLYYLLGERLREIE
FT                   KRDDIFITILTGTGRYFSAGADVNSTRPGGGLNSDTRREITRTFVVNNLDLTRTVYNHP
FT                   KILVAALNGPAVGLSAALVAFADFVYAAPHTFLLTPFSSLGLVAEGGASRAFVERLGIS
FT                   KANEALIMSKRITCEELVATGFVNKVISAPSGKPDDSEGFLKKVLEEVEDRLGTHLNQS
FT                   SLLKIKELIRRPERELLDRQNTYEVFAGMERFVKGYPQEEFRKLASGEKRHKL"
FT   CDS_pept        join(complement(912151..912278),complement(910959..912084))
FT                   /codon_start=1
FT                   /gene_family="HOG000231938" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903129"
FT                   /gene_name="cdc123"
FT                   /orf_name="AFUA_6G04050"
FT                   /product="Cell division cycle protein 123 "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85634.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG189908"
FT                   /db_xref="HOGENOM:HBG609337"
FT                   /db_xref="InterPro:IPR009772"
FT                   /db_xref="UniParc:UPI000051FDA9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDA4"
FT                   /transl_table=1
FT                   /translation="MPLLDPNTQTLAESSAAQPQRLPFPPVTYSHILHCSYHQWQPRYR
FT                   TLTPKSRAIPLTPSFVSYLRANGIVLPPETTRPHGDDDIDTFSDDGADEESDPSVEWQE
FT                   IHSQIKSTISEFGGKVTPKLNWSAPKDAVWMSATNDLQCRTPNDIYLLLKSSDFITHDL
FT                   EHPFDGCVPDPDDSSEAPATQPDIPYYLVLRKYVNFNPSLEFRCFVRNRVLLCMCQRDQ
FT                   NHFDFLFSLRDTLRSRIQAFFDEKLKDTFPDPNFVFDVYIPEPHQRVWLIDINPWADRT
FT                   DPLLFSWLEILQMKDPIGIKEEDTDAPEESFVRLSLNGATPTVVEVNRDEDSESEKDVG
FT                   SADDGDDSPFLPEFRLVKRDDPEAYSFSTPQYSAHKLPKEVVDASLAGSGGMSEFLGKW
FT                   QDILAKQTQEDTDSDDGR"
FT   CDS_pept        join(912596..912738,912997..915067)
FT                   /codon_start=1
FT                   /gene_family="HOG000201351" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751083"
FT                   /orf_name="AFUA_6G04060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85633.1"
FT                   /db_xref="HOGENOM:HBG056227"
FT                   /db_xref="HOGENOM:HBG327838"
FT                   /db_xref="UniParc:UPI000052021A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA5"
FT                   /transl_table=1
FT                   /translation="MASAGPDPQSLKSWQDAFQYPIPTVRHLEQELHRDIASNKERLRA
FT                   LVGSGIDSNTETERRALGAQLSLLHRCTQAIAYLLRKRASTLLTAKLLVLSRLLHKTLS
FT                   QQKTVPPFLDNLRNQLASLRRTLLKRIDKRLASAKSIVDDTIESLAAYCLATSSSSDDA
FT                   IRHFHHVRLDVIGNLLGLHESSGENVSNALQLYIQTLQMSKTLLSRRLSDVLNKLKARP
FT                   ILADPDILSLDELSVDVLGRWVAADVKNFTPWIKLSELSKPEAEKTIKQWSRQAFDAFI
FT                   KGCSHTLTDWCNFSELLALRRKTLELWLSSWGSTPTHSPMNILGGIQSVFNERLSQILS
FT                   HQAKELEQFGRAVSSVVTNWDTNEHVEALSLWDDELINLDYSDGAAVFKQTIADRLLGR
FT                   DADVSAVLAKYETWLAAIDKSKQYINDMKRVRWTDILEEGEEEDADMDITAILNDDDTA
FT                   LLTNALQQSVRESFNHLQSSFVEILSSFGPSHRDKKAAFLLKLVRLVRKDLPVNFISSD
FT                   FSLFKDIVPQLQEILIAQVVTLTEPSNLWPKRVSQTNEILQGRTLWEGDPELPVQPSPA
FT                   IFKFLRHLVDTMDAYGLGLWDVSTTQALKEGMRKELWATAAATLKALESVNDQEGSAVS
FT                   KEAQAVENGDNDNIEQSEANVAIGAQNTDDYKIQLYFDLLYLRNALSITKSAQDSLPDP
FT                   VESLFSSLNSNPTTVKILEQRAHDYWKRTHLLFGLLEVGTEQL"
FT   CDS_pept        join(915391..916495,916546..916721)
FT                   /codon_start=1
FT                   /gene_family="HOG000201362" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264324"
FT                   /orf_name="AFUA_6G04070"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85632.1"
FT                   /db_xref="HOGENOM:HBG056226"
FT                   /db_xref="HOGENOM:HBG327839"
FT                   /db_xref="InterPro:IPR012439"
FT                   /db_xref="UniParc:UPI000051EA63"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA6"
FT                   /transl_table=1
FT                   /translation="MASPRLPILYPHFMRAIRTCEPSTYRTIRGRPHSRSFHASRYRGQ
FT                   EAYHRRYGPAAEANLPPPSKPREELSKEQVSKTPAVKDGNHKLEQSRSQDGTKGDVLDA
FT                   SHKEDDDPKAAQSHESQSPNDSQTQEESELDLDDPDIHAVSPVSTERPSQDRHKPNSLS
FT                   DNPLEGVLHMPSPSSPLTPTETSRSDTKPHLAPVPYVHHFDTYSLVCDLSKGGFTEAQS
FT                   ITIMKAIRTILHKHLDIARQSLTSKSDVENETYLFKAACSELQSSLQTARNSEMQRQRA
FT                   ARAQLEHEADILSQRLNQELAGLKDDIKGMFNDHKMATREQQRSIDTSVQELNYKITVS
FT                   LNSDGKSEIEGLRWILTRRAAMAVATSAFMIIIFLKYYSVRKAQEAAEKKKAASAKETT
FT                   EKRVFQEAAPPPTLPAAPEIIISESLG"
FT   CDS_pept        join(complement(921197..923644),complement(920785..921147),
FT                   complement(919459..920736),complement(918820..919401),
FT                   complement(917192..918763))
FT                   /codon_start=1
FT                   /gene_family="HOG000201373" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056390"
FT                   /orf_name="AFUA_6G04080"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="EAL85631.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG056224"
FT                   /db_xref="HOGENOM:HBG327840"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051EF08"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA7"
FT                   /transl_table=1
FT                   /translation="MSSSENATTPAASDNAAPRAELDITKLHALPSEQQDLYLLTFTSD
FT                   LVQYISDLDSASVSLQQKSLKKELFKILTLSSPTITRVIRNNLGRSFGAILGKGDRGIL
FT                   FETVTDLLAILNAGKNEAELKTKFAAAHCLGEVFAVAGESVFAQSGTVASGLLKLLKSS
FT                   SNHTGLRGSTFAILRKVVVGAGVPVDEGTARDIWKQARNAATSDKSTFVQVHACRCLEQ
FT                   LVKTTPFFDNANDFDHLKTLIWKVIDSNVAPVRHAAAACLAQALVKLHASDARVTAVPK
FT                   PKKMKRQSKKPAPRPGEDDDEAEVSEPSVSKKAEPGLYFLLPDLLRQLSTQYMKSTTSN
FT                   RARAGIAACYKYVLRSLGDKLVEERYGQIANHLLFELLNHPTVTYNRFRLLMTRRFVKG
FT                   ILEETVGRETLRENSQLNAAKWLINEILKDYPQVLQERREPSKYTLASTLSALSSLISS
FT                   LGSAFGAMAEACREALLQVLPHPSYTVQIHAAHCLRNFVLACPHQLISCVTICLNSLSR
FT                   EIGQLSTPRQAPRRCVGYANGLSAMLSTSRLQPLYGSVDVFSRVFTQATDLLKTSGKSE
FT                   LRAASTQVQVAWILIGGLMPLGPSFVKIHLSQLMLLWKNALPKHLGKDNIAQRGYLEMS
FT                   FLAHVRECALGSLLVFMDFNSKLITADGARRIAAMLQNTIEFLDDLPRQKSVADLSQRL
FT                   QPSLQLHDLTTMVRRRVLQCFSKLIDVHPLSHADVISQTTLLSLSISSFADPEYTQPAP
FT                   LESSIAAATAQFETLWELCDNFGFGVTGLARQYIRATLSGKQDNENGPAWSAVDLSDQD
FT                   IDDAQLTFPICQASEHDSLLLYSSRSERDSVLADPHATGVVNAAIELFAVAIPLYAPKV
FT                   QESTMEQIATFLSSQSLQRNPGRKAAMIVNIAVALLHALKIAAKDSGSASGRLSPVTEK
FT                   VLQELLQKFVVDADPIVRTIGAEALGRLCDGAGNTLMTTQVNWLVDTIVDNREPNARAG
FT                   CAAALGCIHAQVGGMAAGLHLKTIVGVLMSLCNDPHPVVHFWALGGLERVANSAGLTFS
FT                   PFVSSALGMLAQLYNADTHNEEAASLATSNIEMTFLTPVVISRCVDSLINVLGPDLQDI
FT                   TKTRNLILTLLRQFQLEDNPALVTESSKCLDHMSLYAPGFVDFSGFVTRLQNELSAGNP
FT                   LMRDVAIRALSNLMKRDATSVLRAATPDLEEQIWLAYDDTPDNLVLKNMILDWLQHTAL
FT                   TETEQWIQRCQNTLTKTRLKVEDIPPTSAVKTAVNDMPDDEVAGFAYAIAGAGQSETVN
FT                   ETVTGQELLKWQTRNFVMSCLSQLLATVQEAILPDQTIPAELALQHKVGDIVRMAFSAS
FT                   TANVVELRVWGLKIIDQVLKMFGKTPDPDFAEASLLEQYQAQIGSALTPAFAADSSPEL
FT                   ASEAINVSATFIATGIVTNVERMGRILKVLVLGLENFSSKCKVEVFLKVCSPSPENPDT
FT                   TEFGDLKGLNSNAKVMVKMALFAAWARLQIASIDQDYLNEVVQPYLATLTPLWLSSLQE
FT                   YARLRFEPDISGSLGTGPQSTNLDEVYAALNRETLLKFYQDSWLSLVDAIAGLVEKDID
FT                   FVFDALDGKTTEPKDREEEKANMPNGKAVDKKHDINYRDEPVAFFFVLFGLAFEALVDQ
FT                   STTPSQRLDILQALKRILRPVISGNAIYQDAIFSETMDTFDRLALTEGTPIQTVIVEIA
FT                   RNLSLDHPSAKAGDARSDHLSDDIEQLFELTRSIILVLAGLLPNLGENTSVARFNVTSD
FT                   DSLSLIRLVLSSLVQVASIFPSIIRNDLNACILHIFTTILATGLCQAEVVPQALPTFKH
FT                   FIHGIIHPKASVSDEAQDLAIVSHQLRGCLTRFLTTLTIAQRRESESSLPCAKNTLLAI
FT                   TILLTTGGHILPPQDPAIPRVLNELLDCLQDVGLANVAAGCIRSILLTSTSRSPTNDLI
FT                   AKYLLPRLIAFLVGCPLDKGEIPSDPENSRTVIARTLVSYATSATFAASELPTAFSIVM
FT                   SALLARAKRESYPVYRETAAHLLELARADQATFRALVASMKPDQKGLLEEILRSSDPGT
FT                   GAGAGRAETNGAQSEASQSMPSIALRLDF"
FT   CDS_pept        join(923914..924127,924186..924811)
FT                   /codon_start=1
FT                   /gene_family="HOG000228370" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264325"
FT                   /orf_name="AFUA_6G04090"
FT                   /product="DUF28 domain protein"
FT                   /protein_id="EAL85630.2"
FT                   /db_xref="HOGENOM:HBG056223"
FT                   /db_xref="HOGENOM:HBG325050"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="UniParc:UPI0000F51CD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA8"
FT                   /transl_table=1
FT                   /translation="MASIVSQRLLLPQRCRTRHSVCEICRSFSSRAPLLAGHNRWSQIK
FT                   HDKAKNDKAKSRERQTIAKEISSATQMWGADPKFNPRLTLALSNAKRAGIPKTVIEAAI
FT                   ARGQGISVTGEALESVTIEAILPHSVAAVIECQTDQKARVLQDLRYAIKDAGGTVTPTT
FT                   YLFEKKGRIIFEKKDGVNPDDYLDQVIEAGAIDVATDDEDRLVVFTEPTETKSVGETLT
FT                   KVTGLAIKELDIIWDPNKDTMVELNKDEQVREIEDILSTLREDPSVQDIYLNTSTQF"
FT   CDS_pept        join(complement(927411..927432),complement(927299..927361),
FT                   complement(926202..927229),complement(925052..926146))
FT                   /codon_start=1
FT                   /gene_family="HOG000201384" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903130"
FT                   /orf_name="AFUA_6G04100"
FT                   /product="Mis6 domain protein"
FT                   /protein_id="EAL85629.2"
FT                   /db_xref="HOGENOM:HBG056222"
FT                   /db_xref="HOGENOM:HBG325049"
FT                   /db_xref="InterPro:IPR012485"
FT                   /db_xref="UniParc:UPI0000F51CDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA9"
FT                   /transl_table=1
FT                   /translation="MSSDQQSSPSGIEPRPSSLQDALEHLEAVAYVPSKKRYTDAGQLA
FT                   KTIASHAYESGIAPSALERLIHILTRKNLLDQGTITTLIKNLYPIDRISSKVVTQVVCC
FT                   LGPSKNKPSPATQASLLRWLILVYEFCEDRSHLAKLYAVLFNHLDMISLRKPLCHLLSI
FT                   ITRRKHVKPFRIQALMELVNAAGAEEKELIGLLNVFKNYYPDIIVGDLGALRRRGLVFK
FT                   HPDPEWTSHAKLLQDRNMEQVQAAQSSSFQVVHRGAAKRGKMEVIVPVLQTSRVSSNRT
FT                   SLEELRSVDHLIGKLDRIELPNQIISAMADNIAQKYLFLVQPESARLRLDDWLSSFFDE
FT                   QLEHAQDEERGSSESLGYILSLIVDYVRYTKDIPAPVQSFLRQYLSSWNGRDNKEEVLS
FT                   LLEYLPVQDFDILRANFLTPLEAAILGSGPFTMTVILDLYSSLIRQWGVKLRSSPSVSA
FT                   ESRPLGHLITHAELLALSILESLSVASNTGNKEPRKPAALSVLEFYCVLANLFSYAPVN
FT                   GQIRLTIPLAPTVYTLVFTPILSSISIISSVLASYKMSFETSLTSEILQVPGSTNSLYP
FT                   TELVGQFNGYVMDVCNLVWRNRGLNGDDPNALGCLLPPATTSALTQYIRELNEASRDRK
FT                   REASFFFNLSSIFSLSYHVALCNMSAGCFADIEEENNITEGKPRLRKPVTQKALSALEK
FT                   DGGVKLTWQEYRVRMLDWLDATGSRGIGNLMRSTMKALRKD"
FT   CDS_pept        join(complement(930094..930138),complement(928963..930027),
FT                   complement(928422..928907),complement(928050..928370))
FT                   /codon_start=1
FT                   /gene_family="HOG000201405" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264326"
FT                   /orf_name="AFUA_6G04110"
FT                   /product="CLPTM1 domain protein"
FT                   /protein_id="EAL85628.1"
FT                   /db_xref="HOGENOM:HBG027580"
FT                   /db_xref="HOGENOM:HBG560750"
FT                   /db_xref="InterPro:IPR008429"
FT                   /db_xref="UniParc:UPI000051FFD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB0"
FT                   /transl_table=1
FT                   /translation="MPEQRQRREEQESGGSGLKGALQGLAVFMLTQFLISQFFGNKSQN
FT                   AGSGVKPGELTSFQARPPRSEIADYSPIPDTVAPIWPPNSAVDISIYVSPSIVLPSLSS
FT                   LPSDSLVLSEKNFTIGNYSDTREIATTIEIPKEVQQNGTLWAHFYVALTGHQLDPTAKD
FT                   YSTDSAVHFFRPLNHYLPKKKVKKLKNLLASSDDTEEEEEDNSIPDVSIASYYHPNFTV
FT                   SLIPDSGVQKYRQVHPAIRHHMQLEATGARDASGQNGWYYPIVFLNTFWQLRSHMTELN
FT                   STVKTMPLRITLNNLSNWKFSMMASVDENAKANARQAAFGGSVPGGGDGSEFEMVKEIL
FT                   LDTNIWLLGTTGVVTILHMIFETLAFKNDISHWRKKKDVVGTSVRTILANVFMQTVIFL
FT                   YLMDNSENTSWMILASQGFGILLEAWKITKTVNVRLRAPPAGSFYSFLPYVVVFEDKHK
FT                   LSETEKKTKEYDEIAFRWLYIIAVPLLGAYAAYSLIYNTHKSWYSYIIETLVGSVYAYG
FT                   FLMMVPSLYINYRLKSVAHMPGKALTYKFLNTFIDDLFAFTVKMPWLHRLATLRDDVIF
FT                   FIWLYQSYKYKVDYKRVNEFGQGGDSDEEAEEPAAAESEKKLEAVSEASGRDNAEKSAR
FT                   KRK"
FT   CDS_pept        join(930498..930778,930834..930919,930978..931142,
FT                   931195..931269,931325..931569)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207683"
FT                   /orf_name="AFUA_6G04120"
FT                   /product="Short chain dehydrogenase/reductase family
FT                   protein"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85626.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056220"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F414"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB2"
FT                   /transl_table=1
FT                   /translation="MTDNPPPPDYSRPQFPAHSEPRVWLITAGDSPIGISVTRQVLKHG
FT                   DYALVGLAHTYLDLDECRREAFGEFLAEVESHRGEGWVERFKTVPLDIRMIGQCQALVA
FT                   EAVAAFGKVDILLCCTSQTLVGAVEELAASQQTLNLVKDQFETNYFGPLNIIKATLPHM
FT                   RKQKSGHIMILSSITAHIGTPGLGMYSAAGWALEGFCDVKPCIRNRPIQREAHNLPMQH
FT                   RNWYPDKLGHQCASHSSSVLSCCQSCPFVPWYIEQTGYSPAPPTDSGHGERSPKLKSSQ
FT                   LC"
FT   CDS_pept        join(complement(933751..933806),complement(933454..933631),
FT                   complement(932855..933376),complement(932089..932829))
FT                   /codon_start=1
FT                   /gene_family="HOG000201419" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264327"
FT                   /orf_name="AFUA_6G04140"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85625.2"
FT                   /db_xref="HOGENOM:HBG056219"
FT                   /db_xref="HOGENOM:HBG325048"
FT                   /db_xref="UniParc:UPI0000F51CEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB3"
FT                   /transl_table=1
FT                   /translation="MARKRKAVETGSTRKQPKTTRSTSSADVADFEDAGASGSTMSTNT
FT                   KPKRKPRRTAKDPWEEETLMTSTTSQLIDIDLVKLLARPEAWNCLEESEKEEILSLLPE
FT                   SLHPNRESTSDDPEAKIPPLPESFLRYSNFWRDSIRLFQLDLQNGRYDPEWQRQAHEAV
FT                   REREQGKFDRFKEEEFEEFWGQKQRMDKTLAAGQSSQVKLTTLIEHGVVREGDVWKYSR
FT                   TFAGKGRNKILVEKEAKVTAGPHLSSAKYPILKINGKRMTFAIPSGQRVFLPAVQAPVQ
FT                   QRSTASSQDKDDGFSKTVIPTNGAAKKNEEAQGDTDNTRKSRSSRKRKSEVELASRKKR
FT                   QQEPISSEEDSQDREPDDDVVLVANSRSVAVEVTSPRAEADSLIPTRILDTISTTNNKE
FT                   GESVAAAATEVLQDNVTSGVAMDEGSSSTNLASDSYQTSEIILENIGGPTALALKILEV
FT                   DGRIKDVPNGNAWKEFRSYRNNQDMGSLWEVRQAWYLRGK"
FT   CDS_pept        join(933914..933947,934007..934041,934100..934209,
FT                   934265..934670,934726..934788)
FT                   /codon_start=1
FT                   /gene_family="HOG000044957" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207684"
FT                   /orf_name="AFUA_6G04150"
FT                   /product="Protein transport protein sec22 "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85624.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG020780"
FT                   /db_xref="HOGENOM:HBG327843"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI000051FB56"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB4"
FT                   /transl_table=1
FT                   /translation="MVKSTQIARLDGLMLAASVDDEQAETELSEIKSQAKMIFRRMSRN
FT                   SAPQASIESGQYNLHYLIKDDICFLCICDRSYPRKLAFTYLEDLATEFTTTYSPSQYHS
FT                   PTLRPYAFVEFDTFIQRTKKIYQDSRASQNLDRLNDELRDVTKVMTKNIEDLLYRGDSL
FT                   ERMGELSGRLREDSKRYKKAAVRINWELLIKQYGPFAGVGFLLLFLIWLRFF"
FT   CDS_pept        join(complement(936140..936298),complement(935858..936011),
FT                   complement(935064..935794))
FT                   /codon_start=1
FT                   /gene_family="HOG000201430" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264328"
FT                   /orf_name="AFUA_6G04170"
FT                   /product="Killer toxin sensitivity protein (Iki1), putative"
FT                   /protein_id="EAL85623.1"
FT                   /db_xref="HOGENOM:HBG056218"
FT                   /db_xref="HOGENOM:HBG327844"
FT                   /db_xref="InterPro:IPR019519"
FT                   /db_xref="UniParc:UPI000051E5BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB5"
FT                   /transl_table=1
FT                   /translation="MAPPNISHRQTHNLLLISKLLSLRDTASPLTLLLDSLEQPATPLI
FT                   HEYIRRAKLSKVHVTLVAFETLRPFEGVDAFISARKKRPSEIVKEVGAAYQPVANVPSR
FT                   RRLILIDSINPLLRSKKTDSQFHLPTFLGSFIAPPGSSPTKAETSLIVTFHQDVPNQLC
FT                   ATPYSPSSFSVLSYLATTVIKLHSFSHILAQKAARDRSLAAPVFGLEEELDGVLLGRLD
FT                   KPTGKDSAEGVVLEMEHRRKSGRGVLEWYVLPPAARYPSNYAKEIVILLDDHPLYRPPV
FT                   EPDVGMGSSEPESTFELRLTERQRREREGVVLPYFDAQQGDGPGEGGRILYDIGEEDDF
FT                   DEEEDEL"
FT   CDS_pept        937642..938424
FT                   /codon_start=1
FT                   /gene_family="HOG000201441" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207685"
FT                   /orf_name="AFUA_6G04180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85622.1"
FT                   /db_xref="HOGENOM:HBG056217"
FT                   /db_xref="InterPro:IPR013957"
FT                   /db_xref="UniParc:UPI000051E82A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB6"
FT                   /transl_table=1
FT                   /translation="MAEPPAKRAKRVDSSTMWDLDERKTRSPEPDSDIGRSPRRDAPQK
FT                   DDRRREGPRDDRRYRSRSRDRAERRRERSRSRDRRDRDRDRDRDRTDRDRDGRGARDRD
FT                   TSATRERHYDRRGMPYPTDEIDLLIPNALQGYRDRYRSRSRSPIRNGNRNRTRTPPPRG
FT                   PKGDRRDDRKDNRPYANGVPHSSLRRDKDEMELDPAVPIEEDEMEALMRKTVGFTRFRS
FT                   TKNTKVPGNNIYGVRKEKKTVYRQYMNRVGGFNRPLSP"
FT   CDS_pept        join(complement(941878..941982),complement(941819..941826),
FT                   complement(941721..941766),complement(940851..941665),
FT                   complement(940012..940796),complement(939155..939939))
FT                   /codon_start=1
FT                   /gene_family="HOG000201474" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751084"
FT                   /orf_name="AFUA_6G04190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85621.1"
FT                   /db_xref="HOGENOM:HBG056215"
FT                   /db_xref="HOGENOM:HBG327847"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR014839"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000051F66D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB7"
FT                   /transl_table=1
FT                   /translation="MASRTSPDGEPSGPRFRPRDGLHVRPLNVEKGSDRFPMSDSIPPQ
FT                   TATWRNNLAALSQRRNLLFVAYSHQIYVWEPAGSFQTLGCQPEMIITPVMKEPHSSGYI
FT                   SPSFPHAINNLLVDDLGREEVLLLVTDSGNVCGYRIEAIFSALKRVAETEGNDKRPLDG
FT                   SQVDPFFVEYVQASAWGLAIHKFARLIAVSANTGLITVFAFALVNPTSKDGSDELENEP
FT                   DFMDYDQTWLDIRSNEQFAQLQRLMPDKHRTRNIKLTYTGHFSNIPSVGFYNCDLDPNG
FT                   TWMVSTDIDNKLLVWKIWESLGPFNVYHFNGSTIRSFPETLRNDAERGWAVLALDPRTF
FT                   QPIKTPEEAFGGQPLRRKKRGQVVLDITRLSNRIPDTSHLYNYFPPAVRSEPDHSVLPD
FT                   IFGADCRISNDSHTQAYSTRPKGLPQNRSSSSDSEPAGEGNLPSEAADSFDHHAADGSA
FT                   AEDEGNESDMNSDPSQRASNQDADAVGSGDNGNTNRFHNANVNFRRHRGQGPLTTAEFL
FT                   QFALLEALGGDIPGAEEYLDDNLDYSDIDEDNQEGESDDTDEEMDDAEARSSDSDAISD
FT                   TGLPAYSGSDALFRFYFPILHFSQTDIRLLPHPLAPQPSVVCGSPLRQAFTRPIVSIRA
FT                   CDRFNMVKCIPEHGIVVAASQKGRAAVIALTQSEETGLSFRIDWIVPFDSQERFGERPL
FT                   VPLLGMSVSPIQGFEMPPDVPYIPREVGDGKELHFQFTDVNHDRSKTFTPSSNIKGDSR
FT                   KIYAPTFPSGPGLRQSPTERDQQYPSTLPECHARATRAYQPEERWRGWNPSRRYRLLLM
FT                   YDDHTVMSYEFWYDWKTKFVSEEEDETDQDDVLIV"
FT   CDS_pept        join(942450..942487,942549..943197)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056391"
FT                   /orf_name="AFUA_6G04200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85620.1"
FT                   /db_xref="HOGENOM:HBG056214"
FT                   /db_xref="HOGENOM:HBG143734"
FT                   /db_xref="InterPro:IPR019315"
FT                   /db_xref="UniParc:UPI000051F40F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB8"
FT                   /transl_table=1
FT                   /translation="MDLVAGVRKEGSRGGRGEFKWSDVKDSAHRENYLGHSLMAPVGRW
FT                   QQGRDLQWYTKGETTAEEQARRDREELQRVKQAEEEAMARALGLPLPVSSGSANANLTP
FT                   LGERETETAVQDPADRKRERRSEQSRSPGRHRIRDRESNRDRDRDRRDHRHHRHHRHHE
FT                   DRERHHRNHRHRSRSPSGDREHRRRRSSSRSTSRVRAGEDGHRRHREDHRRRHPRDHDS
FT                   DHYRRR"
FT   CDS_pept        join(complement(945932..946181),complement(945383..945859),
FT                   complement(945164..945321),complement(945071..945116),
FT                   complement(944627..945005),complement(943635..944544),
FT                   complement(943325..943573))
FT                   /codon_start=1
FT                   /gene_family="HOG000201473" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056392"
FT                   /orf_name="AFUA_6G04210"
FT                   /product="Mannosyl-oligosaccharide glucosidase, putative "
FT                   /function="mannosyl-oligosaccharide glucosidase activity "
FT                   /biological_process="oligosaccharide metabolic process "
FT                   /protein_id="EAL85619.1"
FT                   /db_xref="GO:0004573"
FT                   /db_xref="GO:0009311"
FT                   /db_xref="HOGENOM:HBG056213"
FT                   /db_xref="HOGENOM:HBG327845"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniParc:UPI000051E5B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB9"
FT                   /transl_table=1
FT                   /translation="MHFPNLRFLLAPFLYNVVVSGWQASAADDLSVLATETAKANNDSL
FT                   LWGPYKSNLYFGVRPRIANSLSAGLMWAKVDNYATAQASFRHTCEQNEGMAGYGWDEYD
FT                   IRKGGRQTIHDTGNSLDLTIDFIKVPGGQHGGSWAARVRGIPREDGSPDQPTSIVFYAT
FT                   LEGLGNLGVATESGPIGYQGDVKLMGYTTELGDFSIDVTAGPETNEHPEHGHPSYEDKP
FT                   LDRTLVSSSTIAPENLWQVKPIFFAQLKSEVNEMIQRFGQENPPPPAQVFTIKNAPGDG
FT                   NIHLIQKVFKGAFEFDILFNSGSSPDPVTSDKLTEVISSASQSFSERFNKVLLPQSPFQ
FT                   TAEYSEFSKAMLSNLVGGIGFFHGDDIVDRSAAPEYDEENEGFWEETAEARARAQPVHE
FT                   GPKDLFTCVPSRPFFPRGFLWDEGFHLIPVIDWDTDLALEIVKSWLNLMDEDGWIAREQ
FT                   ILGAEARSKVPPEFTVQYPHYANPPTLFMVLEAFLDKLEASKGAYSQNSGGQEALDSLR
FT                   MTYLQKPELGEAFIRSIYPLLKRHYFWYRTTQKGDIKSYDREAFSTKEAYRWRGRSVQH
FT                   ILTSGLDDYPRPQPPHPGELHVDLISWMGMMTRAMRRIAEFVGETEDVEEFRGYETAIE
FT                   RNIDDLHWDEEAQTYCDATIDEFEESVHVCHKGYISLFPFLTGMLGPDSPRLKAVLDLI
FT                   RDPDELWSDYGIRSLSKKDEFYGTAENYWRSPIWMPINYLVVKNLYDIAMTSGPHQEQA
FT                   REMYSSLRKNLVENVFRQWKETGFAWEQYNPETGKGQRTQHFTGWTSMVVKIMSMPDLP
FT                   ANKQIGHDEL"
FT   CDS_pept        join(complement(947760..947803),complement(946489..947605))
FT                   /codon_start=1
FT                   /gene_family="HOG000201452" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264329"
FT                   /orf_name="AFUA_6G04220"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL85618.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG097646"
FT                   /db_xref="HOGENOM:HBG603845"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000052092A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC0"
FT                   /transl_table=1
FT                   /translation="MAASSERREIVIVGIVTLIEATEIAGGASGKAGGLLALWAYPSSI
FT                   VPLSYKLHADLAKEHNGKVRWGYREVGCGQIVVKGRPLNEKKDVGEKDTGSSLSLQKRS
FT                   DAAIAKLRKAKFPPDLDWIDPLLIRGYESISDPGETAQVHPYLFTTSIAKLAEEKGAEI
FT                   KLGSVTKIGYAGDAVESVTYNDKESGESRTISATDVIIAAGPWTRTVMPEAPISAMRAH
FT                   SVVIRPTKPVSAHTLFTNIEIPANFDPSKPSRPTVVSPEIYARPDETVYACGEGDQVVP
FT                   LPKTTADVEVDQRRCQDIIDQVGSISDELRDGQVCARQACYLPNVSVRGGPLIGHTGTK
FT                   GLYLAAGHTCWGIQNAPGTGKLISEFVFDGDAKSAKIGSLDPRNFL"
FT   CDS_pept        complement(948498..950360)
FT                   /codon_start=1
FT                   /gene_family="HOG000201485" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264330"
FT                   /orf_name="AFUA_6G04230"
FT                   /product="RING finger protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL85617.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056212"
FT                   /db_xref="HOGENOM:HBG327848"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000051F8C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC1"
FT                   /transl_table=1
FT                   /translation="MTGSDLSEDERSVELSSITAIYPEIKIDPTSPFKASLDIPVKPST
FT                   PLPVCFEQQLDAGFPEVLTPPTSLDASDVELGFATKDDGRDVHTLSYLPPLRLEIDLPE
FT                   GYPSEKAPIFRLETNPPWLSHSIILRLTEDGNRLWEDCGRDLVVYTYIDHLQQLAETAF
FT                   SVSDTADQEVRLPRDIKIALLDFNNKAEREKFEQETFECGVCLEPKKGSVCHRLLLCSH
FT                   VFCVSCLQDFYNNCITEGDVDSVKCLSPDCGKKKNDIAEAGNQLKKRKKHDRTLSPSEL
FT                   LQIPLDQETVQRYVSLKRKKKLESDKSTVYCPRQWCQGAARSKKHPKPIDPMSDDVESS
FT                   DEEEGFVFDPNGDEAQLPPMADRVAICEDCNYAFCSVCKKGWHGELVRCFPRREAELSA
FT                   EEKATEEYLRLYTSPCPTCDAPCQKRMGCNHMICFKCRTHFCYLCSSWLSEDNPYRHFN
FT                   DINSRCYNRLWDLEGGDGIDPEGPEALHRIPNDLVVFDEPSDDEGAPILEFREAEVAHR
FT                   RRPPPPAPVPPQVNQAAGGHGHRNRGNDANVLDAAGRAAAAERQAQARAIAEVRARPRQ
FT                   HDGPVAVQPPRPGRIHRPGLQRFLDLVQNDREDEWDSDELDDDF"
FT   CDS_pept        join(951674..951721,951808..951997,952062..952465,
FT                   952501..952503)
FT                   /codon_start=1
FT                   /gene_family="HOG000201506" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056393"
FT                   /orf_name="AFUA_6G04240"
FT                   /product="PAP2 domain protein"
FT                   /EC_number="3.-.-.-"
FT                   /function="hydrolase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85616.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG058366"
FT                   /db_xref="HOGENOM:HBG327849"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI0000520464"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC2"
FT                   /transl_table=1
FT                   /translation="MEDTPLASLSLTHVHYNPEDPLSLLSAWLALVPQALCVAYVTLIW
FT                   ASREMEVILMFSGQMGCEAFNFVLKRIIKEERPKQMLGKGYGMPSSHAQFVTYFAVYLT
FT                   LFLLVRHIPTVPKPDTTSYFLMRMALAAGVCLGAGAVATSRIYLNYHTPKQVLAGCAAG
FT                   VLCAVSWFVATSFLRTEGYVDWVLDLGISQFLRLRDLVVSQDLAEAGWLQW"
FT   CDS_pept        join(953188..955146,955197..955309,955375..955544,
FT                   955595..955724,955775..956606)
FT                   /codon_start=1
FT                   /gene_family="HOG000201507" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207686"
FT                   /orf_name="AFUA_6G04250"
FT                   /product="Pheromone-dependent cell cycle arrest protein
FT                   Far11, putative"
FT                   /protein_id="EAL85615.2"
FT                   /db_xref="HOGENOM:HBG056211"
FT                   /db_xref="HOGENOM:HBG325046"
FT                   /db_xref="InterPro:IPR012486"
FT                   /db_xref="InterPro:IPR021819"
FT                   /db_xref="UniParc:UPI0000F51CD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC3"
FT                   /transl_table=1
FT                   /translation="MMDDSIASSDPTMEEHHIVKADEVDQTGTDITTVSDDQLMEEVAQ
FT                   GLRQEQASKATSAGPNESQEQRPNPSRRPELRRNVSAPPPPLQPPPPAPVQQLPDRPPD
FT                   SLSLAQLKQIVQDMPKVNQPAYAFEYADSQPLVEEIEEWFQYSEFDRIMLLGMKSTFER
FT                   KWASFCENQSAVSDRLPWLDAPHDLRKSFMEQIINGLPDRDISSRTEALEVVCYALTGI
FT                   WGSTAGKAVPDYPEDLPPQAVTDTPNSKSLQIIWMQRNAELVNECSGLGPLLSCLCKAL
FT                   EKNRSSYNPESDGLDSHSDSANVAASEHEVNLVLTALYIVVEIGRRQEKHSQDVSLRDA
FT                   LMGLKPNLSVFLVEVIARLRWDDSANIPLTRIILLFWKCLLLFFGGSDSLKKAKEELEP
FT                   RMEARENSPNRRTPFLTASPLDYHLFRQEITSKYPAYNPPLPVVPLELENNSILPPLPQ
FT                   HPSRTSSSTGLFSGVGPSVAGGNGSILHQSVHIATPAPSPPPSPIGPGGKAGKKQNYQT
FT                   NQNFPFMYPPLDDSSNDIGGKGSAERQDALVGKRWEGSDVPASIIEAGKLFSTHVKMTR
FT                   AMRQLWEERERFMKYDRGWYLDENSPSSDEDPSGELAEDLENLVLEGRKKSSHSWAPQR
FT                   ETDNDDIQRRLDAVESFYSQVLVHLQSITIVFLKIILTNVSAMVNPASGQNGHAMSDGY
FT                   GAVNGFPAAPNSFSDSFNADAAIEELDNIRLREITGKAISGSLLLMLKWFKRSHILKFE
FT                   YMTQLLLDSNYLPLILKMFAHQDIDQAIAQKNDREELGFFHFCHVHSDQPPNSADNSEE
FT                   DSSPSDDEAVPPPILRHRRDTDPGTSSVRPPSPQEALPELVEGAHRPEVDELGFPTAPP
FT                   PKEPITVFSFRNFFSAINYLHIMQKITRDKAHRCLLLVQYKSSTILRKGLKIPDPHLRF
FT                   YTLKLFKSQVPYCGRKWRQSNMRVITAIYLYCRPELRDDWLAGSDIDAEVEEALPLEQA
FT                   LRGLTHWWHLRRYKDVMGGGEGASMMEEERDFFVRELEAMGWGFAGEEMMNEEAEMAAN
FT                   GVMMNGTEWDGGPLQMEGW"
FT   CDS_pept        join(956932..956993,957093..958005)
FT                   /codon_start=1
FT                   /gene_family="HOG000201538" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264331"
FT                   /orf_name="AFUA_6G04260"
FT                   /product="Ribosomal large subunit biogenesis protein MAK16,
FT                   putative"
FT                   /protein_id="EAL85614.1"
FT                   /db_xref="HOGENOM:HBG336099"
FT                   /db_xref="HOGENOM:HBG522263"
FT                   /db_xref="InterPro:IPR006958"
FT                   /db_xref="UniParc:UPI000051EA61"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC4"
FT                   /transl_table=1
FT                   /translation="MSSDEIVWQVINQQFCSYKLKTTKGQNFCRNEYNVSGLCNRQSCP
FT                   LANSRYATVRSDPETGVMYLYMKTIERAHMPSKLWERIRLSSNYAKALEQLDERLIYWP
FT                   KFLIHKCKQRLTRLTQVAIRMRKIAKEEERLGEKIVPKLAPKIRRREETRERKAESAAK
FT                   VERAIERELIERLRSGAYGDRPLNVEEGIWKKVLRGLERTGEGERDEDLDDGEEIEDEE
FT                   EEGVGEVEYVSDLEDDEDLEDIEDWLGGDSADDSSDYDDDEEDEDSDEESGSEEASSDE
FT                   ETKKPKPGAKRKRAAPQVKPRKRGPRVEIEYETEGAGKESILA"
FT   CDS_pept        958636..959376
FT                   /codon_start=1
FT                   /gene_family="HOG000201539" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264332"
FT                   /orf_name="AFUA_6G04265"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27237.1"
FT                   /db_xref="HOGENOM:HBG325045"
FT                   /db_xref="UniParc:UPI0000F51CDF"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA19"
FT                   /transl_table=1
FT                   /translation="MTSYFSSITSSSAISNISTRLNSLRRAITSGDEADDPENEDCSHI
FT                   SNVLRAYYTEKGRPFPSWLPPDPKAPAPAPSRTIATTQIQPGTYGHGSAGTTSAPGRGG
FT                   GLSDLWGDSGASQQPPASQTASLRRGRLAPGSAGAPLSTVHSAPSGSVVTPPSGSPTPP
FT                   TAHPPGARPLPSQRAGSYQTIASGQASLERAASAQERLRARLHGGRSPSPAQTPPGGSR
FT                   PGSPYYGGGPDPSVRKPVGMPGRR"
FT   CDS_pept        join(960907..961462,961522..962621)
FT                   /codon_start=1
FT                   /gene_family="HOG000201550" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264333"
FT                   /orf_name="AFUA_6G04270"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EBA27236.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG325044"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51CEF"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA18"
FT                   /transl_table=1
FT                   /translation="MAVKDVEVPLDDHKEVAEEMDDIQNDLKSEAFNEAAMDAELQQLE
FT                   AQLGSVKQSRLELTFANPAYFTYVLVAFASMGGLLSGLDQSLISGANLTMPKALHLSAS
FT                   QASLVNAGMPLGAVGGALILGPCNEFLGRRMAIIVSCILYTIGAGLEAGAINFGMMFGG
FT                   RFVLGMGVGLEGGTVPVYVAESVPGKIRGNLVSLYQLNIAFGEVLGYAVAAMFFGVAGD
FT                   WRYILGSSLVFSTILLVGMLFMPESPRYLMHKGRPVEAYGVWKRIRGFDSYESKEEFLG
FT                   MRQAVAAENEEQANTKKWAWLDFFTNGRARRAMIYANIMVFLGQFTGVNAVMYYMGVLM
FT                   TKIGFDDRTSVYMSLVGGGSLLIGTIPAVLYMERFGRRYWANVMLPGFFIGLVLVGAGY
FT                   TIDYKTYPATAEGLYLTGIILYMGFFGSYACLTWVIPAEVFPTYLRSYGMTTADANLFL
FT                   CSFIVTYNFTAMMNSMTRIGLTLGFYGGIAVLGWFYQVLFMPETKNKSLEEIDELFSKP
FT                   TSVIVKQNIKSTVEIMRDLSHLRFRKVFSPSPRL"
FT   CDS_pept        join(complement(964148..964300),complement(963707..964079),
FT                   complement(963551..963636),complement(962988..963458))
FT                   /codon_start=1
FT                   /gene_family="HOG000201285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264334"
FT                   /orf_name="AFUA_6G04280"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL85612.2"
FT                   /db_xref="HOGENOM:HBG056209"
FT                   /db_xref="UniParc:UPI0000F51CF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC6"
FT                   /transl_table=1
FT                   /translation="MNDIPNPHGTGLVVLIWILTGISVVVVSLRVLAKTKIRQFRIDDV
FT                   VMIVVLILGIISGSLHTTAVKYGYGLPDATVPEPVATTGRKFYIIGLASLILCSAVGRA
FT                   AFVLYLLAILGGQKGRRIILTALAILEMVFNSVSVILIFATCTPVSMVWDYAAEGTCTA
FT                   TSIQVNFGYFQSTFNVFVDLYLAVFRPISSGILNSNSESKSRDGRRYRQNRPTPEIYND
FT                   ALGGTVNLLRWGYIEADLVIITASLPCLRSVILSGFHYMTSSGHRSRSYELGAAYTGTH
FT                   AGTASVTAQATSHRKTDSRLRGMLSTRNRADDGASVDRILGSRNSLDGVETGGSSQEGS
FT                   AGIRKQVEVTVVADDRRKGV"
FT   CDS_pept        join(complement(968705..968919),complement(965671..968626))
FT                   /codon_start=1
FT                   /gene_family="HOG000201274" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264335"
FT                   /orf_name="AFUA_6G04290"
FT                   /product="Phosphoethanolamine N-methyltransferase, putative"
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL85611.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG396217"
FT                   /db_xref="HOGENOM:HBG435818"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI000051F197"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC7"
FT                   /transl_table=1
FT                   /translation="MASTPASGAGYDCPSSKGPRPTTGSSPGTSSPRASEPRPGRTTKA
FT                   QVDKTKEFERAFTIKHLGILAVFGWILLLHVAGTYFFTKGFLLTRMVLEDKSACDVLPF
FT                   DDSSSSASKGKQGCWHEKSFDKAIVITIDALRYDFTIPFAPESESETAHLFHNNIPVLY
FT                   ETAVKSPENAFLLPFIADPPTTTLQRLKGLTTGTLPTFVDAGSNFAGTAIDEDNLVAQL
FT                   YAAGKTLVHLGDDTWHALFPGYFDADLTRPFDSFNVWDLHTVDNGVNDHLFPLLHPENS
FT                   TKWDVIFGHYLGVDHAGHRYGPDHPAMAAKLREMDQVVRDIIARLDDKTLLVVMSDHGM
FT                   DSKGDHGGESNDEVEAALWMYSKKPIFGRTSTETANPPRTARERFVPQIDLVPTLSLLL
FT                   GMPIPFNNLGSPIEEAFVGVGGNGWKNFATVNRLTSAQIRRYQHEYTSSHGADAAQSLG
FT                   SEELWEAAESAWQKLPRAGKSNVAASRSASELHRQYQRHVLHICRGLWAKFDVPSMLQG
FT                   VGILFAAIVLLVFYARGITAARTELTGSLLSSVGVGSVLGAVTGACLSYSRMLSARAVE
FT                   SSALLAAVGSIVGASWAIFGKSGRIVLPLPNSLWGWLAILFTVSQSMGFASNSYTIWED
FT                   EILLFFLSTFGVVAGASSMRQKSTADRVLGVYHSILFVILGRIASFSRLCREEQMPFCR
FT                   STYYASTTSSTSAPWQLVIPFLVTLTLPAVVRSFYAGSKSYEGAATLWIGFAFRFGLFV
FT                   TSIFWTLEAADDSEWGLLSKETLKTIRVFFAQVVLALAFAAGTTAFVYTKPCVSISVSQ
FT                   GGAESEGREPARKTVTILGFGNVYGTRAFLLVVNFCLAIILMQKPMGQGAIGLLLWQIL
FT                   SLLEILDTNGLVMGNSAIGPVVLGLLGSFHFFKTGHQATLTSIQWETAFIPLSSVQYPW
FT                   SPILVILNTFGAQILTAIAVPLTVLWKRPLQLHDSSSSTTSSTPATRILSDVAQAAATY
FT                   ILYFATINLATTMWAGHLRRHLMLYRIFCPRFMMGAAVLGVVDIVLILFSVTSVRFSIL
FT                   SVAEIFGW"
FT   CDS_pept        complement(970368..970916)
FT                   /codon_start=1
FT                   /gene_family="HOG000201263" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264336"
FT                   /orf_name="AFUA_6G04300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85610.1"
FT                   /db_xref="HOGENOM:HBG056207"
FT                   /db_xref="HOGENOM:HBG327829"
FT                   /db_xref="UniParc:UPI000051F664"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC8"
FT                   /transl_table=1
FT                   /translation="MFIKLVTRGDSSNSDDNNSLAPAMIDLLISLLVLIILGIVLVATL
FT                   LVLRRKRQNQMDSELPVHNGQCSPNHRRLTISASSNSRTQSILVYDEKRSLIENSSSPP
FT                   PSPVPEIRITFPEEEDESGKRKSGRVVVVRISDAGAVGLEPCNEELPPYQTSDAERFQS
FT                   LDIERMGGLKEKDDLKRWS"
FT   CDS_pept        join(977345..977477,977555..978891,978953..979231,
FT                   979294..979849,979906..980327)
FT                   /codon_start=1
FT                   /gene_family="HOG000201252" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264337"
FT                   /orf_name="AFUA_6G04310"
FT                   /product="mRNA binding protein Pumilio 2, putative "
FT                   /function="RNA binding"
FT                   /protein_id="EAL85609.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG056206"
FT                   /db_xref="HOGENOM:HBG327828"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051FB52"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC9"
FT                   /transl_table=1
FT                   /translation="MSGSSMNSDRSRGPHAGMGKGFGAGKSSWNTNIWGDSNLKSGFDD
FT                   QNLAETGFEGKSGSGSLLPSSESDGWSSRPNLPWNTVNTTSASLSRGQNNGMTASPIST
FT                   RPNDRSAPALSDTVDSTSYFSIPRSSGIGSSSGGGNHKTYLNAGADGISPCGDGLSFGN
FT                   FGGLRSGDGRRHPNSSAFGGSPVGTGFPMKQGFTTLDTTRPDEITGSLTMSSLPQALPD
FT                   TMSQPLARNGFAHASHNSASITSQRPTHASHPSFHSESQGFEGRFGGSSMDLSAEINTL
FT                   QLNEGGFSGHPVSRPPYLSHSSYDGSLQRFKYQSAADESSYEAVGGYAGDGLSELPLGH
FT                   HAGRSRLGEGSLSPTDLARMESTFYSALEAGAVPGSHYRNGSATRLSENQALALERKLR
FT                   AMQHDQDLAHGAANSLQRIPYNTPAYDLAGYQAARLNALSGFYPVAQLGGLGSAGIIPR
FT                   GHRDQDPAQVVRSPLLEEFRANSKGNKRYELKDIYNHIVEFSGDQHGSRFIQQKLETAN
FT                   SDEKEQVFREIQPNCLQLMTDVFGNYVVQKLFEHGNQSQKKILANQMKGHVLALSTQMY
FT                   GCRVVQKALEHILTDQQASMVKELENHVLKCVRDQNGNHVIQKAIERVPSQYVQFIINA
FT                   FKGQVSRLAAHPYGCRVIQRMLEHCEEVDRESILAELHACTAHLIPDQFGNYVIQHVIE
FT                   NGEEKDRSRMINVVLSQLLMYSKHKFASNVVEKSIEFGEESQRQQIISTLTSANERGES
FT                   PLLGLMRDQYGNYVIQKVLGQLKGEEREGLIDQIRPLLSQLKKFSYGKQIVAIEKLIFD
FT                   STTLGANSLPPASSTTPPHSHKSSPQPSKRLVNDVENSRAPVVGAAPPTPPPTDNQGHT
FT                   HGPAESKNLAKSTVTSLSVSESASADSNGSVPVSAST"
FT   CDS_pept        981454..982107
FT                   /codon_start=1
FT                   /gene_family="HOG000201241" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264338"
FT                   /gene_name="cwc21"
FT                   /orf_name="AFUA_6G04320"
FT                   /product="Pre-mRNA-splicing factor cwc21 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="EAL85608.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG056205"
FT                   /db_xref="InterPro:IPR013170"
FT                   /db_xref="UniParc:UPI000051E5BD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDD0"
FT                   /transl_table=1
FT                   /translation="MSSNVGLSTPRGSGTSGYVQRNYAFMKPRNAGYGAPYPPVSGANA
FT                   NDSSRGFKQRQPDKQILEHDRRRAVEVKVMEERERLEEENERIEQEGKGKGEGEGKVLS
FT                   EEEIEERCEALRARLLKEMEEEENRKGDAADGERDEGRERRGWKRGPRDRERDLPPRER
FT                   RQFKTYQVHELAEAKIEESERFKKALGIREDTETGEISSGRKDYEPRKRDRERY"
FT   CDS_pept        join(complement(985765..985968),complement(982264..985695))
FT                   /codon_start=1
FT                   /gene_family="HOG000201240" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056394"
FT                   /orf_name="AFUA_6G04330"
FT                   /product="DEAH-box RNA helicase (Dhr1), putative "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="EAL85607.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG525455"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000520927"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDD1"
FT                   /transl_table=1
FT                   /translation="MPKFVPRQRKQKHRQNSSNDAAVDTNAVEILPISKSEREARKQKL
FT                   REELRAQHTKISAKKQKRLDKYIENKLKKEENVELLKKLEKIKVDTSALQSSKELGKRK
FT                   REDENIVPTTTTKDVSTSHNQNSDSELSGDETDDSFVDPKGTTKRKLAETAPAPPIPAP
FT                   VIGGGLKRPLELGPDGFPVLKKRKRAPKAKPAAVSVPEVPWEGFNSDDGNDSAGSSDEE
FT                   PEDSEIDAETKNVQDGEKDASSDNDESDEEDSGSDNEEEDEEDEDDEEGVVDDEEAESL
FT                   AQLRIKPRQSAFKEWARQQINEVVGFKPSGPITAEEQPFVRESKRPVRNTVAEEEPLPL
FT                   ELQVTKGDPNRKAFSVQVDRSEEVQNSRLGLPVVGEEQKIMEAIHNNSSIVIWGATGSG
FT                   KTTQLPQFLFEAGYGHPDSPNPGMIAVTQPRRVAAVSMAKRVADELGQYSDRVAYQIRF
FT                   ESNVSSKTAIKFMTDGILIREIAEDFALKKYSVIVIDEAHERSVNTDILIGMVSRIIDL
FT                   RKAMSEEDPSIKPLKLVVMSATLRISDFTQNPSLFRQGPPPLVQAEGRQYPVTVHFARR
FT                   THRDYVEEAYRKVCRGHRKLPPGGMLVFLTGQNEIRHLAKRLKQTFKPTQRGEATQAKV
FT                   QLSANDAPLEAEDLDLGGADLSHLGNEDDESDLEITGLDENPEEDEEFNLGEEAMDSST
FT                   RVHVLPLYSQLPTKEQLKVFEPPPEGSRLIVLATNVAETSLTIPGIKYVFDCGRAKEKQ
FT                   YDLETGVQKFQIGWISKASANQRAGRAGRTGPGHCYRLYSSAIYEGEFAEYTDPEILRT
FT                   PIEGVVLQMKSMGLHNVINFPFPTPPSRQGLAKAEKLLKNLGALSANGKITQIGHRLST
FT                   YPLSPRFSKMLHIGHQHGCMPYVIALVSALAVGDLFIPENQIDPATSKEEDKSDGVYKN
FT                   SDRLEDTAREQRHKDYTRAERLFSKHDDTSDAMKYLSAICAYAYASNGDSFCDQMFLRA
FT                   KAFKEATQLRQQLTDIVRANNPGLIGAYEPRLPEPTDKQIKALKQIVTAGFIDNVAIRA
FT                   DLAPVPPEMDRTPKRAIDVPYLTLFRSREGRATELQEKAVYVHPSSVLARLSPKEMPQY
FT                   LVYSHLQQSAPSLLSDQVPRIRMYPLAAPSGLQLSAIAHGTPLIEYGKPIGKIEPMDGV
FT                   PQRRACWVIPSLVGEAGGTSWPLPAKKVIQRKDIKDGWVIEKFTA"
FT   CDS_pept        join(complement(987814..987914),complement(986911..987731),
FT                   complement(986636..986823))
FT                   /codon_start=1
FT                   /gene_family="HOG000217813" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264339"
FT                   /orf_name="AFUA_6G04340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85606.1"
FT                   /db_xref="HOGENOM:HBG056204"
FT                   /db_xref="UniParc:UPI000051F8C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDD2"
FT                   /transl_table=1
FT                   /translation="MDPDAQIQQQHEPIESKKKSKIQALLSRAQRPEVQGYDERLRTAS
FT                   FVKPAEPKTFEDVAVNEGCKMVRGSLIVGNRYLRCHLLRLSIQVRYKIYEFLFCHHNSN
FT                   VEIGVPYNPKIGDLAILRTSHVFYHEASIALYHSLGDRRLFFRNYGSKSADFLRRQPTP
FT                   LSCCRNRVFQQWLEYPCRNKEIVWRRSFKKIVFLIGASEPLLAVQRRWAFAEFITTLRM
FT                   GEPLRVHELSVVVYNQWKIPGFDEGDLVRALFSGGIEFLGRLIFRGLAGDETERLTQLI
FT                   FALRIPNLTIERVRTRAEEEEVSINSYALKYEINNAEKDIPVSLCSFESKADDKQSLLV
FT                   RCLCCNNTCYLAGVELTNCFMSRSSTPKQ"
FT   CDS_pept        join(989682..989843,989892..990070,990118..990229,
FT                   990286..990346,990396..990715)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264340"
FT                   /orf_name="AFUA_6G04350"
FT                   /product="Putative uncharacterized protein "
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85605.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="HOGENOM:HBG056203"
FT                   /db_xref="InterPro:IPR010347"
FT                   /db_xref="UniParc:UPI000051E5B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDD3"
FT                   /transl_table=1
FT                   /translation="MSNLRLCFPPMEGQVNCMHSKLMLLFHPGYLRIVAPTANLTPYDW
FT                   GEMGGVMENSAFLIDLPRKVATTSVGSKTVFEEELVYFLRASTLQENIISRLDEFDFSP
FT                   TSHIMLVHTIGGSHTGNTWRRTGYCGLGRAVNALGLRTSKPINIDFVASSVGSLTDEFL
FT                   RSIYLASKGDGGTTDFTLRTSKTFSARNPNDKDQLIHKNTAEEWKDRFRVYFPSQTTIE
FT                   QSRGGPDCAGTICFQSKWYEGPKFPRHVLRDCKSRRPGLLMHNKVALPPSAEVIS"
FT   CDS_pept        join(complement(994823..996144),complement(994549..994769),
FT                   complement(991932..994495),complement(991341..991877))
FT                   /codon_start=1
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903131"
FT                   /orf_name="AFUA_6G04360"
FT                   /product="ABC drug exporter AtrF"
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85604.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000051EA78"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDD4"
FT                   /transl_table=1
FT                   /translation="MADGSRLPESATSTTMETNTNEHAKVLSPDAETVPSSSMTATSSE
FT                   LSLDGRWGERDQGEPVSRRGAMEDFEEMRRELTQLSLRRTRSVGKDAHRLRSRASGRAS
FT                   QVHDEEKAIDEEDSTIDGDGDGYQGGFDLGEFLMGGHLERRTTTGEPAKKVGVLFKHLT
FT                   VKGVETGASFVRTLPDAVVGTFGPDLYRIVCSFIPQLRFGKQPPVRELLHDFTGLVREG
FT                   EMMLVLGRPGAGCSTFLKTIANDRGAFAGVEGEVRYGGLSAEEQLKHFRGEVNYNPEDD
FT                   QHFPSLTVWQTLKFSLINKTKKHDKNSIPIIIDALLKMFGITHTKNTLVGNEYVRGVSG
FT                   GERKRVSIAETLATKSSVVCWDNSTRGLDASTALDYAKSLRIMTDVSKRTTFVTLYQAG
FT                   ESIYELMDKVLVIDSGRMLYQGPANKAREYFVNLGFHCPEKSTTADFLTSICDPNARQF
FT                   QPGREASTPKTPEELEAVFRNSETYKTICDEVASYEKKLQDTDQEDTRRFQKTVAQSKS
FT                   RTVSKKSSYTVSFARQVLACVQREFWLLWGDKTSLYTKYFIIISNALIVSSLFYGESLD
FT                   TSGAFSRGGALFFSILFLGWLQLTELMPAVTGRGIVARHKEYAFYRPSAVSIARVVMDF
FT                   PAIFCMVVPFTIIMYFMTGLDVTASKFFIYFLFVYTTTFSITSLYRMFAALSPTIDDAV
FT                   RFSGIALNILVIFVGYVIPKQGLIDGSIWFGWLFYVNPIAYSYEAVLTNEFSDRIMDCA
FT                   PSQLVPQGPGVDPRYQGCALPGSELGRRGVSGSRYLEESFQFTRSHLWRNFGVVIAFTV
FT                   LYLIVTVLAAEFLSFVGGGGGALVFKRSKRAKKLATQTTQGNDEEKVQDVGDKAALSRG
FT                   EAMSASNGESFKRISSSDRIFTWSNVEYTVPYGNGTRKLLNGVNGYAKPGVMIALMGAS
FT                   GAGKTTLLNTLAQRQKMGVVTGDFLVDGRPLGADFQRGTGFCEQMDLHDNTSTIREALE
FT                   FSALLRQDRNVSKQEKLDYVDQIIDLLELNDIQDAIIGSLNVEQKKRVTIGVELAAKPS
FT                   LLLFLDEPTSGLDSQAAFSIVRFLKKLSLAGQAILCTIHQPSSMLIQQFDMILALNPGG
FT                   NTFYFGPVGHDGGDVIKYFADRGVVCPPSKNVAEFILETAAKATTTKDGKKIDWNEEWR
FT                   NSEQNQRVLDEIQQIREERSKIPVTETGSPYEFAASTMTQTLLLTKRIFRQYWRDPSYY
FT                   YGKLFVSVIIGIFNGFTFWMLGNSIANMQDRMFSIFLIIMIPPVVLNSIVPKFYINRAL
FT                   WEAREYPSRIYGWFAFCTANIVCEIPMAIVSSLIYWLLWYYPVGFPTDSSTAGYVFLMS
FT                   MLFFLFMSSWGQWICAFAPSFTVISNVLPFFFVMCNLFNGIVRPYRDYPVFWKYWMYYV
FT                   NPVTWWLRGVISSIFPTVQIDCSPSETTHFNPPPGQTCANYAGNFITNIAKNGYLLNPD
FT                   ASADCQYCPYSNGAEYMATLNVHDGDKWRCFGIFLAFVIINWLLVYFFIYTVRVRGWSF
FT                   GMGYLFGGMGLVIDKVKGVFKRKSEKA"
FT   CDS_pept        join(999085..999936,1000011..1000106)
FT                   /codon_start=1
FT                   /gene_family="HOG000217284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056653"
FT                   /orf_name="AFUA_6G04370"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85603.1"
FT                   /db_xref="HOGENOM:HBG054391"
FT                   /db_xref="UniParc:UPI000051FFD7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDD5"
FT                   /transl_table=1
FT                   /translation="MAVRAGRQMSYQQLFHVSPATGEYQYCGEQDFLRVLDSEYHALEE
FT                   DTSGCRSQYIIISNVDEQTFSETFSHPCKKLFTSSFFEYIPGLALLLVRMTSAAHEQGY
FT                   NALHSMITRKCAFMNGLDLQLSVMGHVAITSNGRTKKADQTYRPVVVPQPRSDHWPTVV
FT                   IQCAYSQPRSKLANDARWWLLEAGGDVKTVLTILVHQTRREVVEKWELIPRETRQGQNK
FT                   KVPEITRRVVMSQKTDNDPIRVTGYPLTLPFEHLFLRPANPGEGDIVLDESDLETIATL
FT                   TWRDRLNITYLRYGMGSERRLKMYYIAQLNGREE"
FT   CDS_pept        join(complement(1001756..1002574),
FT                   complement(1001419..1001701),complement(1000246..1001360))
FT                   /codon_start=1
FT                   /gene_family="HOG000201140" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751316"
FT                   /orf_name="AFUA_6G04380"
FT                   /product="Molecular chaperone (ABC1), putative "
FT                   /protein_id="EAL85602.1"
FT                   /db_xref="HOGENOM:HBG056202"
FT                   /db_xref="HOGENOM:HBG328306"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000051FB5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDD6"
FT                   /transl_table=1
FT                   /translation="MSGKRLLDAIQLFNVAKSVATNHLTLRQRQLDVFTRTSSLTKGIQ
FT                   RQTEGLILTAQAAAALAKRFNEPSPSEAAPKTQPTSTTASSQPTNAAARSGLSPDKAKK
FT                   AQRQAEFQIPSSAAGHTVNNGSSALNVSDQQDVFYQPSQESTPGLSGLPRVKLPKTISN
FT                   TQVNLDSSLNADSFHSPVNTEKSASEEVSTTEQQDVSEEMMKEIFHSPKVARILSKKGV
FT                   SDMKNPDWRAKGFSESSVSRRSASAPVEKVKQVNKEELEKIGASIAEDVALKDHLIAAD
FT                   LKQSDTYKMTESRVPSSRLGRLWQYSGLATSMAFGAVGEGLRRMTGGKDDYAGSIMFSP
FT                   GNMERLVAKLSKMRGAALKLGQMLSFQDNKMLPEAIHQVLQRVQDRADYMPASQRDKVL
FT                   ADNLGPNWRDLFSTFDEVPMAAASIGQVHGAVLKRTGQPVAVKVQYPGVAESIDSDLNN
FT                   LSILLTASRLLPRGLYLDKTIANARTELAWECDYIREAECGNRFRELVKDDPVFLVPEI
FT                   IPEASGKQVLTMERLEGIAVTKIHDFTQAQRDWIGTQILRLSLREITEFRFMQTDPNWT
FT                   NFLYNAKTNKLELLDFGASREYPVEFISKYIRTLIAASRNDRERCHSLSIELGYLTGHE
FT                   SKTMVDAHVSSILTLAEPFMDSSPDVYDFRNQTITDRVRSLIPVMIRERLSPPPEETYS
FT                   LHRKLSGAFLLCARLGSQVRCKELFADAIQKAEKSGLDVGSTRK"
FT   CDS_pept        join(complement(1007006..1007212),
FT                   complement(1006748..1006942),complement(1006486..1006629),
FT                   complement(1006380..1006428),complement(1005774..1006321),
FT                   complement(1004620..1005717))
FT                   /codon_start=1
FT                   /gene_family="HOG000201108" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265323"
FT                   /gene_name="bre1"
FT                   /orf_name="AFUA_6G04390"
FT                   /product="E3 ubiquitin-protein ligase bre1 "
FT                   /EC_number="6.3.2.-"
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85601.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG023999"
FT                   /db_xref="HOGENOM:HBG056201"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013956"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000051FDB7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDD7"
FT                   /transl_table=1
FT                   /translation="MQKSRLDARSSSELWGEVGSVTWEALGDAKPPRPKILLAFQVLLI
FT                   TTTCTATSSNVTQILLPTRAGTAAPLMPATEASPVVCSESAIVKMEDRKRPATHDHNDS
FT                   APPLKKQATSVNGGSKPHPDADMPWKDDLERFQKDAIWRQMQEYKREKMSLETKLKEMS
FT                   KATAYHNDHLRVIDAWFNQLIDEVKTLMGALDEDKDRPSFRSSLLFENMEDFEKHLKAR
FT                   SDDIRAIITRLQSFSINAPPEVTDLQSQLAKKLAEEKGTIAELEKALAEKQQLEESLEA
FT                   ASLRYMVAEKKLDRARSLTVAKLEKQYLLGAQRPGGDSASGNREEQSPVNGLPSSAERN
FT                   TELEEAHKQLVAVSEKQKEQLQKLESENANLLSQITELNIKRTKPTDDDYAHTDLFKQL
FT                   RSQYDDVVKRINHLEATNIQLREEAAKLRSERTAYRNQVDEETQNVIAEKEAQLMRAET
FT                   DLARIRNARDELLADQQMRKAAQEQEKIATTKVQELADAAQARINALESEVDRLRLQLD
FT                   NTKAAHTEIDDVPLEELRAKYQNLERQYSMLNTELTSMQTACKKYSLLASQKVADFSAL
FT                   EEKVARLTAEKSKADQKYFAAMKSKEARELEVRTLRIQNSKSSDIVSQLKESEATTRSL
FT                   LANMEKQASETKEALNSIISKHHAAQQQIAENNIVIDGLKAQVNELKALSVSKDSSLAS
FT                   ASSACRKAETEIESLKVTLADTKKSLENWKNKSLGNSSSEYEMLRVSLSAYA"
FT   CDS_pept        join(1007321..1007348,1007405..1009137)
FT                   /codon_start=1
FT                   /gene_family="HOG000201097" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265324"
FT                   /orf_name="AFUA_6G04400"
FT                   /product="Transcription factor TFIIIB component, putative "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="EAL85600.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG056200"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017174"
FT                   /db_xref="UniParc:UPI000051E831"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDD8"
FT                   /transl_table=1
FT                   /translation="MKSFSSSVINKSGKKFAPKAPVRRAPPAPSATPAPPRRPSTSSQP
FT                   STTQNAQPALDKSPAEPAPPATVPEPSVPSAGDVQLPVAESSGSPKPDSAPSQSATTIP
FT                   IPVSKRKASFSAPTRRVTVEEARAPSQPRAHHETNTERLPANLEANGPERHGGIVQSIE
FT                   DPQNLVSRNDTSTPAAGSQHLPPVESATEIRPSKRVKLTQESSKTSTRPTPSPSHVITP
FT                   PPIQPPTVDETMEVTDGAESQPNADQTRRASKSRGRRASRTSNVEDAAGKVKRKQQRSR
FT                   KKREPTPEGADLIEIAPAVVKMSELCKDLRTGRMSKRETELRNMELAEQERKRAQQEED
FT                   SQAPVPLKTNGDATSPAAEPNIGLEKKPQAGPVMRIVNGEIVLDAASLHVDRYADAARN
FT                   AGDLEDVVESSLTRKINQATWGKRSKTESWDEEMTELFYRGLRMFGTDFMMISKLFPGR
FT                   SRRQIKLKFNNEERRAPERIKETLLGPRETIDITTYSEMTNTVYDDPKVVQQELDEEKK
FT                   RIEEQHAKEKQAQEDLLRNPDGTTGGDAAPGLDNASNVPVKGKRNNKRQAMRAMGGGTE
FT                   EVIGTIDDLP"
FT   CDS_pept        complement(1009432..1010409)
FT                   /codon_start=1
FT                   /gene_family="HOG000201086" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056654"
FT                   /orf_name="AFUA_6G04410"
FT                   /product="DUF1183 domain protein"
FT                   /protein_id="EAL85599.1"
FT                   /db_xref="HOGENOM:HBG056199"
FT                   /db_xref="HOGENOM:HBG328308"
FT                   /db_xref="InterPro:IPR009567"
FT                   /db_xref="UniParc:UPI000051F8C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDD9"
FT                   /transl_table=1
FT                   /translation="MYYPGINSLLLWLLCFAPPGLAYGRSSESPPGPNAILLSRVQSLT
FT                   LRANRLTSSRRVSPIPQLKCVGPSKTICDKYKIETMRCTNAGYDYDEEDVQWTCTAQLP
FT                   EEFMLGATDVICEGYRNADDKWVLKGSCGVEYRLLLTERGESRFGRIQEDDMRSIPLAT
FT                   KGWRRGMDALVDLIFLGFWAAVLVMIFWPMVRSCFGLRGRRGRTNVGRGWGGFWGGGGG
FT                   GGGDGGGNDYGPYPGPPPPYSSFPDNSSCSSQPGWRPGFWTGAAAGGMAGYEMGRRSNR
FT                   HDRPSSSRWFDDREPWRESNTQPRSPPRFSATTESTGFGSTRRR"
FT   CDS_pept        join(1010554..1010686,1011001..1012427)
FT                   /codon_start=1
FT                   /gene_family="HOG000201075" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265325"
FT                   /gene_name="mmm1"
FT                   /orf_name="AFUA_6G04420"
FT                   /product="Maintenance of mitochondrial morphology protein 1"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85598.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG056198"
FT                   /db_xref="HOGENOM:HBG397194"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="UniParc:UPI000051F8C0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDE0"
FT                   /transl_table=1
FT                   /translation="MTAKAQRVLTERRELVGHFGVQSRYGCDKQLLHLRLVLAEADRVR
FT                   FLLGQLSVVLLIAAFIKFFIFGEAPPPPSRGLSHRSATHRRSNSIFSSAQHDGSTRTLR
FT                   EKPSNSNVLRPVPSSATNTRSILRKTYYTAIPTNPSSKHGRHRIHHSSHQPESLDWFNV
FT                   LIAQTIAQYRQTAYLLKDSPTSSILNSLTAALNNPEKKPSFIDKITVTDISLGEEFPIF
FT                   SNCRIIAVDDPNSDGGRLQALMDVDLSDDNLSIAVETQLLLNYPKPCSAILPVALSISV
FT                   VRFSGTLCISLVPASTPPLDTPSHSPSPPTAQTTTAGRSKREDQTSGSHSHAGGSSKEP
FT                   SGENPPKTSPKSNVAFSFLPDYRLDLSVRSLIGSRSRLQDVPKVAQLVEARVHAWFEER
FT                   VVEPRVQVVGLPDLWPRMGRTGVRTGDDSETGSNVPRSSTAADASGSARHEDSSREPEV
FT                   LRFGSLLGTRPPFDLASRTSSFNVETGDLRSRSMTREESNGNLSDQFHMPGSLPGSGVA
FT                   TT"
FT   CDS_pept        join(complement(1013507..1013586),
FT                   complement(1013306..1013411),complement(1012867..1013238),
FT                   complement(1012672..1012800))
FT                   /codon_start=1
FT                   /gene_family="HOG000201071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903377"
FT                   /orf_name="AFUA_6G04430"
FT                   /product="ARD/ARD family protein, putative "
FT                   /function="dioxygenase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="L-methionine salvage from
FT                   methylthioadenosine"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85597.1"
FT                   /db_xref="GO:0019509"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051213"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG020936"
FT                   /db_xref="HOGENOM:HBG660685"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051FDB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE1"
FT                   /transl_table=1
FT                   /translation="MSEGGGRADALRNANKQILPLICAITSLLTCCLLSERKTYSVGGP
FT                   AEKKHPTMKAYWYDNKPGDQREPHDSGRPVTVDYLASIGVQYYHFPSLESVNELAKERG
FT                   YKNRDEIVVSPQAMGDVYEEKVKMFFNEHLHEDEEIRYIRDGEGYFDVRGQEDEWVRIK
FT                   LAKDDLIILPAGIYHRFTTDDKNYVKAMRLFQEEPKWTPLNRGPDVDENSHRQSYLRTI
FT                   QNKTVA"
FT   CDS_pept        join(1013702..1013808,1013872..1015846)
FT                   /codon_start=1
FT                   /gene_family="HOG000201059" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265326"
FT                   /orf_name="AFUA_6G04440"
FT                   /product="Mitochondrial translation optimization protein
FT                   (Mto1), putative"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="tRNA wobble uridine modification "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85596.1"
FT                   /db_xref="GO:0002098"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG001394"
FT                   /db_xref="HOGENOM:HBG284774"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="UniParc:UPI000051FB4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE2"
FT                   /transl_table=1
FT                   /translation="MAFRARSVALWRWGSAPWSRIMGLTRGMATVSDGTRAYDVVVIGG
FT                   GHAGSEASAAAARSGARTALVTPSLSNIGVCSCNPSFGGIGKGTMIREIDAMDGVAGRI
FT                   IDKAGIMFRILNRSKGPAVWGPRAQIDRDLYKRYMQEELLATEGLSIVEGKVADIVVSK
FT                   EGVENIPGSQGKIVGVRLESGEVIPTGRVVITTGTFLGGEIHIGLEAYPSGRMGEAATF
FT                   GLSKSLREAGFQLGRLKTGTPPRLDMKTIDFAPLEVQRGDSPPQPFSYLNTTVDVGDEG
FT                   QLTCWMTHTNEASHEIVRANLDKSIHIRETVRGPRYCPSLESKIIRFTDKKQHQIWLEP
FT                   EGFAPNEVIYPNGISMTIPADAQYALLRTVRGLENVRMLQPGYGVEYDYIDPRNLRPTL
FT                   ETKLISGLYLAGQINGTTGYEEAAGQGIIAGTNAGLSAQGRQPLTLTRSDGFIGIMIDD
FT                   LITKGVSEPYRMFTARSEYRISTRSDNADLRLTRMARDAGVVSDKRWRSFTDTEAQIKE
FT                   LQNLLAKTKLSSTMWSRKGFKTRTDSSVRSALDLLCLDGVDIDALIPHIESPSGMAYTP
FT                   SSFDPIIRTRVSIEGRYAPYVKRQEAMARKFLQDESLILPPDLDYSKVQGISTEERQAL
FT                   ERVRPVSVGMARRIEGVTPAGALRLLMHVRRAMDASKESSLDADALEGSAESVLRGSV"
FT   CDS_pept        1016716..1018197
FT                   /codon_start=1
FT                   /gene_family="HOG000171155" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751317"
FT                   /orf_name="AFUA_6G04450"
FT                   /product="Alpha-1,2-mannosyltransferase (Mnn2), putative "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="EAL85595.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG055775"
FT                   /db_xref="HOGENOM:HBG327705"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI000051F672"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE3"
FT                   /transl_table=1
FT                   /translation="MSVPRIYSRLRTLLLALFLVSVFTWSFSRWRSVSVEPGHKNPSYV
FT                   DSAGVRVLHSADGHIHFWQQFQPLLAKYQPKCDPPMRLGNAPSVRFEEAKPEDRREYLD
FT                   MLPDEVEAMKNAHTGFVRDIKSNPPQLHYVPNTRGLVSTAGGSYLPVLVISLRMLRKTG
FT                   SELPVEVFLANEEEYEEYICDVVLPSLNSRCVVLSHILDAVPKTMQIEKYQFKLFAMMF
FT                   SSFEEILFLDADAFPLEKPDILFTNEPFRSKNMVTWPDFWADTISSYYYDIASKPMPSK
FT                   TIRQSTESGELLLSKKTHSKTLLLSAYYNFWGPDYYWALLSQGAAGEGDKETFVAAALT
FT                   MDEPYYQVSEPIVALGHRTQSGLAGSTMAQFDPVEDYALTQKGEWRVHGSKAPAPRAFF
FT                   IHANFPKFNPATVFDEQAVKPTFEDDGSYTRAWTIPEEVIGKFRTDVEKQFWREILWTA
FT                   CELETKFRSWEGREGICQRVKDYWNAMFPTQSVKT"
FT   CDS_pept        join(complement(1019658..1019985),
FT                   complement(1019292..1019556),complement(1018821..1018944))
FT                   /codon_start=1
FT                   /gene_family="HOG000010898" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751318"
FT                   /orf_name="AFUA_6G04460"
FT                   /product="Phosphatidyl synthase"
FT                   /EC_number="2.7.8.5"
FT                   /function="CDP-diacylglycerol-glycerol-3-phosphate 3-
FT                   phosphatidyltransferase activity"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85594.1"
FT                   /db_xref="GO:0008444"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG428298"
FT                   /db_xref="HOGENOM:HBG686655"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniParc:UPI000051F40E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE4"
FT                   /transl_table=1
FT                   /translation="MCSPQSGPKKSPILSKIPIPTHENIYTVPNILTFSRLVAAPLVGY
FT                   FLVHDHHAAALSLFVYAGLTDLVDGYIARRYNLQTVVGTIIDPMADKLLMTIGVACLAV
FT                   NGSIPVWLAVIILGRDVGLALSAIYYRWISLPPPKTMARYWDFSLPSAEVKPTGISKVN
FT                   TALQLVLVGSAIALPVIPEAVLDAWNLQDGMTALQYLVASTTIWSGLSYVFSKDAVKIL
FT                   TKEEVQKRLARASRKK"
FT   rRNA            complement(1019050..1019165)
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(1021896..1022849,1022936..1023454)
FT                   /codon_start=1
FT                   /gene_family="HOG000201027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265327"
FT                   /orf_name="AFUA_6G04470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85593.1"
FT                   /db_xref="HOGENOM:HBG056197"
FT                   /db_xref="UniParc:UPI0000520463"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE5"
FT                   /transl_table=1
FT                   /translation="MPILNGPAQEAPVPRDSAVPGNKQKKLETRSIEPQMPADPNLANP
FT                   RLLLNGACIYERQLPGDAYITAHVQRLQHGFHSSPAVSDKDYDHVDFLGINFVFHSPNT
FT                   LAHRFKAATIRASVQGTRHVASSDHYPNGYPPGNPRFLMHAPHLIFGAISPETLQWNYS
FT                   LTGSLGVVDLPVMASLSPTGGINGRYRRYEMMRIQGSVRTLKSPRGRKFDIDAGEIVWS
FT                   LEENNLQRSGLPREFTFAMLIQKPRADSRIVFSLDIEPTLQSWYGSYPDWWLSLPKYQP
FT                   QSRRPVDFRSEVGQRFEPAESKKGFNFATLESSFDDYIPSDGGVLQDDNDTLQDTNHDR
FT                   TIVEPIRGVARLAYPNTLAGAAATATSAPAPGEPALIARRGTLGSDRSALTIHLLMDNQ
FT                   MPSPLSSLRGSRPSPKLTSHSNIHGNSATKQDKADRRESPRALPAATIPAPPQRQTTLR
FT                   RTRSREGLNRNLNLDHHHHPKPRPQVSDRRFN"
FT   mobile_element  1024159..1025706
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        complement(1026792..1028234)
FT                   /codon_start=1
FT                   /gene_family="HOG000201038" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207945"
FT                   /orf_name="AFUA_6G04490"
FT                   /product="Camp independent regulatory protein "
FT                   /protein_id="EAL85591.1"
FT                   /db_xref="HOGENOM:HBG056195"
FT                   /db_xref="HOGENOM:HBG327822"
FT                   /db_xref="InterPro:IPR018608"
FT                   /db_xref="UniParc:UPI000051E5BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE7"
FT                   /transl_table=1
FT                   /translation="MVNGTAAVLEPTFTGYVATTQDALILFEACLTGILHHVPRRPHDR
FT                   ERSHLVRSGSVFIYEENSSGIKRWTDGVTWSPSRILGNFLVYRELEKPFPPGEKKRAMK
FT                   KANRRPVPSARPGEPYPRHDSNGGSYSPSSTSGSFGDRSHQSDVERALVGSLVDSYGFK
FT                   DSGLVKKTMSVTVSGVTHHLVSYYSVEDVMRGVLNPPSMVESLRYIRPRAELTQKQSFR
FT                   APIDDLETGGLENPNDPSHAIYGYRPQLMAPPGYAMPNPHPEFYLHTAPYTASHAPQSA
FT                   PIPGYSIGSSMPAQPAPNPYLPAPSAPAHVQQKTEDYPQYRNPNPAPSAYGTSFDSISH
FT                   APLSSSMPSTLNSSIPSSLSERNRSTSDQSVSAYRNSSISSRSVATDVTSPIDPSTPAT
FT                   FSRGNSFSLSGHMDGPSQQPPEQRGIAPAFDPSIPRRESIPAHYYAGSDRPQYYMGATA
FT                   PAAHASYPVSTWTTAAPAQPQM"
FT   CDS_pept        join(1041982..1042736,1042948..1043584)
FT                   /codon_start=1
FT                   /gene_family="HOG000201141" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751319"
FT                   /orf_name="AFUA_6G04500"
FT                   /product="Snf1 kinase complex beta-subunit Gal83, putative "
FT                   /function="kinase activity"
FT                   /protein_id="EAL85590.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG056194"
FT                   /db_xref="HOGENOM:HBG328305"
FT                   /db_xref="InterPro:IPR006828"
FT                   /db_xref="UniParc:UPI000051F196"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE8"
FT                   /transl_table=1
FT                   /translation="MGNNPSKGPSGDAPPSSASSNLSAPAGDKKVNRRPSTNAISGAAK
FT                   ATAADPSASIETATGHSATARQTPVQQRLQSRNITDSSRGNSERHDRHDAKKAEPHYRD
FT                   IPSPDPSNPVQVPVSRAAARNDATVAPSGPPLNTYYSASTHLQRPPRMPLPIGDATATP
FT                   GSPIIGPEDSHIGFVSGDRSLGEQASQDNAGITNTAIDDEETLDELEPYTPSGVGRAVP
FT                   TCIEWNGPGEKVYVTGTFVNWEKKYRLHRNESNPGVMSTTLNLRPGTHHLKFIVDGEMR
FT                   ASDNLPTAVDFTNHLVNYIEVSADDVNQSRRGSDRTNKSAVPSGVHPPQVIPNLIGDDR
FT                   NGVENQSDKEEPEEIPLGDFQTIIPQFLVDLDKDEDSPEYQQAANVIGDTPTPPSLPLF
FT                   LGKSILNGTTPMKDDSSVLNYPNHTVLNHLATSSIKNGVLATSVTTRYKRKVRSPPNST
FT                   TFVRV"
FT   CDS_pept        join(complement(1045161..1045512),
FT                   complement(1044348..1045054))
FT                   /codon_start=1
FT                   /gene_family="HOG000109569" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903378"
FT                   /gene_name="kae1"
FT                   /orf_name="AFUA_6G04510"
FT                   /product="Putative glycoprotein endopeptidase kae1 "
FT                   /EC_number="3.4.24.-"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85589.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG236550"
FT                   /db_xref="HOGENOM:HBG304663"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="UniParc:UPI000051F8C4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDE9"
FT                   /transl_table=1
FT                   /translation="MIAIGLEGSANKLGVGIMLHPEDGSTPRVLANIRHTYVSPPGEGF
FT                   LPKDTARHHRSWVVKLVKRALREARISVRDVDCICFTKGPGMGAPLQSVAVAARMLSLL
FT                   WGKELVGVNHCVGHIEMGRLITGSTNPVVLYVSGGNTQVIAYSSQRYRIFGETLDIAVG
FT                   NCLDRFARTLHISNDPAPGYNIEQLAKKGKQLVDLPYTVKGMDCSFSGILAAIDGLAAS
FT                   YGLNGEEKEEEGAGDDSKPTRADLCFSLQETVFSMLVEITERAMAHVGSKEVLIVGGVG
FT                   CNERLQEMMGIMARDRGGSVHATDERFCIDNGIMIAQAGLLAYKTGFRTPLKESTCTQR
FT                   FRTDDVFVKWRD"
FT   CDS_pept        join(1046038..1046188,1046301..1046899,1046970..1047197,
FT                   1047268..1047768)
FT                   /codon_start=1
FT                   /gene_family="HOG000201152" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265328"
FT                   /orf_name="AFUA_6G04520"
FT                   /product="SET domain protein"
FT                   /protein_id="EAL85588.1"
FT                   /db_xref="HOGENOM:HBG058928"
FT                   /db_xref="HOGENOM:HBG328304"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011383"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000051F8BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF0"
FT                   /transl_table=1
FT                   /translation="MSSTTHFPDSDSFQRQSDEFITWLAGKPGVKINSKISIADLRSKS
FT                   AGRGVVARSDIFDGEELFSIPRGLVLSAQNSKLKDLLSQDLEELGPWLSLILVMMYEYL
FT                   LGEQSAWAPYFKILPKSFDTLMFWSPSELRELQGSAIVSKIGKEGAEDSIMQMIAPVVR
FT                   ANPSLFPSVDGLASWDGEAGSHALLRLAHIMGSLIMAYAFDIEKVEDEDDENNDEEDGY
FT                   VTDDEQDQSSKGMVPLADILNADADRNNARLFQEDDSLVMKAIKPIRVGEEIFNDYGEL
FT                   PRADLLRRYGYVTDNYAQYDVVELSLDQICRSAGLQNADIESYPPLAFLEDLELLDDGY
FT                   VIPRPSPEDSLTDFLPDELLVLVKTLTLSSEQLEHQKSKSKAPKPSFGHAEAAILLKAV
FT                   QLVGSQYPTTVAQDEEILSGLVQSEAFQPLNQTDRRQKMAIQVRLGEKYILQTLANMLE
FT                   KFITNSAQSNGGSGLKRGANGDSGDSRRTKAPKN"
FT   CDS_pept        join(complement(1050030..1050170),
FT                   complement(1049409..1049891),complement(1048231..1049355))
FT                   /codon_start=1
FT                   /gene_family="HOG000201163" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265329"
FT                   /gene_name="epl1"
FT                   /orf_name="AFUA_6G04530"
FT                   /product="Enhancer of polycomb-like protein 1 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="cell cycle"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85587.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG056193"
FT                   /db_xref="HOGENOM:HBG328303"
FT                   /db_xref="InterPro:IPR019542"
FT                   /db_xref="UniParc:UPI000051E830"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDF1"
FT                   /transl_table=1
FT                   /translation="MGRTRPKKLTSKASIPIVREHEIDIIDDEVQNALQQVETGVEKAE
FT                   ESEFHLQAAISATAQGKVNEAHIPTPETVLSNLRYDELYPPIFSQPATYIRFSSTIEDC
FT                   CGCPYNMTEEDDVFFKIMNEKREPSNRITEDQFEEVMYFFEETAQTKQPFAAVDSPPVL
FT                   SFAEMQDSMDATVEESVKCFAKDIYEHWKLRRIATGNRPLLPSLKFETGQDTDDTDPYV
FT                   CFRRREVRQIRKTRGRDAQSADKLRRLRKELEDARQLVALVRQRELARKEMLSMERQIF
FT                   LQRSEVKEMKRKLNIKDDDEDLINQKVTSIPARLPHAFANLPEQPKKKPAEAPAAQRPT
FT                   APQIRMPQKPGTQAADDMQLLEDVQAEKENEILRDIKQNIAKHIKWNEGYVDYTRAPLS
FT                   PPPEKTFQAAFRPAITTQLPTPPSSDSSDNMMLESALDTANSLSFRDKLVPRTWEMNED
FT                   TCRIPSFRRRIGRGGRLMIDRRNMASRCRIEMDPLKADRFKYDREDSDDESEFECDPYD
FT                   VQIMQHRAIMAAKARDQAAAAAQAHAQAQAQKRLQAEQTTTNNGPPNIGHTMGSNPGPG
FT                   AVASTS"
FT   CDS_pept        join(1050741..1050849,1050916..1050968,1051022..1051095,
FT                   1051172..1051517)
FT                   /codon_start=1
FT                   /gene_family="HOG000233019" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056655"
FT                   /orf_name="AFUA_6G04540"
FT                   /product="Calcineurin Ca2+-binding regulatory subunit CnaB "
FT                   /function="calcium ion binding"
FT                   /protein_id="EAL85586.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG483331"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000051FFE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF2"
FT                   /transl_table=1
FT                   /translation="MEQPSEPNNAAMYDARRRRASVGTSQLLDNIVSASNFDRDEVDRL
FT                   RKRFMKLDKDSSGTIDRDEFLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAF
FT                   SSKGNKEEKLRFAFKVYDIDRDGYISNGELFIVLKMMVGNNLKDVQLQQIVDKTIMEAD
FT                   KDRDGKISFEEFTEMVENTDVSLSMTLSMF"
FT   CDS_pept        join(complement(1054459..1055113),
FT                   complement(1053950..1054216),complement(1053777..1053871))
FT                   /codon_start=1
FT                   /gene_family="HOG000201174" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056656"
FT                   /orf_name="AFUA_6G04550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85585.1"
FT                   /db_xref="HOGENOM:HBG056192"
FT                   /db_xref="HOGENOM:HBG328297"
FT                   /db_xref="UniParc:UPI000051E829"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF3"
FT                   /transl_table=1
FT                   /translation="MEYGYTDTAFQDDPLHGDELQPYPTTLREQQRQQSIQQPFAAYES
FT                   EMVYNLGQQGPTQNPYEVVPQYPARQSAAIDALSSQFAVPQYFPTNEPMATGVPAEVSP
FT                   YLNPQVSPSAYNQARPIGRSSAMQPFPATMAEFTPVGATARRLEQQETSQQQQHHSQQQ
FT                   QQHVIPDSTNLNEEYGRFQRVLRSTFDHIRAGRLVEAGRSLLEISEWLVTNARELGILS
FT                   DEPMFYSDRLQLWNNFNICWLAVCQKQKDMTLELLGAGHQPSNTSMLSSDRLDEMGRKL
FT                   IQLCDQMEQHGLVDYQMGIWEEEILCVLGECIDLIESRPSNMRAHGVNAAAAATSRS"
FT   CDS_pept        join(complement(1059579..1060434),
FT                   complement(1059426..1059517))
FT                   /codon_start=1
FT                   /gene_family="HOG000019802" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207946"
FT                   /orf_name="AFUA_6G04560"
FT                   /product="37S ribosomal protein S9 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85584.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059045"
FT                   /db_xref="HOGENOM:HBG328295"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniParc:UPI000051F671"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF4"
FT                   /transl_table=1
FT                   /translation="MAWQRPNCIVQAVQTVRAAQLQSILRTSTVTSGSLLQQRKGTRSY
FT                   ATEAQTTGGNALQVRAASEIDFSQLATRPARVIPASPAYFSGSPKFIDHLLNLERVCAK
FT                   YASLPTVAPNEAPRMAWLKLAQFRDFVGEPVPTKKYKSLVKILQRLNRIEPALVPGEVR
FT                   DTLKTFLRPGNPYGNKPAPATVDEMGRARGKGKRKTSSAVVYLVEGEGEVMVNGKTLVE
FT                   AFPRLHDRESATWPLRCTSRLDKYNVWATVRGGGVTGQAEAITLALARALLVHEPALKP
FT                   ILRKAGVITVDARRVERKKPGHVKARKMPTWVKR"
FT   CDS_pept        join(1060589..1060825,1060939..1061140,1061387..1062109,
FT                   1062166..1062452)
FT                   /codon_start=1
FT                   /gene_family="HOG000201196" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265330"
FT                   /orf_name="AFUA_6G04570"
FT                   /product="Translation elongation factor eEF-1 subunit
FT                   gamma, putative"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="eukaryotic translation elongation
FT                   factor 1 complex"
FT                   /protein_id="EAL85583.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005853"
FT                   /db_xref="HOGENOM:HBG020891"
FT                   /db_xref="HOGENOM:HBG436026"
FT                   /db_xref="InterPro:IPR001662"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000052045C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF5"
FT                   /transl_table=1
FT                   /translation="MAYHVSYQTLLRSPTPSRDSHKISSIFFHQSPSGISFFFLFEHLL
FT                   LSQPPPPSSFPFSPTSPHPHLTFTMAFGKLYGLPENGRTIAALVAAKCNDLELELVKTE
FT                   ANSAAAFNQSAEYQKLSPLGKIPAFEGANGFTLSESIAIAVYVTSQNEKTTLLGKTKQD
FT                   YAAILRWLSFVNAEVLPKLGAWYRPLLGLDPYNKKNVEDAVKAANKALAVLEKHLTANT
FT                   YLVGERITLADYFGASLLTRAFATVLDKAWRSENVAVTRWYNTIINQAPFKAVVPSPVF
FT                   AEEAIKYTPPKKEEKPKAAPAPAKAAAPAAEPEAQPEKKPKHPLEALGKPEFVLDEWKR
FT                   QYSNEDTRPVALPWFWQNYKPEEYSLYAVDYKYNNELKLTFMANNLIGGFHARLEASRK
FT                   YLFGAQSVYGENYNCVIRGVFLVRGQDWKPAFEVAPDWESYDFRKLDPSNPEDKKLVED
FT                   MWAWDTSVTVDGKEYPHVDGHVFK"
FT   CDS_pept        complement(1063069..1064946)
FT                   /codon_start=1
FT                   /gene_family="HOG000201197" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056657"
FT                   /orf_name="AFUA_6G04580"
FT                   /product="NIF domain protein"
FT                   /protein_id="EAL85582.1"
FT                   /db_xref="HOGENOM:HBG056191"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00005206C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF6"
FT                   /transl_table=1
FT                   /translation="MTRLKATRDGILQAGHHPQNDHGLRDPSQNSSKTWRPYQGRWDPN
FT                   NPGWRSATAIPSRSDNAVSSGSRKNGTRRNARFFDRMSKGEPSPYTPHLSGSQQAQVPH
FT                   IQLQQPFNAPSATPQLDPNVNSFPVLPMNSNTSDTSNNTTMQLPFLPLHVPHSQSAQSQ
FT                   ILPNNLSFTPYGFPPMPDLNSPEKILPFMPSVAPFPPLNLSVFSPALAPPVFGGFPFCP
FT                   FDPMYPTTVGPTGGSSQGPTLQPLLPIPPRDRRSKTPEPPVPTKEYLTQSLLAPKLNPS
FT                   RQPLLVILDLNGTLIFRKHRRLPPSFAKRTGLDQFLDTLLKNYKVMIWSSSQPETVNAV
FT                   CEKLFPGEKRKSLVAEWGRDKLNLSRSQYRSKVQVYKTLETVWSNQEIQASYPISHQNG
FT                   RFKTKKKAAQGKSRWDQTNTVLIDDSKLKALSEPYNILEIPEFTNAPGIDESHIFPKVL
FT                   ECLDSLAQHDDVSKLLHLWNSKLATNITTNSTILDLDIGVIQSPQRQNGSSLITPSTPQ
FT                   EIAQARKERRRARKQEKKAARRAAAAIGNAPANVPTSAAVSAITAEGINDGVTAVDSTP
FT                   ATSGDDSAILTATAVPQSHTRHSPSPVSSVQSENYLLDRLEESLNVRRD"
FT   CDS_pept        join(1065583..1065750,1065805..1066707)
FT                   /codon_start=1
FT                   /gene_family="HOG000201208" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056658"
FT                   /gene_name="rrp36"
FT                   /orf_name="AFUA_6G04590"
FT                   /product="rRNA biogenesis protein rrp36 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="EAL85581.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG328277"
FT                   /db_xref="HOGENOM:HBG351277"
FT                   /db_xref="InterPro:IPR009292"
FT                   /db_xref="UniParc:UPI0000520926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDF7"
FT                   /transl_table=1
FT                   /translation="MAVSDLLNRRVRALPDEDEELYSEASVSELESNDEEVEGSGSDIS
FT                   DDSSEGDYSSDSQDESDAMSHENEEEDDEDDENSDDGQDDVQASLSNISFGALAKAQAS
FT                   LGPTAKRKSKATQSKTDDGETPAASPLDDIRARIREAREQKREGSSKSKDLEKFSRSSK
FT                   HAPMVQSSKHPVTRKRTIIEPPAALKSRDPRFDPAVRSQSGRSEASQSAYAFLDDYRAA
FT                   ELKEMKEKLAKTKDPRQKEALKRDIRSATDRLRTIENRRREKEVLAEHKKREKELIREG
FT                   KKSTPYFLKKSELKKQALLKKYESMGSRQRVKALERRQKKLTAKERKEMPMERRGLGND
FT                   PTPYNDGGGGKRRRLA"
FT   CDS_pept        join(complement(1068891..1069099),
FT                   complement(1067587..1068811))
FT                   /codon_start=1
FT                   /gene_family="HOG000201219" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265331"
FT                   /orf_name="AFUA_6G04600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85580.1"
FT                   /db_xref="HOGENOM:HBG056189"
FT                   /db_xref="HOGENOM:HBG328270"
FT                   /db_xref="UniParc:UPI000051FDA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF8"
FT                   /transl_table=1
FT                   /translation="MSTAVAPATAAPLPSPHMNRDPSPKNCPTLAPTTTNSNSSLTPPR
FT                   ASGVSQDGSAVTKGSPRGRKHSSPSSQNGSIPPKVIVKKEPPSSPAMQTQTHTRPRPRK
FT                   LDLSTSLPTAGGLSARAAGGPLTARDGVTMHDVGIACLSPGFQTHDPVMREQLQRSLSV
FT                   RDQQRSIIESRLHKSAKDDGPDGVKPSESNSLGAPKTGASKRRPPPGLSIVPPSAAQFA
FT                   NERVIQSAPLNQSFTGRYQAQPLTRHVVNQSPTLGSTSHIHHVPATQTNNRLPPLSDVF
FT                   GSDALGSRDRDPNRGTYYQAVSGANPSQSNNLPPLPSPRMPGSAVQAQARPREYRSAEE
FT                   AVHELAGGREELLPRIVHYGGHQPPTPPSPHVNNGQAKSRTSTDAAPSAANQPLHPVLQ
FT                   STEGNARRRPRSEYERDNGSPPLGHGPEPHYRPNPALASTANTTYGPFGAGRDSPETQR
FT                   RKKEEFLSLCARAWDLFHS"
FT   CDS_pept        join(1074626..1074751,1074847..1074938,1075000..1075267)
FT                   /codon_start=1
FT                   /gene_family="HOG000179862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207947"
FT                   /orf_name="AFUA_6G04610"
FT                   /product="DNA-directed RNA polymerase I and III 14 kDa
FT                   polypeptide"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="EAL85579.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG410450"
FT                   /db_xref="HOGENOM:HBG726964"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="UniParc:UPI000051F413"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF9"
FT                   /transl_table=1
FT                   /translation="MPASVHSQDQDQSMMDTAPQELEQQQDYEQEEFELEEKRIVVLPG
FT                   ATETAASFQFEGEGHTLGNALRYAIMKNPEVEFCGYTIPHPSEAKMNLRIQTYGMYFCH
FT                   TLARFDGADRNIADSTTAVEALEKGLEALMDLCDVVTDKFTSARDAFNAAQADKMTS"
FT   CDS_pept        join(complement(1075872..1076000),
FT                   complement(1075663..1075782))
FT                   /codon_start=1
FT                   /gene_family="HOG000200993" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265332"
FT                   /orf_name="AFUA_6G04620"
FT                   /product="NADH-ubiquinone oxidoreductase B14 subunit,
FT                   putative"
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85578.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG190789"
FT                   /db_xref="UniParc:UPI000051E828"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG0"
FT                   /transl_table=1
FT                   /translation="MYSLNLPVSAIRTKIRQEFEKHRYVQQLGVVDVLLFQSHAEYQET
FT                   LNYWKQLSHVMKYFRPEEDPGARLPPNFISGFLEGRN"
FT   CDS_pept        join(1076782..1077069,1077143..1077292,1077369..1077503)
FT                   /codon_start=1
FT                   /gene_family="HOG000048638" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207948"
FT                   /gene_name="loc1"
FT                   /orf_name="AFUA_6G04630"
FT                   /product="60S ribosomal subunit assembly/export protein
FT                   loc1"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="EAL85577.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG059879"
FT                   /db_xref="HOGENOM:HBG328239"
FT                   /db_xref="UniParc:UPI00005206C3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDG1"
FT                   /transl_table=1
FT                   /translation="MAPNKPSVKGKSSSKGDSGKSKPLSSASKVSKKHAKRPPPKEVKS
FT                   KARTESSLLKKTKKREYTEEELGLPKLNMITPVGVVKPKGKKKGKVFVDDQEGMMTILA
FT                   MVNAEQEGHIESKLQKARQLEEIREAKRKEAEARHAEKKNKLEEAKQSIRQKRKRKSSG
FT                   NEDSKSDASTSKSSSKSKEKRKSVSFA"
FT   CDS_pept        join(complement(1078623..1079327),
FT                   complement(1078409..1078569),complement(1078269..1078349),
FT                   complement(1078081..1078204),complement(1077900..1078028),
FT                   complement(1077663..1077848))
FT                   /codon_start=1
FT                   /gene_family="HOG000200972" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265333"
FT                   /orf_name="AFUA_6G04640"
FT                   /product="Hydrolase, alpha/beta fold family, putative "
FT                   /function="carboxylesterase activity"
FT                   /protein_id="EAL85576.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="HOGENOM:HBG058437"
FT                   /db_xref="HOGENOM:HBG328230"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="UniParc:UPI000051F663"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG2"
FT                   /transl_table=1
FT                   /translation="MLSWIRPSARLSFFHSKDNKLLLTKKPGESGVKQQVALADVCRSA
FT                   TPTKCHLNPFLFNGHLQTAWTAVKFDDVPVYYKRRMFEADNSMYKGHFAVDFVVEPYET
FT                   PRDNAEATDEARRYTLPSGLPERTSFFSEEEFQALPSDDTKPMLVLLHGLSGGSHEIYL
FT                   RHVLAPLIADGNWEACVVNSRGCSQTKITTGVLYNARATWDVRQTVKWLRKAFPNRPLF
FT                   GIGFSLGANILANYLGEEGDACQLKAAVLCASPWNLDISSANLQKTWLGLEVYSKTMGS
FT                   SMKRLFEQHVEEVSRNPRVDVEAVRNSTYLHEFDRALQCPTWGYPTEGAYYRDAASIDS
FT                   MLAIRIPFFTVQAEDDPIASVDALPFQEMTQTPYGVMLTTSWGGHLGWFELGGDRWFVK
FT                   PVTNFLNAMAKEIDLETPFIVEHPEKLPGHLANHFDLNKDADTAPKPDFDPMRRKLATK
FT                   MVQ"
FT   CDS_pept        join(1082291..1083253,1083338..1083448,1083603..1083718,
FT                   1083767..1084419,1084472..1085313)
FT                   /codon_start=1
FT                   /gene_family="HOG000200950" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265334"
FT                   /orf_name="AFUA_6G04650"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="EAL85575.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG056188"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019440"
FT                   /db_xref="UniParc:UPI000051ECAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG3"
FT                   /transl_table=1
FT                   /translation="MNYPPSHNGQYPPQYLQQPQQLLYNNADSNVSPYEYGKPVAYPQT
FT                   IISPYSSYGQAYNIEQHQHQPQSHHQQQPPQQQPQQQYVNPSDVFHQPLLPPASSSQLA
FT                   HGSTQYGAQPMVSVAGNSNRSPAVASASTSAQSTPAPSTQSAYQTAPTLNPRNNVFNQY
FT                   SQVALPAPSVPSSNSVATAPSVPSPKPALPLSSKSADSVPSLRPAPPVPSASKPAPPVQ
FT                   AKKPLPQVLVPAPSPEVQQKMQRQGSKKQVQRQNAPQAVQKPTKLPIDYQVLLLSLADE
FT                   YLKAAYGQGTMVALSRREMEIEEYYKLVATGLGCLEAVLKNWRLQPRMEALVRLRYARI
FT                   LFEETENDLEAETALSKGNRMLDLKYSMQHLLARMLHKTNPKASLKAVDGMILDVEAYR
FT                   HSAWEYAFRFLRVSLSLSTSAHQDSVSALQHLHKISNMANRQGDKAVAAISAVIEALAH
FT                   LQQGTSSDAIEQAQRAVAVARSHQLNDELRHIPQLSTLVQMVDICCSLLEYDVNQSSQK
FT                   LKVMQDLMDERLNDPNWRADGSFSIPLSGRSAGPSSIDTGDILQVQNGTLLLSFNWLPQ
FT                   HDLYALCYFLSSITLSAKNSYDGRKAEKFLQEGIRMVKGSFKAPQEIVESMVNANRRVG
FT                   WRRILYCNLLLHQVFLACGRTDWDLANQTLKELRSIAEELGDQLPDTIQRLMEYATGAL
FT                   AQATGDLEAALSIFQSPLLSLSSITSKTARNDPRRDIAILAALNTILILRDPNHPSHSN
FT                   LPSALALVESFCKASPNKYIQAAYYLVCATVQTESTIQTKQYLQQALQSATAISNSQIT
FT                   CMTLTFMSWKYFRGVVGEQAEKSARAGRAMAKKANDRLWVSVTDEMLAETLERQGKSEE
FT                   AEGVRDEGHRVMTGLPPALKRPV"
FT   CDS_pept        join(complement(1086529..1086724),
FT                   complement(1086108..1086454))
FT                   /codon_start=1
FT                   /gene_family="HOG000155290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265335"
FT                   /orf_name="AFUA_6G04660"
FT                   /product="Centromere protein Cse4, putative "
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85574.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG493811"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI000051EEFF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG4"
FT                   /transl_table=1
FT                   /translation="MPPKTGRGRKAIGAPRTQPRDDGGAGPSNAAATASPSTRGQPPKF
FT                   RGGTRGGKRPAHAPRPSDVQPGDPTPQGRRHRYKPGTVALKEIRRYQRSYDLLIQKLPF
FT                   ARLVREVALELLPAEVGAELRWQSHAIQALQEAAEAFLVHLFEDTNLCALHAKRVTIMQ
FT                   KDIQLARRIRGIWGGLG"
FT   CDS_pept        join(1087478..1087666,1087737..1088297)
FT                   /codon_start=1
FT                   /gene_family="HOG000200948" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207949"
FT                   /orf_name="AFUA_6G04670"
FT                   /product="ER-associated proteolytic system protein Der1,
FT                   putative"
FT                   /protein_id="EAL85573.1"
FT                   /db_xref="HOGENOM:HBG268954"
FT                   /db_xref="HOGENOM:HBG435574"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI000051F66C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG5"
FT                   /transl_table=1
FT                   /translation="MAAIWGNGGQGGQFPLEQWFYEMPPVTRWWTVATVATSVLVQCHI
FT                   LTPFQLFYSFRAVYFKSQYWRLLTTFLYFGPLNLDLLFHVFFLQRYSRLLEESSGRSPA
FT                   HFSWLLFYAMTSLLLISPFLSLPFLGTALSSSLVYIWSRRNPDTRLSFLGILVFTAPYL
FT                   PWVLMAFSLVVHGIVPKDEICGIVVGHIWYFFNDVYPSLHGGHRPLDPPRWWRRIFDPR
FT                   AAAGEAQRTDTDNVNRDFAAAAAPEVR"
FT   CDS_pept        join(1092800..1093078,1093140..1093295,1093364..1093999)
FT                   /codon_start=1
FT                   /gene_family="HOG000200927" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751320"
FT                   /orf_name="AFUA_6G04680"
FT                   /product="MIPC synthase subunit (SurA), putative "
FT                   /protein_id="EAL85572.1"
FT                   /db_xref="HOGENOM:HBG396429"
FT                   /db_xref="HOGENOM:HBG433971"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI000051EF14"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG6"
FT                   /transl_table=1
FT                   /translation="MRRGVLIFLIVNLLIISFLVRSVFTLLSLLVEDASADAIRHAELP
FT                   SPNSSLIEQRPQIIPKIIHQTYKNETIPEVWREAQQSCKDLHPDYEYILWTNEKSREFI
FT                   KNEYPWFLDTFDGYKYPIQRADTIRYFVLAHFGGTYIDLDDGCNRRLDPLLSYPAWVRR
FT                   TVPTGISNDAMGSVPQHPFFLRVIELLKSYDRSWLLPYITVMYSTGPLFLSVIWKEYMQ
FT                   DKPSEAARVRILMQDEYNKYSWSFFTHHVGNSWHGKDARLIFWMGQHWMFLTVLGFILA
FT                   SVVGFCLWWVYGRMILLSSKYRYRYSKLPGLGRLSSPTRRSRGVMPTLLRRVSFKEDEE
FT                   SAHVTETSFELYSRRD"
FT   CDS_pept        join(1095299..1095641,1095724..1096031)
FT                   /codon_start=1
FT                   /gene_family="HOG000200916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265336"
FT                   /orf_name="AFUA_6G04690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85571.1"
FT                   /db_xref="HOGENOM:HBG056186"
FT                   /db_xref="HOGENOM:HBG328194"
FT                   /db_xref="UniParc:UPI000051F8D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG7"
FT                   /transl_table=1
FT                   /translation="MKPAHLSNSLVFLILPALGYAAPASATTQHQARDVKITATQIETI
FT                   APKSKSCADAPAPGECATSEQAAANIAKSFETYKVTSAAEQAAVIGLMAFESLDFEYNR
FT                   NHFPGVAGQGTRNMQSPAFNAKYAASLPALADKLKDVSGDPAGVLDLLLSNEEYDFGSG
FT                   AWFLTTQCSQDVRSELQSGSQGGWEKYITSCVGTDANEERKAYWMRAVQALGA"
FT   CDS_pept        join(complement(1096662..1096980),
FT                   complement(1096191..1096606))
FT                   /codon_start=1
FT                   /gene_family="HOG000228064" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751321"
FT                   /orf_name="AFUA_6G04700"
FT                   /product="Imidazoleglycerol-phosphate dehydratase "
FT                   /EC_number="4.2.1.19"
FT                   /function="imidazoleglycerol-phosphate dehydratase activity"
FT                   /biological_process="histidine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85570.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004424"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG000008"
FT                   /db_xref="HOGENOM:HBG289010"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000051ECA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG8"
FT                   /transl_table=1
FT                   /translation="MPLPARTATVSRVTNETKIQVSLSLDGGVLPPYEPSDHFPAPEDL
FT                   KEAEAAKHGIVPPKNAAHATQFTPTQQITVSTGIGFLDHMLHALAKHSGWSLAIRAKGD
FT                   LYIDDHHTTEDTFLALGTAFTKALGARQSLARFGRGDAPLDEALSWAVIDLSSRPWAVI
FT                   NLGFKREKIGDLSTEMITHGLHSFAQAADVTLHVGCTYGDNDHHRAESAFKALAVAIRT
FT                   ACTRRVAGEVGAGDVVSTKGVL"
FT   CDS_pept        join(1097361..1097450,1097644..1098030)
FT                   /codon_start=1
FT                   /gene_family="HOG000200905" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265337"
FT                   /orf_name="AFUA_6G04705"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27235.1"
FT                   /db_xref="UniParc:UPI0000F51CD8"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA17"
FT                   /transl_table=1
FT                   /translation="MPTSSQKGDINPPEEVTSEAVRGFLTGAFRFGSVSILAHMILMLP
FT                   HPFKFSPPAATPSHPPASPSSSRPKTLRFSKDHLRSKFIYGPLSGFSEWLSPTARVYRG
FT                   LTPQFKVFLQIAAMTLGGCIWAERRVNEYIDFMRKVKRAERLQAQRVARFSESE"
FT   CDS_pept        1100796..1104788
FT                   /codon_start=1
FT                   /gene_family="HOG000200894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265338"
FT                   /orf_name="AFUA_6G04710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85569.1"
FT                   /db_xref="HOGENOM:HBG056185"
FT                   /db_xref="HOGENOM:HBG328172"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="UniParc:UPI000051E5BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG9"
FT                   /transl_table=1
FT                   /translation="MADSLGKKERRKSLSVFSPSSTTSILSGSAISHDRSPSDDVNTLK
FT                   KKNRRNSGFFGVRNTSPARTPGNNAQHWPDTIESESTAACIASTPTIIVPETTTRSRRK
FT                   SLQKRRTSVFGSLRSLHSLDDDEKSLGRVKGSPVDDEDAFASRNGIGSAILHHGAIQTT
FT                   GGMWRKKSQYLVLTDTHLVRFKSQSKAAEMFSSIPASYTRSPAMNRQSVASINSLQEPQ
FT                   LAVPNDASAGIPLNSIIAVYMLDDGRPSSMVEVAYLDERLHKAAFVQMQTSDLQELNLW
FT                   MIGIRSAAEMTRNADPLPFDQKSVEYVSRMLEYERDYDPETFRMFRVIQMACSSKATTR
FT                   ASSDDLTKLSPTGCYLALGSHKLHLIPLHKISSRSSVVSMSDLETATSFGLMNLTGLSM
FT                   EWGDDSLHLTFRLPLGKPYSVFLASVHSLEVAFWIRQQTEFLRPLWLRQPYDFIVPRDL
FT                   NHSSNYPPVSLDEDYGCFDRTLVAYSASYDIDTSNIRYTIDMQCDNAPCFRLLPPASPH
FT                   RQKYTALELIAVLRALRYNESFCSISFSRVSLDALQGVRDFHGVDTDALLTRSGTPIHI
FT                   PGQENLSVLSQEIRALALKSTCLNRLDFSYTLSRTPRSDSESHDPGCGIPEALFPVCRR
FT                   QLTSVDCVALNGIRLGDSDLDYLVDAASQKGSHLRALEVGHCGMTVHDVDLLLSTLVTQ
FT                   ASTLEAVDLSGIQGRLGPGLLQQYLGHFGKLRKLDLSRVSRTSGPEALISPETLFRWRL
FT                   QELSLSGTAVNRETVDAIATYLASDQSRDLRILRLDQCGLTGQDVAIFLHSIAVVGAPR
FT                   DLHLYVSENRLDLGCSYLFDAIAQNKTPSHLSMRMIDFKREEQFQDLVEALRINRTLKY
FT                   LDISKASLPYDAGPETCRSLQLMFEENSTLESLDISGESAHLDVARFGIGLNLALTGLK
FT                   KNKSLKVLKIEHQKLGFQGASTLASVLEENTCLREVYCENNDINLQSFTVLVNGLQRNR
FT                   TILNLSSMDQDRVQSLDKFRREIENVKRDLSHAQSSTTSSIRRSIHAAIHVKNATVGNK
FT                   LSKHSSAANPTRSMTSPSLSSASTTAVAASHVMDHDVEIILQSLNEKWDSEVARLRRYL
FT                   FRNYSVANGIDDGYDDAASDGRPTTAASLGTMLENLKLNGPEFSEEEPTLSQTSLQATP
FT                   QSDEKADSPTPSTASTESKSSHLDIFKSLDADSGFRAELGDRPQTAGDVLTHGSAGLPR
FT                   EYSTSNAPSARLAVPVPAMPSITVKPNSVRSARSSSSMSTSAGTTMSSRSTYGTASSTL
FT                   RGFLSKGVSKDRRGLDKLKPGPLCVSSDAPPQLDWTPPQLELRGFR"
FT   CDS_pept        join(complement(1108539..1108703),
FT                   complement(1108114..1108404),complement(1107888..1108056),
FT                   complement(1107766..1107844),complement(1106036..1107707))
FT                   /codon_start=1
FT                   /gene_family="HOG000200883" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265339"
FT                   /orf_name="AFUA_6G04720"
FT                   /product="Mitochondrial mRNA processing protein PET127,
FT                   putative"
FT                   /protein_id="EAL85568.1"
FT                   /db_xref="HOGENOM:HBG056184"
FT                   /db_xref="HOGENOM:HBG328165"
FT                   /db_xref="InterPro:IPR013943"
FT                   /db_xref="UniParc:UPI000051FDA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH0"
FT                   /transl_table=1
FT                   /translation="MFRTSVRSLKDPLREHVCFSCLAEGLGGRPRMRQRQFYNSSVSRA
FT                   KSGNGQASNEDVADSIVRRVPGISPSSSPSPSPSPSASVSLQEQILKTLRDDDADKRSE
FT                   ARRKRRGSTPGTGQPIRKETVTAKIKRTELSALEKVKPGKPGAPFQGEDTTARLQSSLQ
FT                   SVVTLLDSRGADLGGRETIQTLTTNARSIVGRHSGELHSEELSFTPHWCKALDIKTAPV
FT                   PRLSFGLDRVLFNPGVYHLRDPRSRVFNFDPYLGSIMPVTEFDFDALKEYITSSRDEIL
FT                   RGIAEKEKKKYVGSSSSMTSVLSHFHYLLSSWRPIDARNISQGFPDKLRTFTRLLRAPA
FT                   AMFLRYQDGVYAIDADKEFDSANILMNLGKSLEKLLTLPKEDFERYRRTSTNKISPEEE
FT                   QAIPEAYHYSTMGDFVMRSQLDAYDPRLPGTGMFDLKTRAVVSIRMDVRNFEHGLGYEI
FT                   RHRFGGYESYEREFFDMIRAAFLKYSLQVRIGRMDGIFVAFHNVERIFGFQYVSLSEMD
FT                   QTLHGQSDTSLGDTEFQLSLALWNKILDKATAKFPKRSLRFHFETRDAQTPFMYIFAEP
FT                   VTDDEIHAIQTKNQEKIEAYQRRILNLPTKERIKPKPTAAPSELKAGSQPATLAKDHTA
FT                   ESSDKKKGSSQKISTTSDVDQETPATSEGSPASGSPDAPAEDAQEAPRELLAMTLIVKN
FT                   KMNGYYVERPTNFTASDKWTVQWELTEVKQPQAQSLYTACQNRRAKALEIRGEGETGVA
FT                   ANVYIRKLREIAKQGREFRQKEDELDKKQGIVVLDGAV"
FT   CDS_pept        join(1109697..1109976,1110052..1110579,1110645..1112290)
FT                   /codon_start=1
FT                   /gene_family="HOG000030315" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207950"
FT                   /orf_name="AFUA_6G04730"
FT                   /product="Bifunctional purine biosynthetic protein Ade1,
FT                   putative"
FT                   /EC_number="6.3.4.13"
FT                   /function="ATP binding"
FT                   /function="phosphoribosylamine-glycine ligase activity "
FT                   /function="phosphoribosylformylglycinamidine cyclo-ligase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /biological_process="purine base biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85567.1"
FT                   /db_xref="GO:0004637"
FT                   /db_xref="GO:0004641"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="GO:0009113"
FT                   /db_xref="HOGENOM:HBG019024"
FT                   /db_xref="HOGENOM:HBG328156"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniParc:UPI000051EF0D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH1"
FT                   /transl_table=1
FT                   /translation="MAQEQLRVLVVGNGGREHAYAWKLSQSPLVDVVYVAPGNGGTAQG
FT                   ASSKITNANVKGDDYPALVEFAQKNGVNLVVPGPEAPLVDGIQGYFQAVGIRCFGPSKA
FT                   AARMEGSKTFSKDFMKRHNIPTAAYQNFYEYEPARQYLDSVNHNVVIKADGLAAGKGVI
FT                   IPQTKEEAHKALREMMLDHHFGDAGNEVVIEEYLEGDELSILTFSDGYTIRSLPPAQDH
FT                   KRIFDGDQGPNTGGMGCYAPTPISSKEVLEEIDRTIVQPTIDGMRKDGFPFVGILFTGL
FT                   MMTKDGPKVLEYNVRGGDPETQTLLPLLSADTDLAQIMVACTEHWLDGVDIKIEPKFST
FT                   TVIAVAGGYPGSYAKGKAITLDPAPEDTLIFHAGTKLFGNELQTNGGRVIASTATASTL
FT                   EEALRKSYAGISAIHFEDMFYRKDIAHRAFRQRDAAASQQQQSLTYASAGVSIDAGNDL
FT                   VNKIKSCVARTKRPGTDAVIGGFGGLFSLAAANSAYHPESPTLIGAIDGVGTKLKIAHT
FT                   VGVHNTVGIDLVAMNVNDLVVQGAEPLFFLDCYSCGKLDVETAAAFVAGVADGCVQAGC
FT                   ALIGGETAEMPGLFVDETYDAVGAAVGAINTTGKNAKSILPATSAMQAGDVLLALASSG
FT                   PHSNGYSLVRKIVERSGLSYDDPAPFTMPSSSSESLTLGRALLTPTRIYVKPILKALSI
FT                   PPSNSSSGSSAIKGLAHITGGGLVENVPRMLPSTLSAHIDVSAWQLPPVFSWLKKTGNV
FT                   TAPEMARAFNCGVGMVIVVEKGSEAAVKELFEKEGEVVYQVGELKPRQDGEEGCVLGGL
FT                   QTWDA"
FT   CDS_pept        join(complement(1114256..1114434),
FT                   complement(1113409..1114180),complement(1113100..1113330))
FT                   /codon_start=1
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265340"
FT                   /orf_name="AFUA_6G04740"
FT                   /product="Actin Act1"
FT                   /function="ATP binding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="EAL85566.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="HOGENOM:HBG345785"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniParc:UPI000051E5B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH2"
FT                   /transl_table=1
FT                   /translation="MSLCRLSPGECVNRCPCVRLDNPIPGGFLSLNHHARQLNLDNETL
FT                   TCEIASIVGRPRHHGIMIGMGQKDSYVGDEAQSKRGILTLRYPIEHGVVTNWDDMEKIW
FT                   HHTFYNELRVAPEEHPVLLTEAPINPKSNREKMTQIVFETFNAPAFYVSIQAVLSLYAS
FT                   GRTTGIVLDSGDGVTHVVPIYEGFALPHAISRVDMAGRDLTDYLMKILAERGYTFSTTA
FT                   EREIVRDIKEKLCYVALDFEQEIQTASQSSSLEKSYELPDGQVITIGNERFRAPEALFQ
FT                   PSVLGLESGGIHVTTFNSIMKCDVDVRKDLYGNIVMSGGTTMYPGISDRMQKEITALAP
FT                   SSMKVKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF"
FT   CDS_pept        join(1117233..1117634,1117705..1117953)
FT                   /codon_start=1
FT                   /gene_family="HOG000200872" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751322"
FT                   /gene_name="fes1"
FT                   /orf_name="AFUA_6G04750"
FT                   /product="Hsp70 nucleotide exchange factor fes1 "
FT                   /function="binding"
FT                   /biological_process="regulation of translation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85565.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="HOGENOM:HBG056183"
FT                   /db_xref="HOGENOM:HBG328142"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013918"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000520930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDH3"
FT                   /transl_table=1
FT                   /translation="MDPNMNNLLKWSIENSTSARQAGNSNGTGPAPASRSNLNPEMLSA
FT                   LFGGPSDADLMKAAMEALHSDEVDLENKMIAFDNFEQLIESIDNANNLEPLGLWTPLVE
FT                   LLKHEEAEMRRMAAWCIGTAVQNNEKAQDKLIVFNVLPTLVAMSTSDPAPAARKKAVYA
FT                   ISSGVRNYQPAMDEFVKHLPEGYTSGEKIDAADMEAIDALLDKLRAHPSEVSA"
FT   CDS_pept        join(complement(1119387..1119485),
FT                   complement(1119061..1119321),complement(1118781..1118978))
FT                   /codon_start=1
FT                   /gene_family="HOG000200861" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265341"
FT                   /orf_name="AFUA_6G04760"
FT                   /product="UPF0220 domain protein"
FT                   /protein_id="EAL85564.1"
FT                   /db_xref="HOGENOM:HBG056182"
FT                   /db_xref="HOGENOM:HBG328134"
FT                   /db_xref="InterPro:IPR007919"
FT                   /db_xref="UniParc:UPI000051EF13"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH4"
FT                   /transl_table=1
FT                   /translation="MEVSNNRLFRWSKPEWLNNSTIRNAGVYTSGALFSLGFFFLVDAA
FT                   AFSHSSRNGSKVHIKFVDWIPGICSALGMLVINSIEKSRLQADSFSYSGSGVAWKARFV
FT                   LFLGFALLAGGLAGSVTVMVLKYLIKQYPLPTLYFGIANVIANGLVMLRFVDVSPAAIH
FT                   LSRLLTGLLQYYCSMDLAEHRG"
FT   CDS_pept        complement(1119889..1120560)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056659"
FT                   /orf_name="AFUA_6G04770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85563.1"
FT                   /db_xref="HOGENOM:HBG056181"
FT                   /db_xref="UniParc:UPI000051EA60"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH5"
FT                   /transl_table=1
FT                   /translation="MASSLSHPSQHLQTFKIKRESEEPSLPLLEKMASQRSRSLSTGAN
FT                   MHPLRPSDLRNEQSRPGSRRSHFASRKNTPMPVESMSRREHSMALPSSDDKLEPSATPQ
FT                   DAQTIISENKNTITRTILTCMRLYGFNRSSRPTSTAKSGNGVDSDVNLSTEIGATSGTD
FT                   EDEFKAMYHATYRASTFALRKYLKQCPSTDGAVKDLPPLLDKEKAMTYIDEFLRLFCGE
FT                   V"
FT   CDS_pept        join(complement(1122422..1122460),
FT                   complement(1122139..1122352),complement(1121884..1122017))
FT                   /codon_start=1
FT                   /gene_family="HOG000038515" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265342"
FT                   /orf_name="AFUA_6G04780"
FT                   /product="Vacuolar protein sorting 55 superfamily "
FT                   /protein_id="EAL85562.1"
FT                   /db_xref="HOGENOM:HBG327637"
FT                   /db_xref="HOGENOM:HBG379846"
FT                   /db_xref="InterPro:IPR007262"
FT                   /db_xref="UniParc:UPI000051EF12"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH6"
FT                   /transl_table=1
FT                   /translation="MMAGLKTIIALSFVLAIGFLLVILSSALWHNFLPLIVVATYVIAP
FT                   VPNWICARCANPDDFMDSSGNAVADFGRFLTGFLVLMGVALPAVLAHSGAIQIPAMIMS
FT                   ILGGLLIYGTIISFSMFFKEQEEF"
FT   CDS_pept        join(1122936..1122973,1123046..1123157,1123240..1123878)
FT                   /codon_start=1
FT                   /gene_family="HOG000091080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056660"
FT                   /orf_name="AFUA_6G04790"
FT                   /product="Proteasome component Pre5, putative "
FT                   /EC_number="3.4.25.1"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="EAL85561.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000051EF07"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH7"
FT                   /transl_table=1
FT                   /translation="MFRNNYDNDAVTFSPQGRIFQVEYAQEAVKQGSVVVGLVNKTHAV
FT                   LVGLKRNAEELSSYQKKIIEVDSHMGIAIAGLASDARVLSNYMKQQCLSSRMTYGRPLP
FT                   VDRIVTQIGDRAQTNTQQYGKRPYGVGLLVAGVDEAGPHLFEFQPSGMTQEMLACAIGA
FT                   RSQMARTYLERNLDKFADCSREELISHGLRALKETLSHDKELTVDNTSVGVVGLAGEGA
FT                   QGKIETFKLYDGQSISPLLEALEQTDSGETKEEESMEVDS"
FT   CDS_pept        join(complement(1125252..1125396),
FT                   complement(1124178..1124878))
FT                   /codon_start=1
FT                   /gene_family="HOG000156894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265343"
FT                   /orf_name="AFUA_6G04800"
FT                   /product="Lysine decarboxylase-like protein "
FT                   /protein_id="EAL85560.1"
FT                   /db_xref="HOGENOM:HBG388166"
FT                   /db_xref="HOGENOM:HBG437583"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniParc:UPI000051EF06"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH8"
FT                   /transl_table=1
FT                   /translation="MSRDYRIQKRIRSSNIQLGCSYSTQNPLKMTHKTARKHGQAIGRN
FT                   AKRVANPSSCGSVAGNDPIHMETARALAHEFHKNNVQLVYGGGTKGLMGELARTLVSLS
FT                   GPQAVHGVIPRALVRVEPGYDNKREEEKPTASSGKSAERTIKEPLDKTALLGESEYGIT
FT                   TIVPDMHTRKRLMAEKVMAGGPGSGFVSLAGGFGTIEEVMEMTTWNQLGIHHLGIVLLN
FT                   VHGYWDGLLSWVQSAVKEGYIGADNGKILVEAKDPREVLPKLLEYRVSNGRMDLDWGQE
FT                   "
FT   CDS_pept        join(complement(1126546..1126639),
FT                   complement(1126108..1126469),complement(1125525..1126043))
FT                   /codon_start=1
FT                   /gene_family="HOG000200837" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265344"
FT                   /gene_name="med6"
FT                   /orf_name="AFUA_6G04810"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 6"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="EAL85559.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG056179"
FT                   /db_xref="HOGENOM:HBG328105"
FT                   /db_xref="InterPro:IPR007018"
FT                   /db_xref="InterPro:IPR016612"
FT                   /db_xref="UniParc:UPI000051EA5F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDH9"
FT                   /transl_table=1
FT                   /translation="MAGPQDASLEEILWRSPPHVQMMGGYLHSNNILFYFAESPFFDAT
FT                   SNNASLAIQANYNEAFRHFVETREAFEGRLRTMQGLEFVVAYDPLQAAAQTDTQFAHEP
FT                   SNVWVIRKQMRRKRAGQEDEVVVLATFFVVGDCIYMAPSVASVVGNRILSAVTSLTSLL
FT                   KTASTLPIFTPAHGHTYLPPAPKPADAGQPGVPSQQSKENTPMPDAENPARVPLVGSQA
FT                   GNTASTFQDTRTLAESLHLFLRYEDEYMDENPLVGEPGSFIMSKANDVDRTATAKQPQS
FT                   TIPTKMGAPLVRVDTPGKGPEKVGTPSSSDESSLKKKKGGVGG"
FT   CDS_pept        complement(1127148..1129622)
FT                   /codon_start=1
FT                   /gene_family="HOG000025143" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056661"
FT                   /orf_name="AFUA_6G04820"
FT                   /product="Para-aminobenzoate synthase PabaA "
FT                   /EC_number="4.1.3.-"
FT                   /function="oxo-acid-lyase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="glutamine metabolic process "
FT                   /protein_id="EAL85558.1"
FT                   /db_xref="GO:0006541"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016833"
FT                   /db_xref="HOGENOM:HBG396950"
FT                   /db_xref="HOGENOM:HBG448785"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001317"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010117"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI000052045B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI0"
FT                   /transl_table=1
FT                   /translation="MAPFIGDDERASGSGQPSDSSVDAPARRNVLYIDAYDSFSYNVVA
FT                   MLEEVLDVRVSVMTIDSDWPDGNMVEYLQHFEAVVLGPGPGDPNVAKDVGIMRDVWTLS
FT                   GADMLPVFGICLGFQSLCLHQGIPIGRLPYPLHGQVHRIKTVNRDIFENVQDVEVTLYH
FT                   SLYARLDSPEQSTRGVDSGNPQADRFASKDLDLLAWFLLEDGETQIPMAVRHQKRPIWG
FT                   VQFHPESCKSDREACVKLLRRWWDMALNYNKKTGRGGYGILLNSNHCASGSITLPDAAS
FT                   TMLDWSTSTSSCSSYRTFTARNLDAEVVCENLNAPNSPTVLFQSNGRYSIISVPSPNSW
FT                   RLEYYCETQSLLLEKLQDRRGTEIGPTRQSVAESIVERSLTVSQFWDVLRFVTDTKKVD
FT                   SGSLTVPFWGGFLGYFSYEMGLACLARPKTAAGIHTTCENENAGEDPADASLLWTERSI
FT                   VVDHKTGQITVQSTRVDDDLPRGWLHQAVQFLQDLAITRSQCKVYTSDTTAEFLDSILK
FT                   RSVIKFPTQENYQRQIRACQAELEAGESYELCLTGETLITLPSPVSQSGRASFPWELYK
FT                   RLRKYNPAAFSGFARLGHVKIASSSPECFLNWDRDSTLEMKPMKGTVRKTEDMTMEKAR
FT                   EILGSTKEMAENLMIADLIRHDLYGICGSGGVHVEKLLEVEDHGRVYQMITHVKAKVDR
FT                   SRPGFAARDMPQLPSSNMSGYGLTALQRCLPPGSMTGAPKERSCMHLSSIEDRKRGIYS
FT                   GVMGFLDLGGGGSFSVLIRTAFTCSNEQDDEQLWRIGAGGAVTTLSTPEGEWDEMLTKL
FT                   RTVCGIFAPLNP"
FT   CDS_pept        join(complement(1135638..1135765),
FT                   complement(1130556..1135574),complement(1130427..1130503),
FT                   complement(1130184..1130254))
FT                   /codon_start=1
FT                   /gene_family="HOG000200826" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207951"
FT                   /orf_name="AFUA_6G04830"
FT                   /product="HATPase_c domain protein, putative "
FT                   /function="ATP binding"
FT                   /protein_id="EAL85557.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG056176"
FT                   /db_xref="HOGENOM:HBG328094"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR022155"
FT                   /db_xref="UniParc:UPI000052045A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI1"
FT                   /transl_table=1
FT                   /translation="MARNIDFNALKARTMGSGNDEEAVTVDTRGLISKVLARYSGKWTV
FT                   LREMIQNAADANATKVTIKFETLPSTTVPLPSSADQTTLLKHTISHHTLKRLLISNNGL
FT                   PFSEKDWARLKRIADGNPDETKIGAFGVGFYSVFDDCEEPFVSSGKDAMAFYWKGNALF
FT                   TRRLQLSEESNPETTFVLDYRNDTSPVPSLMQLSQFLSSSLTFVSLESIELWLDDWDLL
FT                   RLVKKTAPSVNLTIPKDIETKTPQGLMKVTGITREVVQVDAAWMRVVEWNPNASVFRLD
FT                   GLRDTTGSLRTFFSRLTGQSTQENPVKTEKPENIIDCGDLTTVLKASVFLHISTASIQC
FT                   SVSHSLSSELERATRKPPPKRTTLAILTPSYDTDVASGASTSRSDILSSILPKKTGRVF
FT                   IGFPTHQTTGLNAHISAPSVIPTVERESIDLNTRYISKWNLEMLRAAGIVCRVAWSAEM
FT                   ASIKSRILSKIDSSKSSKIRKGDIVGVLPEAIYTANQFVFRESTPSSVLGQTIEDAFWT
FT                   CNKNASIEVLSTCGIIQSHQARIAPKDLSFMDSIPVLPDELVSGAKDFVRKLTDFGLVS
FT                   EVTVSDIKRELEASTLRPGQVIEFLGWLSRKATSGQLDSFSIQSLLSVAVANDEDSSGN
FT                   PSRLLVFGDINNFLNPQRIPVDLPVPSSVIPFKYSKSLSKQELEALGWTELQTVPWIRW
FT                   LVINASNRDVLPLEQDITQSPSFSAQVLPVLSKQWDNSLSQSSKQTIISLLQSQTVIPT
FT                   KLGMKRPAETYFSSVRLFDDLPVVHGLNSVKEKFLMALGVRKTVELGVIFERLLDNPQA
FT                   SDGKSDNQRKWSHVDLIRYLASVRDDIPANDIKRLKDTSICTAEATEHSKPAGGKRYKI
FT                   SELFEPKGSLRDLGLPILEWPGKYQPSSNEGKFLTMLGLRSFPSAPEMVNVMAKAAAAD
FT                   DWDLHGKAMSYYISEYHTNGYATFDCSAVNVPFLPIEGARDLSTPNRCFTDEGATLFGF
FT                   KILRRDLHPHASKFGVKQHAAMTNCLDYMIRHPPSTKRDARVLFKYLAGRVAELSARDI
FT                   ERTGNAKIVPIAIRDTVEQGSVVRRVAPKLCYLGEGEDYRDIFDFVDFGQEANLFLMAV
FT                   GSKREPTKTELAYMLVKEPARISASFQSADKYLKLLRSLAEHLAVLRRDKELFNEMKRS
FT                   AFLLASRDITSLAQGGAKSEDLLGSDDDEVEDQSIKEWTLTAATDAVVVDDFQSFNLFK
FT                   EHILAAPQEELLENFYTALGAIPLSGLVEERANWGAVAHDQRPAAKLHKLINERSRLFL
FT                   HDQSPDSIRHDVRWLEKNLQVQVVNSISLTRSLKGRRVSHTQKRSAIITQNGRTWILWI
FT                   CPGKYDLYEISQALVHLILVRPKLHSTLTLEMLLKTDLLELKARGYNVERILKQKAQEA
FT                   KIAEDRRQKQLEEERQRLEEREAAWAKEQAQLQAQEREMEAKSQPLMPGDFPDSPTNKG
FT                   SNPNVEAEATETLQERRPRGLFANLTKRFGLEGGRSSWNPLGGQPSPPQPGGTPEPTGT
FT                   PPPPYSADDPQRPRPEEPAPVHPPHRLQNELLSAIQACRPHGSSSLYSRPETNEVTETK
FT                   SYCDEKPSHDLEFVATLPCGINVLFVKTLADRSAFLSKNSAGINLFAALLIECASVFSL
FT                   RKDSLSVFYDPGGKTIAFNRAGSIFCNYFYFQQLHEKELLQNQSADRSESMVYWWVILC
FT                   HELAHNLVGDHSSAHSYYSEGFVAQYFPKIAVKLANASQPKSGSSFSWSLRTWSGKQAG
FT                   FMDIQIDN"
FT   CDS_pept        join(1136775..1137761,1137827..1141111)
FT                   /codon_start=1
FT                   /gene_family="HOG000200815" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265345"
FT                   /orf_name="AFUA_6G04840"
FT                   /product="Hypercellular protein HypA "
FT                   /protein_id="EAL85556.1"
FT                   /db_xref="HOGENOM:HBG056170"
FT                   /db_xref="HOGENOM:HBG328086"
FT                   /db_xref="InterPro:IPR013935"
FT                   /db_xref="UniParc:UPI000051FB4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI2"
FT                   /transl_table=1
FT                   /translation="MFSPLAFPTGMIIYDLTFSVPPISHLELFPFEIFREPLVVIAIAD
FT                   GAELPEENEESEADSATRSGDRMQPGLDELLDGLRLLKEKNTRALVHQLLIFDREGVSK
FT                   LSSGPDGIIWIPRPEASKATTIKTALCDITSILLSELDEFAKTIQSVPFIESPKASSWG
FT                   PHRGPDLRTRPADKLIHRMTLPTHLPSHPNDAPETSLASNKSSPGPSEHETPTTFDEIT
FT                   RSIQLANRASTFGKPNSLPTSKEHSRDRMSVSGMSATDRTKNRIKGRTGVVIGTLFLQT
FT                   GRWPDALKELVEAATNARASSDYVWHAKALESILLCLLMFAWAGMDFQVPPVCYPVADK
FT                   SSKAIQSSALEVGQSTPGNRIISLQNLANLLPDLANNILHLYDRASNITDEPVPQLVFS
FT                   ETVIRLSRLLVAARIRDGALDDNALKHIVMNEPLLPLHRPERPRGLIILRQSEIANFLF
FT                   RALPLSPSSGLPATDTIPIIIGVVSVLNALDLPRKKAFILREFLSIIVPTLVQARKIGA
FT                   AEVGIHPAAGLASLSDTAFDINALDVGSGNMESSMRALLGLIGEIYGVQPSPFYEWEKK
FT                   RSSTASGTDPIPEYDSIAAIIERSFRHVALDRYGDLNLKIDALKACINCCEALPDFTGV
FT                   LQFTVELLQTIRGDLMLAENYYQPPFLPQDEQVRLLNNIKRTVSAAHKLGASDLEAEYW
FT                   DDFLVRDVRLLALPDSKRPVRRSKSHLEVVSGNGDKPSKDPFLYNPFSKTSSKISESLM
FT                   IAGEHAAFTVTLQNPYEFEIEIERIRLHGEGVPLDAVTEWITLPPLCLQEVTVIGTAPT
FT                   EGTVNITGCIVKVRYCRERKFPIFKDLWKPEIEMKFKRTGLAAKRPLTDRPLSWSSTTS
FT                   KDGKQQPKKGPQTTSCEIKVIGQQPDLVIESMSLSQSAVMVLEGETQSFDITLRNASSC
FT                   PLDFITFTFHDSTTRQIQSALTNKDLLPVEVYELELQLSMKPGLRWRRQGSSPDNLVID
FT                   AGQSATFSLDIVGKPGLQETTVQIDYSYIGLSNGQLPEEFYTRQLFVPLTVTVNASIEV
FT                   ARCDILPFSSDFAWRNSQESELDSVGNSSTDGDPFAPVLSQLGRGAYGHDHCILLLDLR
FT                   NAWPNPLSVTLQVSEQPIEESSAEEFTPKVGQYTLTGELQPGQISRFVLVLPCVYVDNP
FT                   HAPIPVLNTGIKRQFVVSANKLTFEAEAASREAFWFREELLKRLSGVWKESTTTSGHKG
FT                   VIELRGIRMNARMVDAFRLDAMDISFSLSPSFPKQKASSAESIDEVMQIGRSKYKVQTD
FT                   EMLDLTVTVRNRSSKPIHPLLRLQPSLRHQPSNVALDLSKRLAWTGMLQQVLPILPSGE
FT                   STSVTIGVTIFCHGEYEVGASVEEVRTLRSTVGLEKDHKPAYDAPVLHDDEAIRDSFGL
FT                   DATRRRRIWHARETCIMHATD"
FT   CDS_pept        join(complement(1142823..1142963),
FT                   complement(1141790..1142758))
FT                   /codon_start=1
FT                   /gene_family="HOG000200804" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903379"
FT                   /orf_name="AFUA_6G04850"
FT                   /product="Short chain dehydrogenase/reductase family
FT                   protein"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85555.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056167"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FDA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI3"
FT                   /transl_table=1
FT                   /translation="MDIHPSPPKPINALSPSASAAREPKLQLPSTTDPPGPQNPPKQLV
FT                   WLIFGSTGHMGRSLVKTALCRNDLVAAVGRTFENSPESMKKLEEEHENCLGLLCDVRAR
FT                   ETVKKVIDRTIERFGRIDIVANCAGYGVIGACEDQDEYEIRDQFETNFTGTLNMIQLSL
FT                   PHFRERRSGRYLIFSSTSGALGVPGLGPYCASKYAVEGLMESMLYEVDSFNIKGTLVEP
FT                   GHMRRDDVGDLVSNTATMPSNEHNLASPLPLYGHFFVKQPSEPYNTPTAPAAHARRMLM
FT                   WLGDKQPASAVKAAHLVWQLGHCSYPPLRLVLGTYAVESIRDRLKCIIEEIEDWKYLSF
FT                   PVGDQPGSSTGKDKPSTEGGDKQDRETAT"
FT   CDS_pept        join(complement(1145111..1145233),
FT                   complement(1144016..1145041),complement(1143317..1143955))
FT                   /codon_start=1
FT                   /gene_family="HOG000200803" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265346"
FT                   /orf_name="AFUA_6G04870"
FT                   /product="Vacuolar protein sorting-associated protein VpsB "
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /protein_id="EAL85554.1"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG028551"
FT                   /db_xref="HOGENOM:HBG559243"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniParc:UPI000051E81F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI4"
FT                   /transl_table=1
FT                   /translation="MDVVAAVSGYISKMVTTGDTASATGSSSSAKMKILLLDSETMPIV
FT                   STAITQSALLSHEVYLIDRLENAAREKMRHLRCLCFVRPSPTSIQFLIDELREPKYGEY
FT                   HIYLSNIIRKSSLERLAEADGHEVVRVVQEHFADFLVVNPDLCSLNLGFPNQRLWSHSP
FT                   DLWNADALQRATEGVIALLLALKKNPLIRYEKNSLLAKKLATEVRYQVTQEEQLFNFRK
FT                   TDTPPILLILDRRDDPITPLLTQWTYQAMVHELLGITNGRVDLRGVPDIRPELREIVLS
FT                   QDQDPFFKKNMYQNFGDLGQNIKEYVEQYQTKTQNTMNIESIADMKRFVEDYPEFRKLS
FT                   GNVSKHVTLVGELSRRVGEDNLLDVSELEQSLACNDNHANDLKTLQRIIQLPTVPADNK
FT                   IRLVALYALRYEKQPSNALPVLLDLLVTAGDVPSYKVNIIPKLLAYHHSLQAPPVAGGF
FT                   SDLFESASLFSGARDRFKGLKGVENVYTQHSPRLEVTLQNLIKGRLKELQYPFLEGSSH
FT                   TREKPQDIIIFMVGGATYEEAKMVAQVNASSPGVRVVLGGTTIHNSTSFLEEVDDAVSG
FT                   WPEPGPSTAAGRLRREIGR"
FT   CDS_pept        join(1145681..1145702,1145801..1145845,1145919..1147037,
FT                   1147100..1147581)
FT                   /codon_start=1
FT                   /gene_family="HOG000200782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265347"
FT                   /orf_name="AFUA_6G04860"
FT                   /product="MBOAT family protein, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85553.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG328785"
FT                   /db_xref="HOGENOM:HBG737510"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniParc:UPI0000F51CD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI5"
FT                   /transl_table=1
FT                   /translation="MLPYVDTIFGYPARLTGASVDELKLIASFLLSYPLAGLLKRIPDA
FT                   HPWKKNVFIIAVSLFYLVGLFDLWDGLRTLLYSAAGTYAIAYYIDGSLMPWIGFVFLMG
FT                   HMSISHIYRQMVDDPQVVDITGAQMVLVMKLSSFCWNIHDGRLPQDKLSDPQKYASIAQ
FT                   FPSILDYAGYVLFFPSLFGGPSFEYVDYRRWLDTTLFEVPPGTDPSKVPPTRKKRKIPR
FT                   SGTPATKKALMGLVWIFVFLQLGSLYNKESVLGESFLSYSFLRRVWILYMLGFTTRTKY
FT                   YGVWSLTEGACILSGLGYNGFDPKTGKVFWNRLDNIDPWSLETAQNSHGYLGSWNKNTN
FT                   HWLRNYVYLRVTPKGKKPGFRASLATFTTSAFWHGFYPGYYMTFILGSFVQTGAKNIRR
FT                   YIRPFFLTPDGAKPLPTKRYYDILSWLVTQLTMSFVVMPFIFLSFSSSIQVWRSVYFYG
FT                   IIGNIMSIIFFASPAKGYLVRSLKKRNKPHIPRTASMESLQQPTLGLPNDPAREFDDAV
FT                   QEIKAEFEARRRRGSVVGVPTGEELKAAVEAKLGRKIS"
FT   CDS_pept        join(complement(1148919..1150794),
FT                   complement(1148664..1148857),complement(1148570..1148608))
FT                   /codon_start=1
FT                   /gene_family="HOG000200771" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265348"
FT                   /orf_name="AFUA_6G04880"
FT                   /product="Serine-rich protein, putative "
FT                   /protein_id="EAL85552.1"
FT                   /db_xref="HOGENOM:HBG056148"
FT                   /db_xref="HOGENOM:HBG328067"
FT                   /db_xref="UniParc:UPI000051E823"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI6"
FT                   /transl_table=1
FT                   /translation="MRSTEPSTNSSPRRRALHERSASQTNETSPPPSSLRIVEDKDHED
FT                   EAHDVYSATPFPTKPEHILLPRPGKGQEYAHYPEFHAGEAHDQSTATLSSNASRAAESS
FT                   LLEQSVGDPWDISSTIDPGNTPSQVWEDDPKSSNSSLPEPILPGDKSAYNRSLGSSDAG
FT                   YSDEDLMVLPTATPSIKPVVSETPGPSRQPSGAQHASSSGSSPNVVTIGPPSSPSFVAL
FT                   DNSSLNFVRIGPSSNPDSATRSNSLTSLNSMGTVIRHIGAAPWTHGSSEEQSSRSQSFR
FT                   STPPYHPSVRSNSNSTRPRGRSHSRSLTSSSRSGPPSVIQAIVDSGVFIQYPTILAPSS
FT                   SGSWVDTSQSANASDRTVQEFTPDQSSDRFKSHLSTVTSRWSAELDSSFASGADEPSEL
FT                   SAAEPSRPSAALVRQRPGSSSLWLVSDSDRDEHLDHLSSLPARPTNPAVPSSLSSESRK
FT                   SSLRSNSIKRPGTSSSFVYNILPAWAKMYYGLDGQTVNSALSVIDGTRPPTARPATSNS
FT                   QALRHIPTASGRSRAPTNETIGSVRWMAPPDPRDPRNHWVKGSETDQLSDANNRLRHSW
FT                   SPHLYPDKRAVGQEGKPWTAPSMDSRTEPLLGRRNMQVWSFCLGFVFPLAWFIAAFLPL
FT                   PEKPDAVLDENGPELEMALKMRLHELGRRRYENARWWRNLNRWMTPLGLVIIAIVITLA
FT                   VVGSTVGF"
FT   CDS_pept        join(1153420..1153488,1153571..1153642,1153665..1154045,
FT                   1154102..1154638)
FT                   /codon_start=1
FT                   /gene_family="HOG000200760" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207952"
FT                   /orf_name="AFUA_6G04890"
FT                   /product="CaaX prenyl proteinase Rce1 "
FT                   /EC_number="3.4.22.-"
FT                   /function="hydrolase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85551.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG056140"
FT                   /db_xref="HOGENOM:HBG327516"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniParc:UPI000051F19A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI7"
FT                   /transl_table=1
FT                   /translation="MLVSNLPTLDEPVISIHTAAFFSVIAGEHKRWMLIVNFMVNFMVY
FT                   TSVLLTLLYVAPFYISPTTRPSQTLSRDAPSVIRARIRAVSWSCSLGTLAVLWLIVAKN
FT                   HASIPEAVRLVGWWPINLWDICRAWLLTAILFTGPLFERGIAEGEWKDWLKGSRISETL
FT                   HGWIGWRNYVAGPVTEEIMFRSAIVPLHLLAKDTPGHIVFVAPLYFGIAHVHHFYEFRL
FT                   THPDTSIFAALFRSVFQFGYTTIFGWYATFLYLRTGSLLAVIVAHSFCNWCGLPRLWGR
FT                   VEASVPIGPPVGKAKEDADVKDAHAAYGKLGLGWTVGYYVLLVSGAIAFYYALWPLSDS
FT                   PNALATFTGGSK"
FT   CDS_pept        join(1155114..1155494,1155548..1156231)
FT                   /codon_start=1
FT                   /gene_family="HOG000200749" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903380"
FT                   /orf_name="AFUA_6G04900"
FT                   /product="Sucrase/ferredoxin-like family protein Fmi1,
FT                   putative"
FT                   /protein_id="EAL85550.2"
FT                   /db_xref="HOGENOM:HBG056130"
FT                   /db_xref="HOGENOM:HBG325034"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000F51CE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI8"
FT                   /transl_table=1
FT                   /translation="MTPRLTNCRSLMRGCGKTTPAARFFSSRISRSNIRARLNIQPPFP
FT                   VAEKCPEPSCSCPATPAMPKGLPIDFDQPLNGTMAAYTQQVVICTGQRDWESRIEDDGK
FT                   GQSWGELVRGLKKLMGRGGRYADPFNNVLVSNSSFPSSSSTSTASAFLFPRFKYIPSIS
FT                   INVSEEQNAPTNLATFVQAFLLPAQLNPMQDSLPESKRAELTRKSELESSFPGAVDIQY
FT                   SPVVLICGHGGRDMRCGVMAPVLEKEFSRVLGARGFSPAGADGNPTDSPEHAKIGLISH
FT                   VGGHKYAGNVIVYIPPGMKAGGSPHPLAGKGIWYGRVEPKHVQGIIDETVMSGRVVLDH
FT                   FRGGIDRNGDILRV"
FT   CDS_pept        join(1156617..1157123,1157191..1157331,1157382..1159700)
FT                   /codon_start=1
FT                   /gene_family="HOG000200747" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265349"
FT                   /orf_name="AFUA_6G04910"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /function="ATP binding"
FT                   /function="leucine-tRNA ligase activity"
FT                   /biological_process="leucyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85549.2"
FT                   /db_xref="GO:0004823"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006429"
FT                   /db_xref="HOGENOM:HBG521010"
FT                   /db_xref="HOGENOM:HBG693845"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="UniParc:UPI0000F51CE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI9"
FT                   /transl_table=1
FT                   /translation="MYSISRLRCRPTVFIQGRWRCAVRPVLSNFMRLATTSATSISRKL
FT                   DLLAIDRKWQEKWHAEGPRSLPDDANKENRGDRPKSYILSMFPYPSGTLHMGHLRVYTI
FT                   SDVLARFYRMRGHEVLHPMGWDAFGLPAENAAIERGIDPAEWTKQNIAKMKEQLRSIST
FT                   SFDWDRELATCSPEFYEHTQRIFLMLYRKGLAYQAEALVNYDPVDKTVLANEQVDSNGF
FT                   SWRSGAKVEKLKLKQWFFRITDFKEMLLKDLDSLTGAWPERVLTMQRNWLGKSYGAKIK
FT                   FPVAVDASGDANLHVNVFTTRPDTLYGVEYLALSLNHPIVLEAAEKDAALRKFLDEAAS
FT                   LPPDSKVGYKLANVTASNPLHIIDKESPHIARRLPIFVAPYVLSDYGEGAVIGVPGHDS
FT                   RDLAFFKENTNSDSIPVVIEPEHLSNPNNDSTGTVTRPNDMKAFTQEGILTSRCWKYQG
FT                   LHSREAKKQIVTDLKGVGHGDFVEQWRLRDWLISRQRYWGAPIPIIHCESCGPVPVPED
FT                   QLPVRLPKIEGDWLKGKKGNPLESSQDWVNTKCPSCSGPAKRDTDTMDTFVDSSWYYLR
FT                   FPDAHNKEQPFSPSTARQVDIYIGGVEHAILHLLYARFIYKFLSQTELFPEIARSGDGL
FT                   GPSEPFKTVLTQGMVHGKTYTEPSTGRFLLPSEVDLSNPNKPLIKGTQVAPNISFEKMS
FT                   KSKHNGVDPTSCALQYGADATRAHVLFSAPVSEVLEWDDTKIVGIERWFGRLWKLVLDA
FT                   KQSLASASFTVSQNDLQKSPYATSKLPSLLQGLGDSDAEGLLHTHQTIVSVTNCIENNP
FT                   YGLNTVISDLTKLTNTLTSSNPTSPQVLYLCVSSLVRLLAPVAPALASECWEVLNDTLI
FT                   DQNANTGARVPDIFDCAWPSPLLTSEQADVLSARGGQIVAVQINGKLRFTVTIPRRLSP
FT                   TTSADSSDSGAVTDEQDWIISRILETDEGRVWLREKNDWEKRRRVVVVKGGKLVNIVF"
FT   CDS_pept        join(1161764..1161955,1162029..1162204,1162261..1162805,
FT                   1162869..1163212)
FT                   /codon_start=1
FT                   /gene_family="HOG000136703" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903381"
FT                   /orf_name="AFUA_6G04920"
FT                   /product="NAD-dependent formate dehydrogenase AciA/Fdh "
FT                   /EC_number="1.2.1.2"
FT                   /function="NAD or NADH binding"
FT                   /function="formate dehydrogenase activity"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85548.1"
FT                   /db_xref="GO:0008863"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG223609"
FT                   /db_xref="HOGENOM:HBG328050"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F66B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ0"
FT                   /transl_table=1
FT                   /translation="MVLIRSLSRHLRRPATSFLSTKGTLSPTSSSPFRAASLGGSISGA
FT                   RTLTASANLQGKVLMVLYDGGEHAKQQPGLLGTTENELGLRKWIEEQGHTLVTTSDKDG
FT                   ENSTFDKELVDAEVIITTPFHPGYLTAERLAKAKKLKLAVTAGVGSDHVDLNAANKTNG
FT                   GITVAEVTGCNVVSVAEHVVMTILALVRNFVPAHEQIRNGEWDVAAVAKNEFDLENKVV
FT                   GTVAVGRIGERVLRRLKPFDCKELLYYDYQPLRPEVEKEIGCRRVENLEEMLAQCDVVT
FT                   INCPLHESTRGLFNKELISKMKKGSWLVNTARGAIVVKEDVAEAVKSGHLRGYGGDVWF
FT                   PQPAPKDHPLRYVQGPWGGGNAMVPHMSGTSIDAQIRYAQGTKAILESYFSGRHDYKPE
FT                   DLIVKDGDYVTKAYGQRQK"
FT   CDS_pept        join(complement(1164861..1164887),
FT                   complement(1164387..1164800))
FT                   /codon_start=1
FT                   /gene_family="HOG000200726" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903382"
FT                   /orf_name="AFUA_6G04930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85547.1"
FT                   /db_xref="HOGENOM:HBG056107"
FT                   /db_xref="HOGENOM:HBG328043"
FT                   /db_xref="UniParc:UPI000051FB5E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ1"
FT                   /transl_table=1
FT                   /translation="MGSMSSLAKTLLIPAVISLALYLLLSFLIVPFFRRYHQRYSQYLP
FT                   LQAISAHTLSLRDRIADAVMRFFLPSAWRRQTDAQHDNISIFDEEGEIMVGMDMDPSRR
FT                   EALERRRDTADASSRLSRDLEQGFMDDSDDDEDDQGHSRVGR"
FT   CDS_pept        join(1165667..1166862,1166918..1170287,1170346..1171182)
FT                   /codon_start=1
FT                   /gene_family="HOG000200715" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903383"
FT                   /orf_name="AFUA_6G04940"
FT                   /product="Cytokinesis protein SepA/Bni1 "
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /protein_id="EAL85546.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="HOGENOM:HBG056100"
FT                   /db_xref="HOGENOM:HBG328035"
FT                   /db_xref="InterPro:IPR003104"
FT                   /db_xref="InterPro:IPR010472"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR014767"
FT                   /db_xref="InterPro:IPR014768"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051FB51"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ2"
FT                   /transl_table=1
FT                   /translation="MPTTTSASDKSRQTSAGKGFFGRKLHKEKPVDDRYEGYGGSENLA
FT                   PPGNATGSRSSRHSKRSSVQSVDYSHDFDPSGISMTAGVITSIPYESLTTDTRSPIPVD
FT                   YLSRAETSPRKEPSPNHLAKGGGDFHQYPAWNPTGLRENNAFSHPTGPRPPPHASNVSM
FT                   VGSTAGDKSARHQQWARPGSSATNAGFSHNSSSTVDSSSTSRMSFDQTSIHSSLSSNTR
FT                   GSSYISSDGSARTLTTSHSGDRGTLFPSSGNSNRFSTAQAAWQAAQLATHSAAPVLNPE
FT                   QYLTRPRDDRVVDQLFLDLMQKRGWQNLPEQAKRQMLAYPASKKWTLVHQDRLTELQGE
FT                   QKRRQNARQTHGHDGPAGILERADEEGSPEWYVKKVMDDSITSKQLASLSVSLRTQPIN
FT                   WVRAFVEAQGQIALTNVLSKINRRKASGPVPAPPTGDRDLDREYDIVKCLKALMNNKYG
FT                   ADDAIGHQQVIIALVSSLLSPRLNTRKLVSEVLTFLCHWAEGEGHQKVLQAMDHVKNQH
FT                   GETGRFDAWMRIVEVTIDGRGKMGSLVGASEEYRSGGIGMENLLMEYAVSTMMLINMLV
FT                   DAPENDLQLRCHIRAQFISCGIKRLLTKMEGFQYEVIDKQIERFRENEAIDYEDLLQRE
FT                   SSSMKDSIEGEVKDMSDPLQITDAILTRLNGTRAYDYFLSAMQHMLLIRENSGEDGLRM
FT                   FQLVDAMLSYVAMDRRLPDLDFRQGLTFTVQSLLDRLHTDAEARRAYDESLEARQIAEA
FT                   AIAERDEMKAQVEMGADGLVKKLQKQIDEQTSIIELQTRQNDALKAELADVQRLRAQEL
FT                   QRNELETRELYLMLRDAQDIAASNAKKNNLAETDPSHMRGILDRERLLERLEKQLERTK
FT                   TQFKLEGKVWGQHGPSDRLRELREQMDGEPDPEDFQEQARRNLETSALGSVHRKRSHVP
FT                   EMDVANGQERPSHQDGPLLVNFGRPRMDPEQASDLLGEIASKVPKIDAEDAETDEFNAQ
FT                   PTQLETEEARVGQVEEVKPEDETEKPEEKPVSVPAPPPPPPPPPPPPPPGGAVGIPPPP
FT                   PPPPPPPPPPGAKGLGVPPPPPPPPPPGFAGGMPPPPPPPPGRFGAPPPPPPPGVGGGW
FT                   RSNYIASQSAPSHPTAVLSSIRPKKKLKALHWDKVDTPQVTVWAIRDPTPQAKEQKYSE
FT                   LAKKGVLDEVERLFMAKETKIFGAGSGAKQRKDKKQIISNDLSKTFQIALAKFSQYPID
FT                   DVVRMIIHCDPEILDNMVVMDFLQREDMCTIPENVSKLMAPYSKDWTGPDAASSEREQD
FT                   PTELTREDQIYLYTAFELNHYWKARMRALALTRSFEPDYEHLSTKIREVVRVSESLRDS
FT                   VSLMNVLGLILDIGNFMNDANKQAQGFKLSSLARLGMVKDDKNETTFADLVERIVRNQY
FT                   PEWEGFVDEIGGVIGVQKINVDQLRADAKKYIDNIKNVQASLDAGNLSDPKKFHPQDRV
FT                   SQIVQRSMKDARRKAEQMQLYLEEMVKTYDDIMVFYGEDNTDEGARRDFFAKLASFLVE
FT                   WKKSKEKNIALEEARKRTEASLARKRVNAGLANSSGAGDAPVSPATSGAMDSLLEKLRA
FT                   AAPQARDQRDRRRRARLKERHQVRIASGQKIPDLTGSEPANGETQANNNSATPVGGNDA
FT                   NTIETGLLSPPAQETDVDTPTKELQVSESEDVADRAASMLQGLRDNLDNNGERARRRRE
FT                   SAEEERRKRRLRRRNGGTASKDSADGSTLSSVPEPATPPPSTEVSALSEPGMASPSNDE
FT                   NGTSQPPQTRSIVVSPNADEHHGSPGNEKSLDGSPKHQPTEQSA"
FT   mobile_element  complement(1168850..1168945)
FT                   /mobile_element_type="transposon:cacta transposon family"
FT   CDS_pept        join(1172116..1172388,1172453..1173994)
FT                   /codon_start=1
FT                   /gene_family="HOG000200714" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207953"
FT                   /orf_name="AFUA_6G04950"
FT                   /product="Mitochondrial GTPase (Mss1), putative "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="tRNA modification"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85545.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006400"
FT                   /db_xref="HOGENOM:HBG001389"
FT                   /db_xref="HOGENOM:HBG746795"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="UniParc:UPI000051E81D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ3"
FT                   /transl_table=1
FT                   /translation="MRAFGFWSLRRAVTICPSWSRYSCIAAPSHGVSLDLARQAQRRLP
FT                   NTCRHFCASSNFRFSLEADSTIYALSTAPGRAAIAVVRVSGSACVQIYRALCPSAPLPR
FT                   ARVAAVRTLYDPTQEPSANTVLDAGALVLYFPGPKTVTGEDVLELHLHGGPAIVKSVLA
FT                   AIARSNRPESTVRYAEPGEFTRRAFMNNRLDLPQIEALGDTLTADTEQQRRLAVRGASD
FT                   ALSRRYESWRQQLLYARGELEALIDFSEDQYFDESPEDFVRSVAGQVRALQTQLRLHIE
FT                   NASKGELLRNGIKIALLGAPNAGKSSLLNRIVGKEAAIVSTEEGTTRDIVDVGVDLGGW
FT                   YCKLGDMAGIRSEKSTSTGQGTAIIGAVEKEGIRRARARALESDVVVLVISLEEGTNGS
FT                   PYRLSVDQEVIDAVNDCVQAGKCIVVAINKCDRLPAADRFGQSLHDLRTKIRTLFPAVP
FT                   EKRIFDISCNEASEETLSEQSDPGNLQRFLRGLISTFEEIASPARMDGDENGQYDLSYW
FT                   EDSLGVTHRQSSNLQRCMQHLDDFLNETTQAQTLQTPGYADDRNIETEIDVVMAAEHLR
FT                   FAADTLAKITGKGESGDVEDVLGVVFEK"
FT   CDS_pept        join(complement(1179462..1179907),
FT                   complement(1176704..1179409),complement(1175883..1176072))
FT                   /codon_start=1
FT                   /gene_family="HOG000200692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056662"
FT                   /orf_name="AFUA_6G04960"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL85544.1"
FT                   /db_xref="HOGENOM:HBG056089"
FT                   /db_xref="HOGENOM:HBG328012"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051E5AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ4"
FT                   /transl_table=1
FT                   /translation="MDPFTWIGAISGVLQIAQVISQTTAGLVKLKGRFSNADLTIQSLI
FT                   GELSIIESALTHLEDWAKFNARVTTKSEEYIEGLNVALDGCRAVMEVLSEEVASLVQNI
FT                   TGQDSIVGFRARVKVVWNEDVMRGHQERLHAQVVALQLLLQACQCRSSSEQVELLRRAE
FT                   NRQIIKKVADDTATLRSSSYAGSQAHGSSWSFYQPSVSNVASDLDRVLASSPSIRYAGH
FT                   HFQSKSDIDEGYASAATTGRSFSQTNCFSLPLRPNDSVVMSNGHSTSVTLQHAPRQYSQ
FT                   SQVRRSHSDSKPPSSARPPLGSKRERIRSVFRQFSRSSLKSSSSMSPGLSPTASRVARA
FT                   VDEKVLKTSIDLTAPEGATAPLIVKLAQSGGLADIEMLIESGHGVDARHLSTRRTALLV
FT                   AAHCGNEAVVNLLIQKNARLDAVDAWGSTALHLAASRGHCDVIQLLLLEPLDREARDAQ
FT                   GRTALWLAAGRGQLEATRLLVAHHAKVNVRAENHTTPLHAAAKRGDEEMVELLISCGAD
FT                   LEARDGAMMTALHYACEEGHLGVMKLLLDNRANINVPGSDRRTPLICSAAMGRCPVAQE
FT                   LLKRKASAHCVDDASMTAVHWAAFNGHIEIVDLLSQKKGVLTATNKLGRTALHLAAMNS
FT                   RFAVIELLVRKGVPVDARCHDGLTPLHYACLANSLEIARLLLISSANIEAQTEINKQRP
FT                   IHIAAARGSMNILNLLCDKGASLEARDAKGDRALGVASRHGHAAAVQNLLERGCPLYLA
FT                   YETRPQEDSPLCLAAMGGHLPVVSLLLQHGASVVRRDESGWQPHHYAAYYGHPDVLALL
FT                   LHHGPASANDGTRFGLDAAGIGFAPHAIISEERKAQVRQLLNQDSGQFVAQTQIPAFQP
FT                   PQAIGETLHNRTIAPQLPLTTRSLEPCAEPSAMAPQELPVTLEQGLPPSRSVTPEHMRG
FT                   GRRTSIGLRSSSSQSRQFEAAVQSSSSGTAPRQPEPSLSHTGSTSEPWFDYSLPYWRGS
FT                   PVSTVHETGTEVEVLAPQPGRGTVSKLPLLSTFNPVDPVCEPTGIMNSDSESSSSVYTA
FT                   REKTPCSGNNGTSNSGGGLRGAVSWNRRSNPDNRIDAGDDLVLKGYKVRTSGDSGARRE
FT                   TSIIET"
FT   CDS_pept        join(1181194..1181907,1181968..1182540)
FT                   /codon_start=1
FT                   /gene_family="HOG000088965" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265350"
FT                   /orf_name="AFUA_6G04970"
FT                   /product="Phosphoserine aminotransferase "
FT                   /EC_number="2.6.1.52"
FT                   /function="O-phospho-L-serine:2-oxoglutarate
FT                   aminotransferase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="L-serine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85543.1"
FT                   /db_xref="GO:0004648"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006564"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG289982"
FT                   /db_xref="HOGENOM:HBG521576"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniParc:UPI000051FFD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ5"
FT                   /transl_table=1
FT                   /translation="MPSRQEVAYFGAGPAPLPTSVVEAGAKAFVNYNDCGLGLGEISHR
FT                   SPTANKILEDTKASLTTLLDIPDDYEILFMQGGGSGQFTSVVQNLVGVWVERRRQKAEA
FT                   EISATENKDELVFERLQKEVQEELKLDYIVTGSWSLKAAQEATRLVGAKHVNIALDART
FT                   ASNGKFGKIPAEDTWTLSPSKNSAFVYFCDNETVDGVEFPNFPKILESDDRIVVADMSS
FT                   NFLSRNVDVKKYSVIFGGAQKNIGIAGISIVIIRKSLLPPQTPTPAPALLHRLNIGGLP
FT                   GSVVLDYATIAKNNSLYNTLPIFNLWIAGQVMAELVQTYGVQKISGQEQISNRKAEILY
FT                   SVLDKYPQVYHVVPDKSVRSRMNLCFRVHGGDAEKEKEFLAGAEKRLLQGLKGHRSVGG
FT                   IRASNYNAVPLENVEKLAKYLEDYATGNV"
FT   CDS_pept        complement(1182728..1183873)
FT                   /codon_start=1
FT                   /gene_family="HOG000200681" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751323"
FT                   /orf_name="AFUA_6G04980"
FT                   /product="Cytochrome c mitochondrial import factor (Cyc2),
FT                   putative"
FT                   /EC_number="1.7.1.1"
FT                   /function="nitrate reductase (NADH) activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85542.1"
FT                   /db_xref="GO:0009703"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056078"
FT                   /db_xref="HOGENOM:HBG327994"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI000051FFE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ6"
FT                   /transl_table=1
FT                   /translation="MKSRLPRSGGLLFNPPSTLSKRAASRRYTASSSPTTSAPSPPKRR
FT                   LWLRLTIVTATAAGIGAYVRSQQGSESTTLNPVTFTKYRLVAREPVSSNGSIFTLKPPK
FT                   PDDNREVYEDAWKTGVWSVMFKQPQLQIGRDYTPLPPISLNDQDEQEGCLRFFIRKDPF
FT                   GEVSRYLHSLDVGSAIEVRGPRIECEIPSDTRQILFIAGGTGIAPALQAGHTLLRRTDA
FT                   DHKPRLHILWANRRRDDCLGGCNDSSAIDEVQQRSWFTGLFRSRPSSPPPAGPTQDPAA
FT                   TSLMVRELEALKARYPGQVTVDYFVDEESSFIEKKSITRFTDTASSNGPPGGKMIIVSG
FT                   PEGFISYMAGPKLWAQGMELQGPLNGVIKELDLKDWAVWKL"
FT   CDS_pept        join(1184265..1185299,1185357..1186166)
FT                   /codon_start=1
FT                   /gene_family="HOG000098892" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751324"
FT                   /orf_name="AFUA_6G04990"
FT                   /product="Amino acid transporter, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85541.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="HOGENOM:HBG714539"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051F8C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ7"
FT                   /transl_table=1
FT                   /translation="MSHITFSQTDTRSNNLHAPRDSLELASLASSSPESVGRSSASSSP
FT                   SGISSSRKLSLEDEDPLSDAHSHANLESGRARPTRSYSISSAFDFGNALFPLSQTAGGY
FT                   APLGAPSALDRQAGTDGSLERNKTLTYLNGLSLVVGIIIGSGIFSSPSQVNANAGSPGA
FT                   SLIAWAVAGLLAWTGAASYAELGGAIPLNGGAQVYLSKIFGELVGFLFTWCAVLVLKPG
FT                   SAAIIAIIFGEYVVRAVIHADAETVSPWISKGVAFGGVFLVTVLNCISTRLAARIGDFF
FT                   MFFKFVALIGVTVIGIVVAVTGFSSTGSASKEWKEGWFKGTSKDISGWAVAIYAGLWAF
FT                   DGWDNTNYVTGEFKNPSRDLPRVIHTAMPLVILSYLLANVSYFLVLPHSTIEASNTIAV
FT                   QFGDKVFGSVGALVFALVVSASCFGALNATVFTSGRLVYAAGKEGYLPSMFGSLWSGRS
FT                   SGMGSNRLQRRSWASKALARIFGENIRFGYTPINAMALNSALTAVYIIGGEFKTLVTFY
FT                   GVAGYTFYFLTVLGLIVLRIREPYLARPYKTWISTPIIFCCVSLFLLSRAVIAEPLQTL
FT                   IVVAFIIAGVPVYFFRIYQRDGKITFPGWKFWQASRRR"
FT   CDS_pept        join(complement(1186902..1188390),
FT                   complement(1186448..1186845))
FT                   /codon_start=1
FT                   /gene_family="HOG000217814" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265351"
FT                   /orf_name="AFUA_6G05000"
FT                   /product="Glycosyl hydrolases family 32 superfamily "
FT                   /EC_number="3.2.1.26"
FT                   /function="sucrose alpha-glucosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85540.1"
FT                   /db_xref="GO:0004575"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG056064"
FT                   /db_xref="HOGENOM:HBG332332"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="UniParc:UPI000052021C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ8"
FT                   /transl_table=1
FT                   /translation="MHILPGSQHAAELDNSGTLIHSVHCDPEQKAKNIPQSTGIAQASS
FT                   EWRPSYHLAAPRGWMNDPCGLGYDPTTGLYHLSFQWNPHGNDWGNISWGHATSSDLVSW
FT                   QISPEPCLTPSAEYDRCGVFTGCFRSHGPDGKPGVLTYVYTSVNHLPLHYTLPYVKGSE
FT                   SLSIAVSRDHGKTWQRIDSNPIHPGAPAGLEVTGWRDPYLNCWPSLRAQRQGGVASPDL
FT                   YGFISGGIAKESPTVFVYVVNPDNLTEWTYIGPLLHVGLNYRPSRWSGDLGVNWEVANF
FT                   FTLTDGGVSRDIVIFGAEGCLSCEVGSKRVPRSLLWMCINVRPGLQAQSSGEPLADYSF
FT                   SGIFDHGCCYAANSFWDPVTEEYVVYCWITEEDLPDRLRHRQGWSGIMSLPRLVRLVTL
FT                   HNVKRAHQSKLESITSVEIERHSQGTQVRTLSVRPDPRLNILRTSARELHLSNVQLGSV
FT                   AHQPPAFLPLRTARWEMTATFVIGTHCAAVGLEIGHSPEDFHQRTTLSWIPYDETFTIE
FT                   RPPLHDAGINHVPETAPHTLFTFCNNEGEEVTEPLQIHAYFDASVLEVFVNSRTVISTR
FT                   IYTPHAQVCTGLKFFASATESQPKPSTSAPAAVLVRADIWDGLSVIRDEIKH"
FT   CDS_pept        join(complement(1192148..1192186),
FT                   complement(1191888..1191979),complement(1190765..1191784),
FT                   complement(1190106..1190703),complement(1189724..1190038))
FT                   /codon_start=1
FT                   /gene_family="HOG000200670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751325"
FT                   /orf_name="AFUA_6G05010"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85539.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056059"
FT                   /db_xref="HOGENOM:HBG327957"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000520219"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ9"
FT                   /transl_table=1
FT                   /translation="MNPSPTNAVKKTPCSLSQPCRACSQMGFECLFLQPQKKRGPTGNR
FT                   VSQIRQQQQTQLLRKSSQSSLSDAYPYQRPITSRETGQHGVAPSVQDPTQWPIPQRGEA
FT                   SVSTDVVPPRSNTSIGPSWPATDTSSVDSQTNSAISWNERSDVEYWLPDNLDAQVPVFE
FT                   FPGSNIYLKASLPSIIQPEQEAAGLQPHHVDTSNLALSTMGVMPAGPVPTRTTWPASIV
FT                   EANMIPWIEVYFDRLHPTLPVLNRSSLFIRMLAQEHRRNPQFGAMLLSLCAFSLTQPIE
FT                   IDERPTSSSRASQARSMMNEATKMRSCSDFGEHPTIEAVLTSFFLFGCLFGSNQHNAAW
FT                   LRLREALDLAATLGLNNPDSYRDIPNDERGQRLRTYLVLSITERAYALQRRHPITFWGR
FT                   PGFTMRSVHDFIHNATHSVVSGIIVHNEKDAEGMLGLARLMELFDAIDEEVVDCWNQRC
FT                   NVNSGYCNNLTEEKALSIHQNLRRVCESERYKGYDWFERTKSVPGEVQSVQPTISMRET
FT                   QCADVFITKKWLQNRVWVLCSTHGLLRPVSDHPELSFEYAITVAVDALKICQSLRLSSM
FT                   EAHGIGLVEKLYDIAVSAIGISANVRQPLGEHSTASVAGSMAGPGVAPPGSLVGAMSPN
FT                   TAAVHSTQSLAEDFMLLLNTLRGGNHPFMEKFKAYLSSLHIVGVGCSNWAQT"
FT   CDS_pept        join(1193316..1193569,1193632..1193653,1193715..1193987,
FT                   1194046..1194240,1194295..1195194)
FT                   /codon_start=1
FT                   /gene_family="HOG000158126" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751326"
FT                   /orf_name="AFUA_6G05020"
FT                   /product="Acetamidase"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="EAL85538.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG327754"
FT                   /db_xref="HOGENOM:HBG348222"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR015830"
FT                   /db_xref="UniParc:UPI000051E5B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK0"
FT                   /transl_table=1
FT                   /translation="MGSVRTWEQTVTEKRSVRDRALEPYMTSDIEQRPPQIQNTHHRTC
FT                   IHDDTTIQEITDIDSVPVLLERLKRGQYTAEQVSLAYIKRATIAHQLTNCLTEVVFEDA
FT                   LEQARRLDQLFEEKGQLAGPLHGIPVTLKDQFNIKKVDTTLGYVGRSFAPASEDAVLVE
FT                   MLKGMGAVIIAKTNLPQSIMWAETENPLWGLTVNPRNPLFTPGGSTGGEGALLALHGSV
FT                   LGFGTDIGGSIRIPQSINGLYGFKPSSSRFPYYGVPVSTEGQEHVPSSIGPMARDLSSL
FT                   AYVCRIFANAKPWKLDPKCAPLPWNEDSFGDALSRPLVVGLILDDGVVKIHPPVERALR
FT                   ELSAKLESRGHEVVVWDASDHFDYIKLMDQYYTADGCEDIRRDVEVAGEPYIPHVEALI
FT                   NRGKAISVYEYWQLNKQKTTLQKRYLDKWNTVRSQSGKQVDILLGPTMPHAAVPHRSVR
FT                   WVGYTKIWNLLDYPALTFPADQVRADRDRLPDELYRPRNELDGWNWGLYDPLTMNGHPI
FT                   NLQIVGRKLEEEKVLGAATVIEKIWRTAKT"
FT   CDS_pept        join(1195846..1195951,1196011..1196588,1196666..1196769,
FT                   1196827..1196956)
FT                   /codon_start=1
FT                   /gene_family="HOG000251649" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903384"
FT                   /orf_name="AFUA_6G05030"
FT                   /product="Polysaccharide deacetylase family protein "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85537.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG048398"
FT                   /db_xref="HOGENOM:HBG508050"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniParc:UPI000051FDAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK1"
FT                   /transl_table=1
FT                   /translation="MGKKRVLVAYGVDIDAVAGWLGSYGGEDSSNDISRGLWAGHVGTP
FT                   RLLKLFDKYNIKATWFIPGHSLETFPEECAQVRDAGHEIGLHGYSHENPSDMTPEQQKD
FT                   VLDKTYRMLTDFCGRPPRGIVAPWWETSKEMADLLLAYGIEYDHSMSHHDCQMYWLRTG
FT                   DTWTKIDYSQKAETWMKPLVRGQDTGLVEIPGNWYIDDLPPMMFIKNAPNSHGWVNPRD
FT                   IEDIWKDHFDYFYREYDSFVFPMTIHPDVSGRPHVLLMHERIIEHINKHEGVEWVTFEQ
FT                   MCDEFKKNNKPPEGAKMPVTPVLE"
FT   CDS_pept        join(complement(1198456..1198544),
FT                   complement(1198175..1198399),complement(1198029..1198112),
FT                   complement(1197553..1197975),complement(1197270..1197495))
FT                   /codon_start=1
FT                   /gene_family="HOG000224155" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265352"
FT                   /orf_name="AFUA_6G05040"
FT                   /product="DNA replication factor C subunit Rfc4, putative "
FT                   /function="ATP binding"
FT                   /function="DNA clamp loader activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="DNA replication factor C complex "
FT                   /protein_id="EAL85536.1"
FT                   /db_xref="GO:0003689"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005663"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG533331"
FT                   /db_xref="HOGENOM:HBG541599"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniParc:UPI000051EEFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK2"
FT                   /transl_table=1
FT                   /translation="MVQAESSASASRNSLRAVTAGAPPDYELPWVEKYRPIFLDDIVGN
FT                   TETIERLKIIAKDGNMPHVIISGMPGIGKTTSILCLARQLLGEAYKEAVLELNASDERG
FT                   ISRIKGFAQKKVTLPPGRHKIVILDEADSMTPGAQQALRRTMEIYSSTTRFAFACNQSN
FT                   KIIEPIQSRCAILRYARLTDAQVVKRLKQICDAEKVEHTEDGIAALVFSAEGDMRQAIN
FT                   NLQSTWSGFGLVSGDNVFRVVDSPHPIKVQAMIKACWEGKVDAALETLNELWDLGYSSH
FT                   DIISTMFRVTKTIPTLSEHSKLEFIREIGFTHMRILDGVQSLLQLSGCVSKLCKINMKP
FT                   QLFEPPKA"
FT   CDS_pept        1199005..1199391
FT                   /codon_start=1
FT                   /gene_family="HOG000200659" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056663"
FT                   /orf_name="AFUA_6G05045"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85535.1"
FT                   /db_xref="HOGENOM:HBG056038"
FT                   /db_xref="UniParc:UPI000051F662"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK3"
FT                   /transl_table=1
FT                   /translation="MGTTSVRRNLFHHNLSRRPVSATPGSMPSSRSNGVSGPPSHMLQS
FT                   SSESMGPSLTSGSLDNGDIVVRDKNGGYKLDIPVLPPAITSENGDGMDGLDESGTSGGA
FT                   GTTAVDSASQTDISGREKESTLAG"
FT   CDS_pept        join(complement(1201126..1201169),
FT                   complement(1200771..1201027),complement(1200465..1200617),
FT                   complement(1199826..1200412))
FT                   /codon_start=1
FT                   /gene_family="HOG000200648" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265353"
FT                   /orf_name="AFUA_6G05050"
FT                   /product="DUF410 domain protein"
FT                   /protein_id="EAL85534.1"
FT                   /db_xref="HOGENOM:HBG060032"
FT                   /db_xref="HOGENOM:HBG397316"
FT                   /db_xref="InterPro:IPR007317"
FT                   /db_xref="UniParc:UPI000051FFD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK4"
FT                   /transl_table=1
FT                   /translation="MTSRIDKTIARQREKIASGAYYEAHQQLRVIAARYIKQSNYEAAA
FT                   EILAGGATALLRAGSQQGASASGGDLAIMLVDEVYTKAGWGITGGDDDAEGRARKKRLI
FT                   ELLREFPSEEPTRKRFIQEMIGWSGRFGPVERGDAELHHAAGSVYAEDNEPYDAEKHLV
FT                   LGTSESAETLAKLEYEWYTNDEPHTAAIYASRAVFPYLLVGNLRNANKAFLVFTSRLSS
FT                   SNTSLGVQEVSSASSDVRVFPSLPLLNFISMLLLTIQRGSADLFKQLTAHYASQIREVG
FT                   IWDDALSQIGEQYFAIKVPRQGNPLLDMMGSMLFGGQNQGGSRRTPQGRSQSKTVEAPP
FT                   ASMELD"
FT   CDS_pept        join(1201673..1201747,1201804..1202046,1202114..1202145,
FT                   1202198..1202234,1202355..1202448,1202503..1202673,
FT                   1202756..1203055,1203119..1203264)
FT                   /codon_start=1
FT                   /gene_family="HOG000200647" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265354"
FT                   /gene_name="rai1"
FT                   /orf_name="AFUA_6G05060"
FT                   /product="Protein rai1"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription termination, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85533.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006353"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG056022"
FT                   /db_xref="HOGENOM:HBG395893"
FT                   /db_xref="InterPro:IPR013961"
FT                   /db_xref="UniParc:UPI0000520459"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDK5"
FT                   /transl_table=1
FT                   /translation="MDGGTFDIQPIGRFYGSNTTIRRPREITCFSYDAEHKFHLGDSSL
FT                   RYYYTPRLPADLNRGFDTFQKLDDTADEHLDALLETIMALEKETGKRCEADIITWRGMM
FT                   TKILTAPFDNLNGFEMNATCFQVGGENNLYKIQQKQIQENQRMPPGMASQDLMAYWGYK
FT                   FETLCLLQQPWDPTPRAEIESREDLVVNNNAQYCSVVRTGIGSTRLIIGGEVDAVWDCK
FT                   PDRKEDPINWVELKTSAEIRNDRDMIKYERKLLKFWAQSFLLGVPKIIVGFRDNHGIVH
FT                   RLEELETASIPNKVKKLGRGTWDGNICINFAAAFLEWLKSTIKEGGTWRIRKLEKSSLI
FT                   QVFKIEETGTGDIISRSFLDWRSRS"
FT   mat_peptide     join(1201676..1201747,1201804..1202046,1202114..1202145,
FT                   1202198..1202234,1202355..1202448,1202503..1202673,
FT                   1202756..1203055,1203119..1203261)
FT                   /product="Protein rai1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDK5 "
FT   CDS_pept        join(complement(1205322..1205420),
FT                   complement(1203890..1205257))
FT                   /codon_start=1
FT                   /gene_family="HOG000039995" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056664"
FT                   /orf_name="AFUA_6G05070"
FT                   /product="tRNA isopentenyltransferase, putative "
FT                   /EC_number="2.5.1.8"
FT                   /function="ATP binding"
FT                   /function="tRNA dimethylallyltransferase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85532.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0052381"
FT                   /db_xref="HOGENOM:HBG350859"
FT                   /db_xref="HOGENOM:HBG559459"
FT                   /db_xref="InterPro:IPR002627"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI000051E5C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK6"
FT                   /transl_table=1
FT                   /translation="MLNFLRSFWRIKRPSTMEPLIAVVGATGTGKSKLAVDLATRFNGE
FT                   IINGDAMQMYRGLPIITNQIPFEERNGIPHHLISCVDFEEEPWRIGHFKRECLRLIKDI
FT                   HSRGKLPILVGGTHYYTQTVLFKDQLVEESLFSGDDDDAHFHKETKPTSAKWPILDAPP
FT                   DVVFQKLKEVDPVIASRWHPNDVRKIRRSLEIYFQTGKPASEIYAEQKRQKYATGTNGE
FT                   SSPGIGQLRYPTLIFWVHSEKETLNCRLAKRVDSMVEQGLMAEAQRMWAYIREKKGQGI
FT                   TVDQTRGVWVSIGFKELAPYFDALENGELSEGELEALKQSSIELVKIATRQYATSQIKW
FT                   IRNKLWKALADAGATKNLYLLDSTNVEDWQRWVTEPSEHLTQALLNDEPRPDPKSLSDM
FT                   ARETLCAREVQAQTQRSDVLQTFTCEICSRTMATQDQWNIHLNGRAHKRAIKNAAKRAE
FT                   REKYLRNQQTLGVGQNCDNPTPTEQPSTPQ"
FT   rRNA            1205794..1205909
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(1206309..1206444,1206502..1207208)
FT                   /codon_start=1
FT                   /gene_family="HOG000200636" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903385"
FT                   /orf_name="AFUA_6G05080"
FT                   /product="ABC transporter, putative "
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="EAL85531.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG316888"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="UniParc:UPI00005206C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK7"
FT                   /transl_table=1
FT                   /translation="MADSDNHTGPSINVNGLNYKFPDGSSGLTNVSLSLPAGSRTLLIG
FT                   ANGAGKTTLLRLLAGKRLAPTDTVSVSGRDPFKHGLEGVTYLGVEWVLNSIVRTDIDVP
FT                   TLLASVGGDAYPERRDELVEILDIDLRWRMHAVSDGERRRVQLAMGLLRPWQVLLLDEI
FT                   TVDLDLLSRSNFLSFLKRETETRPCTIVYATHILDNLSQWPTHLVHMHLGNVRQWGPME
FT                   NFKSEVTETSENSQLGELVLKWLKEDLSARGPRNGQSSQSKTYGSLDGLGGYGLEKPT"
FT   CDS_pept        join(complement(1209813..1209941),
FT                   complement(1207427..1209745))
FT                   /codon_start=1
FT                   /gene_family="HOG000200623" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207954"
FT                   /orf_name="AFUA_6G05090"
FT                   /product="RNA polymerase II Elongator subunit, putative "
FT                   /protein_id="EAL85530.1"
FT                   /db_xref="HOGENOM:HBG118786"
FT                   /db_xref="HOGENOM:HBG327889"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000051FDAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK8"
FT                   /transl_table=1
FT                   /translation="MASITTEYISVGGNRHPAAADWDVQLGVLAFGADNNVALWNPSDA
FT                   SQRGVYALLVGHTDKVSAVRFYTCPATGTKLLLTGSIDQTIRIWRADTVDPTKFAHAHT
FT                   LTGHTGSVNTIAVADGVAIIASGAADGTVKIWKIDTQETVIRADLFQSLTMKPRFFPLA
FT                   LSLKPLSTPLSTELKDKPVVLAVAGTMNNVQVYVSEDTLAGANFRLSATLSGHEAWVRS
FT                   LSFTEDKQSKSGDLLLASASQDKYIRLWRLQRGEATKSALSDDADPMLGGLETTLSNKA
FT                   HQFEAAGSKYSVTFEALLFGNEDWIYTACWNPSTERQQLLSASADNTLTIWEQDPVSGV
FT                   WLSVERMGEISVQKGSTTATGSTGGFWIGLWSPNGRQVVSLGRTGSWRAWRYDADRDMW
FT                   LQALGITGHVRSVNGVQWEPTGGYLLSTSADQTTRLHAEWLREGLKSWHEFSRPQIHGY
FT                   DLNCIDILGPARFVSGADEKLLRVFNEPKPIAQLLEKLAGFKPGTDEELPDTAQIPVLG
FT                   LSNQAVGDDIPMEVDEESAAGARQVQANQAMISNLWHPPLEDQLARYTLWPEHEKLYGH
FT                   GYEISAVAVNHDRTLVATACKASSIDHAVIRLYDTSDWREIRPSLKAHSLTITSLCFSS
FT                   DDRYLLSVGRDRQWAVFLRSGQDPSSFSLLTSNPKGHSRMILDAAWAPQVAKPVFATAG
FT                   RDKSIKLWEKVQDSFTCKTTISLENSVTAVSILPSILDASFFLAAGEESGKLSIYQVTV
FT                   DGLEARHIATVDRSVSPSRAITQLSWRPSHRTDVRDTQSRFELAVASEDSSVRVYAISN
FT                   MLS"
FT   CDS_pept        join(complement(1213159..1213172),
FT                   complement(1212823..1213011),complement(1212572..1212756),
FT                   complement(1212274..1212443),complement(1212116..1212196),
FT                   complement(1211955..1212062),complement(1211785..1211904),
FT                   complement(1211360..1211734),complement(1210923..1211300))
FT                   /codon_start=1
FT                   /gene_family="HOG000200602" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751327"
FT                   /orf_name="AFUA_6G05100"
FT                   /product="6-phosphofructo-2-kinase, putative "
FT                   /function="6-phosphofructo-2-kinase activity"
FT                   /function="ATP binding"
FT                   /biological_process="fructose 2,6-bisphosphate metabolic
FT                   process"
FT                   /protein_id="EAL85529.1"
FT                   /db_xref="GO:0003873"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006003"
FT                   /db_xref="HOGENOM:HBG058567"
FT                   /db_xref="HOGENOM:HBG395770"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR016260"
FT                   /db_xref="UniParc:UPI000051EA76"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK9"
FT                   /transl_table=1
FT                   /translation="MDTLLTAEIVANSPRFRRKSSTFVDAIHDLPEKADLAPAQLYSTE
FT                   SGRLFHSGRIVIITVGLPARGKTHISVALARYLRWLVFLSNRSCCHCLWNCRLGVKTRI
FT                   FHLGDYRRATIPVGQDIPDDYFFVNASASSVLLRQKIMKRCREDIYQYLNFENGQIAIY
FT                   DAVNPLASGRRSLAKEFAKQDIETLFIESWCDDERIIEENVRRVKISSPDYVGWSSEDA
FT                   VKHYLARISARIPQFQTMEEKDLNYIKMINAGERLIVNNKSFGYLSNRIVFYLLNLHIK
FT                   SRHTYFARAGVSLEADSYKADASLSEQGEDYAKKMTERLLQHRESEKQAMIDRGETDYE
FT                   LKPLTVWTSTRRRTVETAKYLYEKGYKVRQRSQMSQLNPGVCEKMSERRIREEYPDEVA
FT                   KHELDPYHHRYPRAESYHDLAVRLEPIILELEREQNDLLIIAHESVLRVLYGYLMACNA
FT                   ADIPFLEFPRDEIIEVRTQLMPPKLQSSRLTRSFRLSRKATKMRRAEYTSLICQKRLYL
FT                   ALRKILRFLYLPVGYPLPWLEE"
FT   CDS_pept        join(1214176..1214487,1214565..1215212,1215281..1215388)
FT                   /codon_start=1
FT                   /gene_family="HOG000200591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265355"
FT                   /orf_name="AFUA_6G05110"
FT                   /product="Mitochondrial import receptor subunit (Tom40),
FT                   putative"
FT                   /function="receptor activity"
FT                   /function="voltage-gated anion channel activity "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="EAL85528.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0008308"
FT                   /db_xref="HOGENOM:HBG056755"
FT                   /db_xref="HOGENOM:HBG327874"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="UniParc:UPI00005206CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL0"
FT                   /transl_table=1
FT                   /translation="MADFLALPSFLVENSAAVALKDAYNSFSERRAALGLSNPGTVDNI
FT                   AREVQKEVLLSNFMFSGLRADLTKVFGMSPLFRVSHAFSMGGSGNLPPYAFSAMYGTPK
FT                   VFMQGNFGSDGALAAVFNYRWNPKLVTKTNTQIMAGASQGLLQIDNDYTGDDFSASIKA
FT                   FNPSCLDGGLTGIFVGSYLQSITPSLALGFEAIWQRQAMNTRPETALSYCARYKANDWI
FT                   ASAQLQAQGVFTASYWRKLSERVEAGVDMNLQFAPNAAAALMGGPSRDGTTSIGAKYDF
FT                   RASTFRAQVDSAGKVSCLLEKRIAMPISLTFAGEIDQAKQSAKLGLAVSLEIAGEELME
FT                   QQEKIEAQGMIPPPF"
FT   CDS_pept        join(1221763..1221808,1221845..1222071,1222143..1222226,
FT                   1222302..1222650,1222709..1222902,1222958..1223162,
FT                   1223230..1223363)
FT                   /codon_start=1
FT                   /gene_family="HOG000233017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207955"
FT                   /orf_name="AFUA_6G05120"
FT                   /product="Glycogen synthase kinase (Skp1), putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85527.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00005206CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL1"
FT                   /transl_table=1
FT                   /translation="MSQNRPGVFSNLRMGENITQEPVELTALLSDHTEVVREKVQDGLT
FT                   GETKEISYSQCKIVGNGSFGVVFQTKMMPSGEDAAIKRVLQDKRFKNRELQIMRIVRHP
FT                   NIVELKAFYYSNGERKDEVYLNLVLEYVPETVYRASRYFNKLKTTMPMLEVKLYIYQLF
FT                   RSLAYIHSQGICHRDIKPQNLLLDPSTGILKLCDFGSAKILVENEPNVSYICSRYYRAP
FT                   ELIFGATNYTTKIDVWSTGCVMAELMLGQPLFPGESGIDQLVEIIKVLGTPTREQIRTM
FT                   NPNYMEHKFPQIKPHPFNKVFRRAPHEAIDLISALLEYTPTQRLSAIEAMCHPFFDELR
FT                   DPNTRLPDSRHPGGAARDLPNLFDFSRHELSIAPALNSRLVPPHARAALEARGLDIDNF
FT                   TPLTKEEMMARLD"
FT   CDS_pept        join(1225920..1226755,1226809..1227958)
FT                   /codon_start=1
FT                   /gene_family="HOG000200580" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265356"
FT                   /orf_name="AFUA_6G05130"
FT                   /product="snRNA cap binding complex subunit (Gcr3),
FT                   putative"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="EAL85526.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG056744"
FT                   /db_xref="HOGENOM:HBG327862"
FT                   /db_xref="InterPro:IPR015172"
FT                   /db_xref="InterPro:IPR015174"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051F8BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL2"
FT                   /transl_table=1
FT                   /translation="MASPATGFEAQASALLEKTDIIASTPHALVDLVNPFALKDGEPTA
FT                   VQSVISLLQNQLQAEANRGWELACLPRPWKRSESEEDGPIEAGPKHAFPQITVPNPVRK
FT                   GARAIFPEIYLSVYANQDLETVPPTSDIASSLLREALVDTINILDFNRIATAKFLIDVD
FT                   CYFTPYTFVKRATPFDRLRDLPGDRPTWKPEDVAVDAVFSQLFQLPSPEHKLVYYHSVL
FT                   TECCKIAPAAIAPSLGRAIRFLYRSLDTIDLELMHRFLDWFAHHLSNFGFTWKWSEWIE
FT                   DLELPLVHPRMAFITGAIDKEIRLSFAQRIRGTLPDPYQELITEGKEKDTPDFKYSSDS
FT                   ESYLICCPRSAYSKGLTKILIPTATPYAKEGREIMQLIRRKAGDEEIQPLITAIEEQAK
FT                   ALGVDDPMLPSTDAFVTSICFVGSKSLSHVLSCIERNKERLLAIGPKSARARCQIITSV
FT                   MEYWVDQPGVAINIIDKLLNYTILTPLSVIEWALVERLQAGTILSRTHIFEMISATVGK
FT                   VTNRLRQIVAARTQPGLYEPQLSVLDETLSREKADMQALFRVIEDSVVSVAGGSNDGLM
FT                   ERGDGSGNLPEDEIIRQWGRRWLRVFRRKAGVEESFITEAMADATPVGTVAPAPQPTAS
FT                   ETGGVVNDAADGDMDIAGADEAVKIS"
FT   CDS_pept        join(complement(1229666..1229934),
FT                   complement(1228802..1229591))
FT                   /codon_start=1
FT                   /gene_family="HOG000200579" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207956"
FT                   /gene_name="erg3B"
FT                   /orf_name="AFUA_6G05140"
FT                   /product="C-5 sterol desaturase B-like "
FT                   /EC_number="1.3.3.-"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85525.1"
FT                   /db_xref="EMBL:AAU82098.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG028850"
FT                   /db_xref="HOGENOM:HBG559159"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI0000520458"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL3"
FT                   /transl_table=1
FT                   /translation="MDIVLEIWDTFIGDRVYSALLPLSLSSTVSLPGLTNAANSSLSLF
FT                   GASKPFVYEPATQLFRLEPSKYAYLSAWPRNNIYRQFLSFFLIVWIFGIIVYFISATLS
FT                   YIFIWDKTTVKHPKFLKNQIPMEIAQTMRSMPVMSLLTAPFLVAEVRGYAKLYDSVDEE
FT                   PFPYYSILQFPLFIAFTDFCIYWIHRGLHHPLIYKSLHKPHHKWIMPSPFASHAFHPLD
FT                   GWSQSVPYHVFPFIFPLQKLAYVFLFGFINLWTVMIHDGEYVANSPIINGAACHTMHHL
FT                   YFNYNYGQFTTLWDRLGGSYRKPNEELFRRETKMDEAEWKRQTKEMETILKTVEGEDDR
FT                   KYLSQEEAKKDL"
FT   CDS_pept        join(1231600..1231720,1231952..1232033,1232131..1232453,
FT                   1232525..1233063,1233119..1233586,1233657..1233789,
FT                   1233872..1233947,1234105..1234234,1234421..1234657)
FT                   /codon_start=1
FT                   /gene_family="HOG000200558" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207957"
FT                   /orf_name="AFUA_6G05150"
FT                   /product="Transcriptional repressor TupA/RocA, putative "
FT                   /protein_id="EAL85524.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG395537"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013890"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000051FDB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL4"
FT                   /transl_table=1
FT                   /translation="MYNTHRGMVPAPNSRLTELLDQLRQEFENQSRSTGEFEHQLTGQL
FT                   QEMEMIRQKVYQLEQAQIKMKQDYEAEIRVLRHELESRGVQPISSHLAGPAQHAGPSQA
FT                   PPPALGHGPSNLFGGIMTNQGGSGPGLAPPPPQDQQPPQHTLQQPAPAAQQSAPQPPQS
FT                   SFGGYQPGAAVNGYGPAPPPTASPGPGKRSRAPPGPATPQQTHQLAYPDPRVSPQIARP
FT                   TPPSQALVTSRGERPGNMLANWNPDDLPASQKREGADWYAIFNPEVQRVLDVDLVHHLV
FT                   HDSVVCCVRFSRDGKYLATGCNRSAQIFDVTTGQIVATLQDESVDKDGDLYIRSVCFSP
FT                   DGKYLATGAEDKQIRVWDIAARTIKHIFTGHEQDIYSLDFAGNGRYIASGSGDKTVRLW
FT                   DILDGKLVYTLSIEDGVTTVAMSPDGHYVAAGSLDKSVRVWDTTTGYLVERLESPDGHK
FT                   DSVYSVAFAPNGRDLVSGSLDKTIKLWELSVPRAGYTNAVKGGKCVRTFEGHKDFVLSV
FT                   CLTPDGHWVMSGSKDRGVQFWDPITGNAQMMLQGHKNSVISVAPSPTGNLFATGSGDMR
FT                   ARIWSLFEHGLGLFLRSTFARVCPVPSQLRIFVSSVTLHVFKNDKTLHIPGSRWLHGDS
FT                   IYEAVCLLATRQGSRVNGRLHRSVYLVMDSVCYGYSLLATWSRVPEMDMVLRHQAPETD
FT                   RDLDISLD"
FT   CDS_pept        join(1241172..1241924,1241992..1242045,1242116..1242289,
FT                   1242355..1242708)
FT                   /codon_start=1
FT                   /gene_family="HOG000200547" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056665"
FT                   /orf_name="AFUA_6G05160"
FT                   /product="C2H2 transcription factor (Azf1), putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85523.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056725"
FT                   /db_xref="HOGENOM:HBG327836"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000051F18E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL5"
FT                   /transl_table=1
FT                   /translation="METAEPVSYEFTGHAMGSMAPRRLLHAGLGSNFSYYNNPATSFPL
FT                   PYHPSSSTPYGFSHTINQHPHQLPGYQHFYLTNHPSLNSQPVRLSSEPPTVQQIPDIRP
FT                   AKNAISRIVGKPLAKSEQSASSQPIAAAQPPATGVTQEKGPGSTEIEFSTEVDILMKTI
FT                   QAKAVPQQSALQCLPPLQQLTHGGENGFSQAYAMASSTLRCNVAVEELASRPGKKRKYI
FT                   CRLPNCGKSFAQKTHLDIHMRAHTGDKPFVCKEPSCGQRFSQLGNLKTHQRRHTGEKPF
FT                   SCDICQKRFAQRGNVRAHKITHQHAKPFTCLLDDCGKQFTQLGNLKSHQNKFHATTLRT
FT                   LTLKFSQMSETQLMNPQDRQLWEYFANLYKNSNKGIKGRGKDRRISPTSKSSDSSASCT
FT                   RMQSLESDEDLKASCGSREASSAYTSSSSGEEEDPEIYYTDRKGH"
FT   CDS_pept        join(complement(1244202..1244319),
FT                   complement(1243874..1244116),complement(1243225..1243790))
FT                   /codon_start=1
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265357"
FT                   /orf_name="AFUA_6G05170"
FT                   /product="Mitochondrial folate carrier protein Flx1,
FT                   putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL85522.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000F51CD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL6"
FT                   /transl_table=1
FT                   /translation="MTIKDGLSSSFVETIAGFTAGIVSTLCLHPLDLLKTRLQVDRSSP
FT                   SQLGGSLRVIREISRREGGITAFYRGLTPNIIGNSTSWALYFLCYGKTKDLMRRLRGSR
FT                   VLELTSADYFVASGLAGLATSFLTNPIWVIKTRMLSTGSNAPGAYASFTTGVTQIYRSE
FT                   GISGFYRGLLPALFGVSHGALQFMAYEKLKAYRTRMSSASRTSGDSIGLGATPARQLGN
FT                   IDFFLTSSLSKIFAGCVTYPYQVLRSRLQTYDAHLVYRGVRDAMAQIWAQEGFGGFYKG
FT                   LGPNLLRVLPSTWVTFLVYENTKSCLT"
FT   CDS_pept        join(complement(1245315..1245341),
FT                   complement(1245198..1245244),complement(1245105..1245133),
FT                   complement(1245010..1245046),complement(1244932..1244953))
FT                   /codon_start=1
FT                   /gene_family="HOG000200536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265358"
FT                   /orf_name="AFUA_6G05174"
FT                   /product="TOM complex component Tom7, putative "
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="EBA27234.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="HOGENOM:HBG325118"
FT                   /db_xref="InterPro:IPR012621"
FT                   /db_xref="UniParc:UPI0000EA8398"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA16"
FT                   /transl_table=1
FT                   /translation="MVQFSEETKERISKVIDVSRVAIHYGYLPLIIYLGYTYSEPRPSL
FT                   FKLFSPLA"
FT   CDS_pept        join(1245683..1245702,1245782..1246157,1246228..1246890)
FT                   /codon_start=1
FT                   /gene_family="HOG000200535" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751328"
FT                   /orf_name="AFUA_6G05180"
FT                   /product="Splicing factor 3b subunit 4 "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="EAL85521.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051E81E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL7"
FT                   /transl_table=1
FT                   /translation="MSGARHWEQDKEATVYIGNLDERVTDSLVWELMLQAGRIVNVHLP
FT                   KDRVTQSHQGYGFVEFISEEDAEYASRIMNGIRLYGKPIRVNKASADKQKAVEIGAELF
FT                   VGNLDPLVTEQVLYDTFSRFGTLVNIPKVARDDNNLSKGYGFVSFADFESSDAAIANMN
FT                   GQYLMNKQVSVQYAYKKDGKGERHGDQAERMLAAQARKHNVRPPTQPLPPQFTNPGTPM
FT                   AAAGVANGDGTQALNAAPPELATGRGIPPPNLGFQNIPSPQPNRQLPPTAPLANPPPGL
FT                   PARPPPSQAGYGGPQTFLPSGFNSAGQQPPFPQQAAPPPGFAPPGFGPPSGTANPPPLP
FT                   PGFQQPGYGGGR"
FT   CDS_pept        join(complement(1247990..1248044),
FT                   complement(1247611..1247930))
FT                   /codon_start=1
FT                   /gene_family="HOG000200514" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265359"
FT                   /orf_name="AFUA_6G05190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85520.1"
FT                   /db_xref="HOGENOM:HBG056707"
FT                   /db_xref="HOGENOM:HBG398785"
FT                   /db_xref="InterPro:IPR018559"
FT                   /db_xref="UniParc:UPI000051E827"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL8"
FT                   /transl_table=1
FT                   /translation="MAYYTLYFLTFAVVICGTALYLTRSRWLPLIPVPDHLYARLPSSF
FT                   AGDLEAGLSSSQFDISSNIADGDTRAGLDNKAKREVQKIMKTQNVNFDEARRIYTERRF
FT                   ATHNIGPDGRPRDPKFVSFS"
FT   CDS_pept        join(1248660..1248715,1248841..1248931,1248998..1249021,
FT                   1249093..1249217,1249308..1249485)
FT                   /codon_start=1
FT                   /gene_family="HOG000200513" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903386"
FT                   /orf_name="AFUA_6G05200"
FT                   /product="60S ribosomal protein L28 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85519.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG349501"
FT                   /db_xref="HOGENOM:HBG621898"
FT                   /db_xref="InterPro:IPR002672"
FT                   /db_xref="UniParc:UPI000051FDA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL9"
FT                   /transl_table=1
FT                   /translation="MAAERTNVSSDLVWQITRNQNAFLVKRRTGGGSQFSRDPLNLQNK
FT                   QSFKYAGYANTKAVGVQATENGGVVVITKKPGNPQQPAKNLVSVSWGPNAATRKIYKAV
FT                   ASKTAKNGYRADLREDAVARVSAIRRSQKPKKDAAPKKLRGAQARKAAEQKSE"
FT   CDS_pept        join(1250905..1250917,1250984..1251015,1251093..1251203,
FT                   1251270..1251357,1251425..1251802,1251860..1251944,
FT                   1251997..1252141,1252205..1252345)
FT                   /codon_start=1
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265360"
FT                   /orf_name="AFUA_6G05210"
FT                   /product="Malate dehydrogenase, NAD-dependent "
FT                   /EC_number="1.1.1.37"
FT                   /function="L-malate dehydrogenase activity"
FT                   /function="binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85518.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG242477"
FT                   /db_xref="HOGENOM:HBG566126"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniParc:UPI000051E5C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDM0"
FT                   /transl_table=1
FT                   /translation="MVKAAVLGASGGIGQPLSLLLKACPLVDELALYDVVNTPGVAADL
FT                   SHISSVAKVSGYLPKDDGLKNALTGTDIVVIPAGIPRKPGMTRDDLFKVNAGIVRDLVT
FT                   GIAQYCPKAFVLIISNPVNSTVPIAAEVLKKQGVFDPKRLFGVTTLDIVRAETFTQEYS
FT                   GQKDPSKVQIPVVGGHSGETIVPLFSKASPALDIPADKYDALVNRVQFGGDEVVKAKDG
FT                   AGSATLSMAYAGFRFAEKVIRASQGQSGIVEPTYIYLRGVTGGEEIANETGVEFFSTLV
FT                   ELGRNGAEKAINILQGVTEQEKKLLEACTKGLKGNIEKGIEFVKNTPPK"
FT   CDS_pept        join(complement(1253390..1253619),
FT                   complement(1253127..1253244),complement(1252942..1253031),
FT                   complement(1252751..1252882))
FT                   /codon_start=1
FT                   /gene_family="HOG000200502" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265361"
FT                   /orf_name="AFUA_6G05220"
FT                   /product="BET3 family protein"
FT                   /function="guanylate cyclase activity"
FT                   /function="heme binding"
FT                   /protein_id="EAL85517.1"
FT                   /db_xref="GO:0004383"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG119157"
FT                   /db_xref="HOGENOM:HBG619271"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="UniParc:UPI000051EF0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDM1"
FT                   /transl_table=1
FT                   /translation="MSFDASVSSINTSDPHARFLSTSCLDFLLIELVPMAERLTRELAL
FT                   NDKALDDDEIRESTFFRLESIGYRVGQGLAERFSRDRPRFTDNLDVIKFLCKDLWTILF
FT                   KKQVDNLKTNHRGVYVLTDNSFRPFARMSMASRSEATAMAQAFLWFPCGIIRGALSNMG
FT                   IATTVQAETSELPGATFQIKTVQPRP"
FT   CDS_pept        join(complement(1256040..1256187),
FT                   complement(1255727..1255945),complement(1255604..1255675),
FT                   complement(1255231..1255547),complement(1255039..1255144),
FT                   complement(1254761..1254986),complement(1254200..1254710))
FT                   /codon_start=1
FT                   /gene_family="HOG000200481" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751329"
FT                   /orf_name="AFUA_6G05240"
FT                   /product="SUMO ligase SizA, putative "
FT                   /function="ligase activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL85515.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG056673"
FT                   /db_xref="HOGENOM:HBG328171"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0000520218"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDM3"
FT                   /transl_table=1
FT                   /translation="MASAVQSSELQSIVALIKTLTNAQLKDILRSEGLAVSGVKASLQL
FT                   RIIDYIERLNQGGHTERYDNLRRFIYATAHRAMPGTSTTQQPLPSQPYHASHITQSIQT
FT                   QHRPTPLTIPMSSHGFTPGRISFKDSPFYTILEQLTPTVECKIREQTRDNVELKVVLTP
FT                   TVASRLQADPNLRVMVYCAADSGLNQYTKSDIAFPHQVELKANLDEVKANLKGLKNKPG
FT                   TTRPADVTNYIRKKPGYPNHIVMTYALTQKRFFVLVNLVQRHPVEDLVLELKRRKTITK
FT                   EQVLREMKNRAEDSDIVATSTVMSLKCPLSTLRIEVPCRTVVCTHNQCFDASSFLQLQE
FT                   QAPTWSCPVCSKATSYESLQIDQYVDDILHSTSPDVEQVIIEPDGKWSSPKEDEFKGTG
FT                   GVTPATEDEDELIEIKEPGIVRVKQESLPASGLSLERTPAQSREPSATSSAARLSTNKR
FT                   SAAQVIDLTGSDDDDGDFSPVRPAKRLASNAPHRAYVRPAFRNSFSSGLVNGGNFSTTN
FT                   QTNSESPRHTGGLDA"
FT   CDS_pept        join(1256629..1256812,1256974..1257167)
FT                   /codon_start=1
FT                   /gene_family="HOG000200470" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903387"
FT                   /orf_name="AFUA_6G05250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85514.1"
FT                   /db_xref="HOGENOM:HBG056665"
FT                   /db_xref="InterPro:IPR019434"
FT                   /db_xref="UniParc:UPI0000520461"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDM4"
FT                   /transl_table=1
FT                   /translation="MAKSVRASVTKRNRAKLRATVFGPAADARTERLSAKLKELASQPI
FT                   IREHKSSSMELDSTGTEIKSPRNHIADIGVLLDMDVDTMSVKHTQSRSKKPGRVQKRKK
FT                   ARSSIVFQTHPLKTKKGSRRK"
FT   CDS_pept        join(1258248..1258447,1258507..1258551,1258622..1258910,
FT                   1258974..1259101,1259154..1259524,1259592..1259709,
FT                   1259824..1260132,1260199..1260505,1260693..1261229)
FT                   /codon_start=1
FT                   /gene_family="HOG000200459" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI18207958"
FT                   /gene_name="las21"
FT                   /gene_synonym="gpi7"
FT                   /orf_name="AFUA_6G05260"
FT                   /product="GPI ethanolamine phosphate transferase 2 "
FT                   /EC_number="2.-.-.-"
FT                   /function="transferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85513.1"
FT                   /db_xref="EMBL:ABD84045.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG114816"
FT                   /db_xref="HOGENOM:HBG328034"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI000051ECA9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDM5"
FT                   /transl_table=1
FT                   /translation="MAFKGEHRAILIANILIVVAISIFSSGFFPYKSLLPGLATFAETN
FT                   IGTVAPKVFDRVIFMVIDALRSDFVYSKTSGFSFTQSLIRSGAALPFTAHASSPTVTMP
FT                   RLKAMTTGSVPSFLDVILNIAESDTSSTLAYQDTWLAQIKAQGGQLVMYGDDTWIKLFP
FT                   GVFDRCDGTTSFFVSDFTEVDHNVTRHVPRELSERDWSAFIMHFLGLDHIGHKAGPKSR
FT                   HMMTKQREMDSIVALIYAAMEEQEHLQSTLFVLCGDHGMNDAGNHGGSSPGEISPALLF
FT                   ISPKFQTKTTPEDSPVEAFSDLQYYRTVEQVDITPTLAGLLGLPIPLNSLGVFIPEFLM
FT                   MWDNDAHRIDILLRNAKQMLSAMKGTFPDLDVEAITPPHGCDKHVLRSAQDVMSSTASK
FT                   YNTTRLYLGLFVAALAVLLSFFPAYGLGSKYSYAVTFLMLIIISYGGMMFASSYVEEEQ
FT                   QFWYWVVTAWTVYLHIKSLRPWHGSKDTRRWNQTGQKFAAEPDIARDFFPRHQNILWAL
FT                   IILTYFDTCMHLCLNSHSSNIWRSAAILTTIAAFFFKLVFVASDSPELLYESLLSPIQK
FT                   SLEEMPLVPPARLSKAVNIPIFLMFRLQAIILDFLKMSAIEVTLTSLLSQNMTFFAFGG
FT                   SNAISSVDLSNAYNGIGSYSVVLVGVLTFISNWAGPIWWASAARLLYSNPTFAERYGQR
FT                   TLLTFHAATSLMSVMAACTMLRTHLFIWTVFSPKYLYTLAWTILNHMFINLPATANVSQ
FT                   VLNWQYAFHSVACR"
FT   CDS_pept        join(complement(1261801..1262015),
FT                   complement(1261342..1261714))
FT                   /codon_start=1
FT                   /gene_family="HOG000217815" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265362"
FT                   /orf_name="AFUA_6G05270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85512.1"
FT                   /db_xref="HOGENOM:HBG056654"
FT                   /db_xref="UniParc:UPI000051FDB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDM6"
FT                   /transl_table=1
FT                   /translation="MDVKEIIALHSLLHLVFHRNKNQHGNTKWWKWLSILKRITLKLAK
FT                   SLETDAFHTVRLYKEHLALHVIPNCYLAFSRVIADGQFSTIGIVLIAALARLTKATGID
FT                   KEMNSLRGKKMAFRPSTCLKNLQQEDVGEVVSRLSESFIPLPSFQSGKQAGSEEPNSHQ
FT                   REAKETATVAVKPSGQKKRKKNAIDDLFNGVL"
FT   CDS_pept        join(complement(1265604..1265791),
FT                   complement(1265181..1265556),complement(1264695..1265129),
FT                   complement(1264227..1264589),complement(1264135..1264170),
FT                   complement(1263942..1264084),complement(1263846..1263876),
FT                   complement(1263770..1263787),complement(1263691..1263719),
FT                   complement(1263593..1263636),complement(1263460..1263539),
FT                   complement(1263296..1263401),complement(1263009..1263238))
FT                   /codon_start=1
FT                   /gene_family="HOG000200448" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903388"
FT                   /orf_name="AFUA_6G05280"
FT                   /product="Meiosis protein MEI2, putative "
FT                   /function="nucleotide binding"
FT                   /protein_id="EAL85511.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG056646"
FT                   /db_xref="HOGENOM:HBG325109"
FT                   /db_xref="InterPro:IPR007201"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000F51CCD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDM7"
FT                   /transl_table=1
FT                   /translation="MRANNSSRGLSSPCSTNDGISLNGSPDTKLTAFSPEDVRSKGRPE
FT                   TSVATSLGDAGFCRLYTARPADPFLVPLNTSNSGQLSPHAASFTPIGIAGSAASDIQVR
FT                   GRSEIGSLNAQANVEICGARNGPGGVYEQGLPNYGPIGRAPITQKGCPTGIFAGNFDND
FT                   RRSRAFVIENVPASLNFMSLAGFFNRREFATLKGPVLNELSSLGKVYVAFADSREAKKA
FT                   IEKVRLLRPEWRIFPLTAKEYVQHSEPSLLHQTSDYEGHLLVSMYYDSRNPTFNSHTVA
FT                   RSLQTLATTFGDLKAFDLLPRGQDNVSEFHLEFYNTRDADNAMVTLNGTTVDDCILDIT
FT                   LFKPDVTEDRPFNVLPSLSPVKDGGSRNGTSYHRSSPSAPTRPFRTPYMELSPTGRSIV
FT                   PSGEHVGLMDWMSRAGEKNLHSPRREISRYPDARVISQNAVDIERIRLGLDVRTTIMLR
FT                   NIPNKIDQTMLKAIVDETSHGKYDFMYLRIGEKLHSLFDCKMKLTLNFIDFANNCNVGY
FT                   AFINFEDPIDIIDFVKTRAGRSWNCFNSDKVAEVSYATIQGKDCLIQKFRNSSVMLEHP
FT                   SFRPKIFHTGTGPLAGTEDRFPGPDNPSKMRRSIENAEHIGLFAPRVGQQYRDEQRRRR
FT                   SQFDRGTTAAEREIVYVQTIAAHPFGVNNGLRSAPCTYPTSTIWYDPTISARGPRTS"
FT   CDS_pept        join(1267138..1267188,1267244..1268236,1268292..1268423,
FT                   1268495..1268596,1268646..1268753,1268811..1268882,
FT                   1268999..1269448,1269505..1269755,1269812..1269890)
FT                   /codon_start=1
FT                   /gene_family="HOG000200437" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265363"
FT                   /orf_name="AFUA_6G05290"
FT                   /product="Exocyst complex component Sec15, putative "
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /cellular_component="exocyst"
FT                   /protein_id="EAL85510.1"
FT                   /db_xref="GO:0000145"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG056638"
FT                   /db_xref="InterPro:IPR007225"
FT                   /db_xref="UniParc:UPI000051FDAD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDM8"
FT                   /transl_table=1
FT                   /translation="MPSMLSSRSEPSHVLNSIIISPSDTDYIDQLIPSIREYSVSNRTS
FT                   QLLQSLSKFASDKEAEIETICNTNHQEFVSSINHLLRIREGTVSLTAEILDLNQSIQAS
FT                   TERLAEQKKALVESRSHRQNIDETSRAIQDCLEVLRLANQVHDLLAKKNHYAALRALEE
FT                   LQNVHLKDVTQYKIADMIQRSVPATQRAIAEAVLSDLNTWLYRIREMSQFLGEIALYHT
FT                   ECRKTRLKERAEKLPYLRHFKLNSAIELVSDEHEEYDLLQNEELQVDFTPLFECLHIHQ
FT                   SLGQMDKFRTEYANTRRRQKELLIPSTITLVDEDGASLHNLLEEMAGFAIVERATMKRV
FT                   PDLRSSVDVDELWDSMCQTAVGLISKALPEVDNAESLLKIKNLIALFMQTMNTWDFSVG
FT                   KFDELLLTLFKRYAELLKKRFSDDFQEIVSTDDYMPMPIQSLDEYDKVLNVSWYNPEKP
FT                   REEQVSMCSAFFSDVSLVLHRHPQLLKPALDELLSNQVCDTLVERLSSQYLGQIVQILI
FT                   NLEHFESACRELEELLAAARSQGAAGGPISLRATEKFRSNKKAAEKRIFEVVNSKIDDL
FT                   IETAEYDWMALTPPTEPSNYMQTLTRFLSNIMNSTLLGLPTEIKELIYFDALSHAANMI
FT                   LAQPLSSDVKSINPNGVMALAKDVEYLFQFVDSLGVPILRENLDELQQTVHLMQADNTD
FT                   EFYDISTRNKKYGRVDAINGPILLEKLTRTVQSSGKIDKFTTLSSRFGKKS"
FT   CDS_pept        join(complement(1271163..1271244),
FT                   complement(1271074..1271087),complement(1270949..1271005),
FT                   complement(1270239..1270901))
FT                   /codon_start=1
FT                   /gene_family="HOG000200436" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903389"
FT                   /orf_name="AFUA_6G05300"
FT                   /product="CCAAT-binding factor complex subunit HapE "
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85509.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="HOGENOM:HBG748837"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000520210"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDM9"
FT                   /transl_table=1
FT                   /translation="MEQSSQSTAQQQGRQQPVYDTRNGGHYGASAALSAQGYAPVAELY
FT                   TGTWANVNQGLQGTARDILTTYWQHIINHLESDNHDYKIHQLPLARIKKVMKADPEVKM
FT                   ISAEAPILFAKGCDIFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVP
FT                   REEATSHAKRSSQTTAGAAGSSAATGAQLPPSQHGVQHPPHHMGPPDYGSLGQHGMGQD
FT                   QEYRQPTMYGGAVQSDPTAAYGQPQSQIFEGMYNPYPHLPPQQVCQNSS"
FT   CDS_pept        join(1272227..1272405,1272464..1272635,1272847..1273221)
FT                   /codon_start=1
FT                   /gene_family="HOG000200415" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903390"
FT                   /orf_name="AFUA_6G05310"
FT                   /product="Nucleolus protein required for cell viability,
FT                   putative"
FT                   /protein_id="EAL85508.1"
FT                   /db_xref="HOGENOM:HBG059610"
FT                   /db_xref="InterPro:IPR014810"
FT                   /db_xref="UniParc:UPI000051F66A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDN0"
FT                   /transl_table=1
FT                   /translation="MQVEACGKVALHSIEEGALNDHDIEQLLYEAESRLQTCKVQPIST
FT                   SQDQAIGHSGKPFLNIPKLATDSSLQSYIAQRDDVALADTKRIIDPLQMNLSNKRLATV
FT                   KIQQASVNSSTQKEKPTAGADWFHLPKTELTTELKRDLQLIRMRSVLDPKRHYKKESGK
FT                   AQPPKYSQLGTIIEGPTEFFSGRIAKKDRKKTFVEDVLALERETKRFASKYREIQISKQ
FT                   SGKRSFYSNLRAKRNRQKK"
FT   CDS_pept        join(complement(1274540..1274750),
FT                   complement(1274406..1274484),complement(1274254..1274333),
FT                   complement(1274128..1274192),complement(1273861..1274063),
FT                   complement(1273520..1273799),complement(1273423..1273467))
FT                   /codon_start=1
FT                   /gene_family="HOG000045183" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265364"
FT                   /orf_name="AFUA_6G05320"
FT                   /product="Purine nucleoside phosphorylase I, inosine and
FT                   guanosine-specific"
FT                   /EC_number="2.4.2.1"
FT                   /function="purine-nucleoside phosphorylase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="EAL85507.1"
FT                   /db_xref="GO:0004731"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG205650"
FT                   /db_xref="HOGENOM:HBG292914"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001369"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="UniParc:UPI000051EF0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDN1"
FT                   /transl_table=1
FT                   /translation="MLPEAPKNKSLYEEAVEAFSFLKERLPETLQHPRVAVICGSGLGG
FT                   LANTIHDEPRAEFEYSSIPHFPCLTVPGHAGKLVFGLLADHIPVVLMVGRAHYYEGHSI
FT                   HQVTFPIRVFKLLGIETIVLTNAAGGLNTEYAVGDIVIINDHIFPAGFAGTHPLRGPNT
FT                   EEFGPRFPPLSDAYDLELRRHAHQAWKAVISENSTRRLHEGVYAFVAGPSYETRAECRM
FT                   LRQVGADLVGMSTVPEIIVARHCGIRVLAFSLVTNKAVLSPVPRGDDHLLQAKDVKELD
FT                   SILQEGKANHEEVLEAGRTAAIDMQKLVVRVISNVHGRR"
FT   CDS_pept        join(1276031..1276083,1276146..1276570,1276649..1276824)
FT                   /codon_start=1
FT                   /gene_family="HOG000217816" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265365"
FT                   /orf_name="AFUA_6G05330"
FT                   /product="37 ribosomal protein Rsm10, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85506.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG056608"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="UniParc:UPI0000F51CDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDN2"
FT                   /transl_table=1
FT                   /translation="MLRSKNSAPSSGSGVKEWSERLDSVGQKARLPRSVQALYLRPLRR
FT                   KPEFGLPVCDLQLRSYSVRNLEFFADFALRAAYYLELPVSGPVPLPRIVERWTFPRSNF
FT                   VHKKSQENFERITLRRLIQIKDGHPQAVQAWLAFLRKHAFYGVGMKANVWDHESLDVAR
FT                   NMDESLPDIEKSLEPYLSHFGYRSDGSDQSAVFDLLESERFTHNKSPLTDIRKG"
FT   CDS_pept        join(1277161..1277568,1277617..1277697,1277765..1277880,
FT                   1277930..1278048,1278110..1278561)
FT                   /codon_start=1
FT                   /gene_family="HOG000059940" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207959"
FT                   /orf_name="AFUA_6G05340"
FT                   /product="Tryptophanyl-tRNA synthetase, putative "
FT                   /EC_number="6.1.1.2"
FT                   /function="ATP binding"
FT                   /function="tryptophan-tRNA ligase activity"
FT                   /biological_process="tryptophanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85505.1"
FT                   /db_xref="GO:0004830"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006436"
FT                   /db_xref="HOGENOM:HBG003090"
FT                   /db_xref="HOGENOM:HBG293263"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI000051EA5E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDN3"
FT                   /transl_table=1
FT                   /translation="MQRSNCHSSQVVRILRGARRPRIRAGKPVTSREVFRRWSSSETAK
FT                   SSSAANQTIFSGIQPTGVPHLGNYLGALREWVRLQNAAKEGTRLFFSIVDLHALTVPQD
FT                   ASQLRNWRKETFATLIAVGLDPNRSTIFYQSAVHAHAELFWILCTIASMGYLSRMTQWK
FT                   SKLQLPDNANLEDSTARSRLRLGLFSYPVLQAADILVHRATHVPVGDDQRQHLEFSRNT
FT                   ANSFNHVYGPIFPSPEAIISPAKRVMSLKEPTLKMSKSHADRRSRIILTDSPAEISKKI
FT                   NAALTDSELTITYDPVRRPGVANLIEILSHFDGRTCDEIAMEYRSASLRALKEHLARTL
FT                   SNHLEPIREKYLSLVGDQTDYLDSIAEQGSEAARANAELTMEQVKVAMGLI"
FT   CDS_pept        join(1280046..1280240,1280310..1280628,1280724..1281667)
FT                   /codon_start=1
FT                   /gene_family="HOG000159040" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265366"
FT                   /gene_name="opsB"
FT                   /orf_name="AFUA_6G05350"
FT                   /product="Probable aspartic-type endopeptidase opsB "
FT                   /EC_number="3.4.23.-"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="pathogenesis"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="anchored to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="EAL85504.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0009405"
FT                   /db_xref="GO:0031225"
FT                   /db_xref="HOGENOM:HBG056590"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000051EF09"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDN4"
FT                   /transl_table=1
FT                   /translation="MRHIFSLLSIVCLMVKHGACLTLHQRDVPAVVSLDIKRSIVSDPV
FT                   VRDRVRRKRDKTIGQTLDNAETLYFCNVTLGTPGQALRLVLDTGSSDLWCNAANSTLCS
FT                   DSNDSCNISGSYDPSSSSTYAYVSSDFNISYADGTGAVGDYATDILHIGGSTLRNLQFG
FT                   IGYSSTSSEGVLGIGYPSNEVQVGQYGKDTYPNLPRAMVDQGLINSNAYSLWLNDLESN
FT                   TGSILFGGVNTGKYLGELQTLPIQKVNGRYSEFVIALTGVAFDSESHHKTYSSDALPAA
FT                   VLLDSGSSLTYLPDSIVENIYRDLNVAYEPSSGVGYLPCKLAGNNINITYTFSSPNITV
FT                   MIDELLLDAGDLRFRDGARACIFGIVPAGDSTAVLGDTFLRSAYVVYDIANNEISIANT
FT                   NFNSTEDNILEIGVGPDSVPSATQVSHPVTSVVADGSGARIGAPTGASSTTVPSISSAG
FT                   ALSAGVARADKQYLAIALIAVWFVLGL"
FT   sig_peptide     1280046..1280105
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDN4 "
FT   mat_peptide     join(1280106..1280240,1280310..1280628,1280724..1281592)
FT                   /product="Probable aspartic-type endopeptidase opsB "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDN4 "
FT   pro_peptide     1281593..1281664
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDN4 "
FT   mobile_element  complement(1287412..1288185)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(1288790..1289212)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   gap             1293624..1318623
FT                   /estimated_length="25000"
FT   mobile_element  1321584..1322354
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  1322369..1322836
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(1330286..1331515)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   CDS_pept        join(complement(1334553..1334658),
FT                   complement(1334305..1334495))
FT                   /codon_start=1
FT                   /gene_family="HOG000223542" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056666"
FT                   /gene_name="lsm6"
FT                   /orf_name="AFUA_6G06325"
FT                   /product="U6 snRNA-associated Sm-like protein LSm6 "
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="EAL88484.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="HSSP:1N9R"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000051E9B3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNI0"
FT                   /transl_table=1
FT                   /translation="MENSSSSEGRDPSAFLGEIIGAPVTVKLNSGVVYKGELQSVDGYM
FT                   NIALERSEEFVDGKLKRSYGDAFIRGNNGLSCIQSFLDPPSILMNLVLYISAQ"
FT   CDS_pept        1335190..1336404
FT                   /codon_start=1
FT                   /gene_family="HOG000181631" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207961"
FT                   /orf_name="AFUA_6G06328"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27349.1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="UniParc:UPI0000F51965"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Q0"
FT                   /transl_table=1
FT                   /translation="MRSFFKRPSWASKGDEPVTSDFYRRAGQVYDDIITTNREAREKSV
FT                   CANKPAAEDGRARKRRHLLDDGSLEGSTSLGLDNSFKHNSLSKSRQRCAPSMLTPSSCN
FT                   TLADESMDSGLQKPATTYSGGLAISRNVHQDRDSEFTLLTSDQRCKMNIDDSSQSKMER
FT                   NSKSINDNERLHHQTQARCQKKATDASIRQCSGPRSEDVTVQILITSPIEGTKPLIIHR
FT                   KMSQSLRDVRLAWCKRQDLSPALQASIYLTWKGRRLFDVTTCRSLGLNTSETPTGDEDI
FT                   DKFSQIDGEPLRIHMEAVTDKLAAPDTHQLLPVLGSQSNLNEGSDQKHLMRLVYKCPGF
FT                   DKFETKVASNAPVSQAIAAFRLAKRIPSERKIHLVFDGDCLDPNACFTDYDITDDDLVD
FT                   VLIKY"
FT   CDS_pept        join(1336683..1336868,1336922..1337152)
FT                   /codon_start=1
FT                   /gene_family="HOG000181652" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207962"
FT                   /orf_name="AFUA_6G06330"
FT                   /product="AdoMet-dependent tRNA methyltransferase (MTase)
FT                   complex subunit Trm112, putative"
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL88485.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG011422"
FT                   /db_xref="HOGENOM:HBG526194"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniParc:UPI0000520183"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNH9"
FT                   /transl_table=1
FT                   /translation="MKLVTANFLTCAVKGCKTSSASFPLHFQDAELELEELDFQPEFIR
FT                   NIIPRVDWDGLRVTANELGFSNLPEKKPEGEALNDEQTLKDLHRLLLETHVIEGKLVCG
FT                   NCGHEYLIKEGIANFLLPSHLGLGLPDRIYIVAC"
FT   CDS_pept        join(complement(1337864..1341485),
FT                   complement(1337700..1337803))
FT                   /codon_start=1
FT                   /gene_family="HOG000181654" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207963"
FT                   /gene_name="set1"
FT                   /orf_name="AFUA_6G06335"
FT                   /product="Histone-lysine N-methyltransferase, H3 lysine-4
FT                   specific"
FT                   /EC_number="2.1.1.43"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /cellular_component="Set1C/COMPASS complex"
FT                   /cellular_component="chromosome"
FT                   /protein_id="EAL88486.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="GO:0048188"
FT                   /db_xref="HOGENOM:HBG056384"
FT                   /db_xref="HOGENOM:HBG395496"
FT                   /db_xref="HSSP:1PEG"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR015722"
FT                   /db_xref="InterPro:IPR017111"
FT                   /db_xref="UniParc:UPI000051E9B4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNH8"
FT                   /transl_table=1
FT                   /translation="MSRTSAGFADFFPTAPSVLQQKRVRAPRDRPCPKDRPEDQLHVQD
FT                   DNGQSSCSPGTSAANVSTNGSPPSVSVSETGTGVENSGCKLVGETNTDITGTDTSILSA
FT                   SLAQCRATQVNEARFDNLTPVTNAESSPPRKLSPHQSKSVEVAEYESNKFATDESKLAA
FT                   TPLHTPPTPRSQTSRSGVIKGCKLVYDPDLEKRSSKEKRRKPQYVDFVVNEQDGCSPDP
FT                   RLSILNYTRGAGCKQKTKYRPAPYRLKQWPYDTATTIGPGPPVQIVVTGFDPLTPVAPI
FT                   NALFSSFGEISEINNRTDPITGRFLGVCSVKYKDSTSFRGAGPVPAATAARRAYVECKK
FT                   EQRIGTRRIRVELDRDGAVSDRIVARAIESQRMGHKKNIVGEEAKVEPQAKKNEPPPTA
FT                   PKGPSRSSTRPVAAVPEGPRASFLKPAIPSLIEETPILAQIKRDPYIFIAHCYVPVLST
FT                   TIPHLKKRLKLFDWKDIRCDKTGYYIIFENSRRGEEETERCFKVCHMKPLFTYIMNMES
FT                   QPYGNPNYERSPSPERLQAERRERAERERLKKEADLDLEEEKKQRAIDLDPCREVLALI
FT                   VRDLKDKLLEDVKSRIAAPTLYDYLDPDRHAARRRALGIPDPEGIRRHTFRLDADNFGS
FT                   NNPRSFLPGDRSFSPYGLNILALPRIRKARRLNRANAAFLDERRKQPVRRKEVRPLYHR
FT                   LQQLHDVDDSDEDQRTPFSRDIDEQDSRPPSRMSSRSSISDDGEESEPLDGLAPQGKRH
FT                   ESRLLGLEYEDSGNTLNEAVDGYSRHDSPGLSSTRKRKRVAEGIDVRKRPKEESERSQL
FT                   NRSVEAGDTFYEESQHSEAAELGTVKPENLAGIGGKFLGRVEDRSINEDGEKENMERLH
FT                   IESAIQGANLGIQQPLPDESTTTKSHEDPITEIEWGVSNDEPRPTVVDDETIILDLDGW
FT                   QNLVKDEEDLCFLRHVLDGQSRSKVGNLSAWAWRQKEIKALNRAGESGPVHQETRIPDY
FT                   YVCNPTGAARTEGRKRILESEKSKYLPHRIKVQKAREEREANAKSDPHASSAAEAARIS
FT                   AAKTISKSTSRSTRVNNRRLVADINAQKQALPMQGGDGDVLRFNQLKKRKKPVRFARSA
FT                   IHNWGLYAEENISANDMIIEYVGEKVRQQVADMRERQYLKSGIGSSYLFRIDENTVIDA
FT                   TKRGGIARFINHSCTPNCTAKIIKVDGSKRIVIYALRDIGRDEELTYDYKFEREWDSDD
FT                   RIPCLCGSTGCKGFLN"
FT   CDS_pept        join(1344619..1344623,1344695..1344765,1344819..1345050,
FT                   1345147..1346540,1346599..1346760,1346815..1347035)
FT                   /codon_start=1
FT                   /gene_family="HOG000258898" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI16265367"
FT                   /orf_name="AFUA_6G06340"
FT                   /product="Glucosamine-fructose-6-phosphate aminotransferase"
FT                   /function="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing) activity"
FT                   /function="sugar binding"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL88487.1"
FT                   /db_xref="EMBL:AAT44964.1"
FT                   /db_xref="GO:0004360"
FT                   /db_xref="GO:0005529"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="HOGENOM:HBG409912"
FT                   /db_xref="HOGENOM:HBG645312"
FT                   /db_xref="HSSP:1JXA"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI00003B02CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6J9U0"
FT                   /transl_table=1
FT                   /translation="MCGIFGYINYLVERDRKYIIDTLLNGLSRLEYRGYDSAGFAVDGD
FT                   KKNEVCAFKEVGKVAKLKELIEESKPDMTKTFESHAGIAHTRWATHGTPSRQNCHPHRS
FT                   DPNWEFAVVHNGIITNYKELKALLESKGFRFETETDTECIAKLAKYLYDQQPDIEFTVL
FT                   AKAVVKELAGAFGLLIKSVHYPHEVIAARKGSPLVIGVRTSKKMKVDFVDVEYSEDGPL
FT                   PAEQASQNVAIKKSATGLLAPPDKSLLHRSQSRAFLSDDGIPQPAEFFLSSDPSAIVEH
FT                   TKKVLYLEDDDIAHVHEGQLNIHRLTKDDGTSNVRAIQTIELELQEIMKGKFDHFMQKE
FT                   IFEQPESVVNTMRGRLDVANKQVTLGGLRQYISTIRRCRRIIFIACGTSYHSCMAVRGV
FT                   FEELTEIPISVELASDFLDRQAPVFRDDTCVFVSQSGETADSLMALRYCLERGALTVGI
FT                   VNVVGSSISLLTHCGVHINAGPEIGVASTKAYTSQFVAMVMFALSLSEDRASKQKRREE
FT                   IMDGLSKISGQFREILKLNEPIKQMCAKFFKDQKSLLLLGRGSQFPTALEGALKIKEIS
FT                   YLHCEAVMSGELKHGVLALVDENLPIIMILTRDNIFSKSLNAYQQVIARGGRPIVICNH
FT                   DDPEFSSAQTEKIEVPKTVDCLQGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE
FT                   "
FT   CDS_pept        join(1347719..1347843,1347936..1348344)
FT                   /codon_start=1
FT                   /gene_family="HOG000229253" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207964"
FT                   /orf_name="AFUA_6G06345"
FT                   /product="DMRL synthase family protein "
FT                   /function="riboflavin synthase activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /cellular_component="riboflavin synthase complex "
FT                   /protein_id="EAL88488.1"
FT                   /db_xref="GO:0004746"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="GO:0009349"
FT                   /db_xref="HOGENOM:HBG311126"
FT                   /db_xref="HOGENOM:HBG408416"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="UniParc:UPI00005208A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNH6"
FT                   /transl_table=1
FT                   /translation="MAIIQPLVEGAKKSLLAAGVLEEDITLETVPGSYELPFAAQRIYT
FT                   ASQLQAAKGSSSAGGISATDLLSSSTADLSKTSPTSTAAKPFDAIIAIGVLIKGETMHF
FT                   EYIADAVSHGLMRVQLDTGVPVIFGVLTVLTEEQGLERAGLGKKGMHNHGEDWGKAAVE
FT                   LGLKRRDWVEGKIV"
FT   CDS_pept        join(complement(1349366..1349533),
FT                   complement(1348948..1349274),complement(1348557..1348898))
FT                   /codon_start=1
FT                   /gene_family="HOG000091086" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207965"
FT                   /orf_name="AFUA_6G06350"
FT                   /product="Proteasome subunit alpha type 3, putative "
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="EAL88489.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000051F5C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNH5"
FT                   /transl_table=1
FT                   /translation="MLQVEYAVKAVENGGTAIGIRCKDGVVLAVEKIVTSKLLKPGANK
FT                   RIATVDRHVGIVSAGLVPDGRHFVSRARDEASSWRSVYKGPIPISALANRLGSYVQAYT
FT                   LYSSVRPFGVTAIVGGWDSETELAVDGQVGTGPASGSGGKTSDAKVGGPGLYMIEPSGL
FT                   YWGYYGAATGKGRQAAKAELEKLDLASEKLTLLEAVREAARIIYVAHEDSKDKEFELEM
FT                   SWISSLDGPTKGKHEAVPRELLEEAEKAAKRALEGEDEDEEETTKNDGNGGERMEE"
FT   mobile_element  1352532..1354862
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  1357276..1358253
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  complement(1359232..1360296)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   mobile_element  1360879..1362009
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        complement(1366023..1366331)
FT                   /codon_start=1
FT                   /gene_family="HOG000181665" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903391"
FT                   /orf_name="AFUA_6G06360"
FT                   /product="Mating alpha-pheromone PpgA "
FT                   /protein_id="EAL88490.1"
FT                   /db_xref="HOGENOM:HBG056385"
FT                   /db_xref="UniParc:UPI00005203B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNH4"
FT                   /transl_table=1
FT                   /translation="MKLLSLVLASFAAAAVQAHITPWCHLPGQGCYMLKRAADASDEVR
FT                   RSASAVAEAVAEAFPQSPWCHLPGQGCAKAKRAAEAAEEVKRSADAFAEAMAAFEKE"
FT   CDS_pept        join(1367479..1367745,1367816..1367924,1367975..1368878,
FT                   1368939..1369026)
FT                   /codon_start=1
FT                   /gene_family="HOG000021113" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056667"
FT                   /orf_name="AFUA_6G06370"
FT                   /product="NAD(+)-isocitrate dehydrogenase subunit I "
FT                   /EC_number="1.1.1.41"
FT                   /function="NAD or NADH binding"
FT                   /function="isocitrate dehydrogenase (NAD+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="EAL88491.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004449"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG435977"
FT                   /db_xref="HOGENOM:HBG518924"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI000051FAC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNH3"
FT                   /transl_table=1
FT                   /translation="MFSLRTAQPAQVSKTLHQIDCVTRGRAFSHFLSHFSLLRPAAASQ
FT                   QLSHSQCLDVMFLCIKANVLLLCRLSYAAQLVQALSSTPRSQQDLLLACSLTSSSPRSM
FT                   AESTPLLSFQVPMAHPKPCPECDGIGAEVAESVKTIFKADNVPIEWEQVDVSGVDTGNK
FT                   HSEELFKESIASLRRNKLGLKGILFTPVERSGHQSFNVALRQELDIFASIVLIKNIPGY
FT                   KTRHENVDLCIIRENTEGEYSGLEHQSVQGVVESLKIITRAKSERIAKFAFGFALANNR
FT                   KKVTCIHKANIMKLADGLFRSTFHKVAEMYPTLEVNDMIVDNASMQAVSRPQQFDVMVM
FT                   PNLYGGILSNVGAALVGGPGVVPGCNMGRDVAVFEPGCRHVGLDIKGKDQANPSAMILS
FT                   GSMLLRHLGLDDHANRISKAVYDVIGEGKTRTRDMGGQATTHEFTRAVLDKMEAAL"
FT   CDS_pept        complement(1369717..1370454)
FT                   /codon_start=1
FT                   /gene_family="HOG000111527" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265368"
FT                   /orf_name="AFUA_6G06380"
FT                   /product="Methyltransferase, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL88492.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG444343"
FT                   /db_xref="HOGENOM:HBG491094"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR022238"
FT                   /db_xref="UniParc:UPI000052087A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNH2"
FT                   /transl_table=1
FT                   /translation="MTHRALELLDLRSPSLILDVGCGSGLSGEILSQVPPQQGGPHTWV
FT                   GMDISPSMLDVALQRDVEGDLLLADIGQGVPFRPGTFDAAISISAIQWLCNAETSDVSP
FT                   EGRLRRFFEGLYSSLRRGGRAVCQFYPKNDAQRAMISGAAVRAGFGAGILEDDPGTKNA
FT                   KLYLVLTVGGGGLHGDITGVVQGMNDVDILDARKKAAERSKVQPSRKGDKAWILRKKEQ
FT                   MARKGKIVKANSKYTGRKRRPAF"
FT   CDS_pept        1371909..1372097
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903392"
FT                   /orf_name="AFUA_6G06390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88493.1"
FT                   /db_xref="HOGENOM:HBG056386"
FT                   /db_xref="UniParc:UPI000051EE66"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNH1"
FT                   /transl_table=1
FT                   /translation="MGSEYATGEHVPTGGRTRIALSSEGKMKNKGMAKAVVDGVRDWIS
FT                   ENGALMGFWRSERTRRF"
FT   CDS_pept        complement(1372668..1377194)
FT                   /codon_start=1
FT                   /gene_family="HOG000181676" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751330"
FT                   /orf_name="AFUA_6G06400"
FT                   /product="Rho GTPase activator (Bem3), putative "
FT                   /function="GTPase activator activity"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL88494.1"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG056387"
FT                   /db_xref="HOGENOM:HBG329401"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000051EBFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNH0"
FT                   /transl_table=1
FT                   /translation="MSQLRHGSDNNPSLNQPSAVYPVSQQARDAGFPRSPLTGSLIPRD
FT                   YLVTRADAQPLRSGVVAVTDPSKPMPSPLNTSDHCRENRQDNSSVLQSPVSPRSSVKTA
FT                   PPPNHSSTSRIVHAPSPSKPSGSGQESTTSSAGDRVCGDPKQHDRGVIAIANDIGARKL
FT                   SDTGDSVQSPTSSPVSLLDSLQSMSGDRTPGHRIMPRTSSIDSAISSLSSASQPHKSSF
FT                   DASAVSQADIDRLIATAGSTEAVIIHLLKEKHHAASQNAQLWRLVDKQRTLILGLNKDL
FT                   ERALKEKERYKKRAKELQNSIPPVPPTNDHIVQSRSADTSAIPASRDLSKQEQAQGESS
FT                   EAKSTNAGMQDLCDSSVLSPNAKVDRRSPAGADSPRLNTTFDNEFSRPGQIEELDQQSN
FT                   SQSLAYARKEMLSASPTSLASSSSALNETLPSEESQQRLPHPSRKPPPAPLKLGQTQRV
FT                   AMENSGNYDSESDYEDILEVDELPVERGRRKTRDDDDREREAALDKEMGALKATGEEPP
FT                   QTCDPSHLLGKTPTGGLTAGVSKDLWQPISSSSPIERQDSLNSAQNPQKIHAPSLNDQS
FT                   AFAVPKSPGLPLSPRPEDRPIGSPLPRMPREVPNSLAHLPMSSENSLAGLALSPRPTNH
FT                   PNPSATGASKPNDTSPSHIDAHRHIATINHGSRKDTPRSHWSPAREIYQGLMSEDYPGL
FT                   LLPPNALPLIRVKVSSSRLRPSRNSYLAPKPSEEEPVFTLGVFSRSENLELWRVEKVVA
FT                   ALPQLDQQIRQSSALWMKLPDRSIFSGHSPAKIDARRAALNSYFEALLDTPVDERAALA
FT                   ICQFLTMDAIEPRDDESSLLKGNCKAASEVLPGQDRKPQKEGYLAKRGKNFGGWKTRYF
FT                   ILYGPELKYFESPGGPHLGTIKIFNAQIGKQSQPANNTNNPLSGPEDDSENQYRHAFLI
FT                   LEPKRKDSSALVRHVLCAESDEERDAWVEALLAYVDGQSDNEGTENASPQSQVSTQARH
FT                   LSQSTSKPKLFAGGSKKSGKGMNNADADLTDTVQGFSYDDAVPAEPPLLGPPSEKQPPR
FT                   SPMSPLEAAMEPSDTNPASDHVQLSSKVISGPTNGTVIQDAGAWGNKTVTTTKEKKRSI
FT                   WGFRTRSSYDLASQLQASQEPSSAQAVVNPSTERKDLVRPVFGIPLAEAVQHCAPHGID
FT                   VDLPAVVYRCIEYLKAKGAATEEGIFRLSGSNVVVKALKERFNTEGDVDFLAGDEYYDV
FT                   HAVASLFKQYLRELPTTVLTRELHLDFLRVLGACRCFPSFLHLFQGTILIKSYLELDER
FT                   QKKILAFNSLVHRLPRPNLALLRALVQFLIIIINNSDVNKMTIRNVGIVFAPTLNIPAP
FT                   VFSMFLTDFESIFDKMPEGCSEPVELKVDRPALPEDIRSPRHQMFSDLPTPAYSQTTFR
FT                   RPTEVVDDSRHDTGFISIQPTYEQSSHNLVEHYNQQPDSAAMNRMLMPSVDSSRSAKAK
FT                   RRESSMLFMEYNHQDSGLPAMRNDQSKSPPITPELSHRLQTDLRESR"
FT   CDS_pept        join(1380165..1380499,1381079..1381262)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265369"
FT                   /orf_name="AFUA_6G06410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88495.1"
FT                   /db_xref="HOGENOM:HBG056389"
FT                   /db_xref="UniParc:UPI000051EE4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG9"
FT                   /transl_table=1
FT                   /translation="MLLSQSFHRLRTRSSCIHVPCNHRHHTDPHKYIPHTLAPDSVPKS
FT                   IVMCCPAPVSRAGLGTGLVAVSANTATKRVAKPAVALVEGRLDDIDTLRVLLADPDRIG
FT                   IKMPQGGRTCCGLSVDHESCLSTGCIDANMTKVQRLTPDRGIASRLGDITQKVIDEGVK
FT                   EAQLPSGWV"
FT   CDS_pept        join(complement(1384217..1385009),
FT                   complement(1382931..1384156),complement(1382740..1382871))
FT                   /codon_start=1
FT                   /gene_family="HOG000181687" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207966"
FT                   /orf_name="AFUA_6G06420"
FT                   /product="Mitochondrion biogenesis protein (Mdm31),
FT                   putative"
FT                   /biological_process="mitochondrion organization "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL88496.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0007005"
FT                   /db_xref="HOGENOM:HBG056390"
FT                   /db_xref="HOGENOM:HBG737392"
FT                   /db_xref="InterPro:IPR012571"
FT                   /db_xref="UniParc:UPI000051F0F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG8"
FT                   /transl_table=1
FT                   /translation="MSFNFGRRLYTSIWDTAHPLLVRELRNSRMTFFFESPSTGNWFRR
FT                   FLFNTHARKISSLPPRTRHITKRFASGSFFMLGISPSPCAVEAGTSCAISPEKFVSQSH
FT                   LLDRKFVCASLYTWKRGLHTTKDDDGLKSEQSNELLTNDSNTSPSPSRETADSDTRSGT
FT                   MKSQEEHIEGFTSRHIMNRLPHMSHLHRPTKEELLAAANGFWSRLKVRFKWFSIRSVRP
FT                   FNFDEITALFSWVLLGHVVWIVLGTTTFFSLLIIAINTVLAQETLAGWVGNYLTKSSGV
FT                   KVVFESAIVPKWKDGVITFKNVFVSRRPGQGTGHVSKGSSKTAAAVAAAAALSGSSSPE
FT                   PFSDQQSIPDEEDTNYTQFDLSIETVNVTLSFTKWINGKGLLRDVEVKGIRGVVDRRSV
FT                   HWSDDHLDPKSYRHEHHPGDFEIDSFKMSDVLVTVYQPGNFRPFSVSIFSCDLPQLRKQ
FT                   WLLYDFMSANMMTGSFDNSLFTIHPRQSHSFASAEMDNKIEADGKPSTWKKHSRIRIDG
FT                   LNIDHLNRGVQGPFSWIYEGTVDIVADIMFPAENDESLAQVMAGLYDRLEATVISNQYQ
FT                   EPDSRRQPGMDGTASSDDKRFLVTDLRLQLNNVRAVVPLFNRDLSYINNALIRPIVAYI
FT                   NSRRTFIPIHCRLVKRLADFDGSWTTFDSGLMDDLSAAVYDAFARDVVDEQARKRRFKK
FT                   VGFWSLQLAAQAIFMGMAGNIA"
FT   CDS_pept        join(1385399..1385477,1385551..1386173,1386228..1386284)
FT                   /codon_start=1
FT                   /gene_family="HOG000181708" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265370"
FT                   /gene_name="pno1"
FT                   /orf_name="AFUA_6G06430"
FT                   /product="Pre-rRNA-processing protein pno1 "
FT                   /function="RNA binding"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="EAL88497.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG014182"
FT                   /db_xref="HOGENOM:HBG380350"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="UniParc:UPI0000520184"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNG7"
FT                   /transl_table=1
FT                   /translation="MPAPTALLRKSDEPLSAEEPSLTFSSDAQASGQGEAPSPIPTESA
FT                   QHSDMRIDEESRPVFTPITDAGTVLRVETRKVPVPPHRMTPLKANWPKIYPPLVEHLKL
FT                   QVRMNIKNRAVELRTSKFTTDTGALQKGEDFVKAFTLGFDVDDAIALLRLDDLYIRSFE
FT                   IRDVKASLNGEHLSRAIGRIAGKDGKTKFAIENASRTRVVLQGTKVTILGRFRDLGIAQ
FT                   EAIVSLILGSPPGKVYGNLRKVASRMKERF"
FT   CDS_pept        join(complement(1387267..1387364),
FT                   complement(1386523..1387210))
FT                   /codon_start=1
FT                   /gene_family="HOG000091081" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265371"
FT                   /orf_name="AFUA_6G06440"
FT                   /product="Proteasome component Prs3, putative "
FT                   /EC_number="3.4.25.1"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="EAL88498.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG318170"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI0000520890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG6"
FT                   /transl_table=1
FT                   /translation="MASVIAHDPQSEAIGYSFAQQSSTAVREHSFYPYTDNGGSTLGIT
FT                   GSDFAILAGDTRSVAGYNINSRYVPKVFKIGGDAETGEGAHILLSVVGFAADGQALKER
FT                   LDAVVRMYKYQHGKPMSVRACAQRLSTILYQKRFFPYYVHAILAGLDEEGKGALYSYDP
FT                   VGSYEREQCRAAGSAASLIMPFLDNQVNFKNQYIPGSGEGHALEPKKAEPLPRATVEQL
FT                   VRDAFTSAVERHIEVGDGLQMMVITQRGIEEIYTPLKKD"
FT   CDS_pept        join(1389089..1389118,1389178..1389325,1389390..1389994)
FT                   /codon_start=1
FT                   /gene_family="HOG000181719" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265372"
FT                   /orf_name="AFUA_6G06450"
FT                   /product="Proteasome component Pre4, putative "
FT                   /EC_number="3.4.25.1"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="EAL88499.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG028814"
FT                   /db_xref="HOGENOM:HBG629728"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR016295"
FT                   /db_xref="UniParc:UPI000051FCF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG5"
FT                   /transl_table=1
FT                   /translation="MNHFPEAWGRPRNDVYGPYNPSYLQTSGPKSHTQSPAVTGTSVVA
FT                   VKFGGGVAIAADNLASYGSLARFSDVKRLRVFGESAVIGFSGDVSDMQHIDRLLESIDI
FT                   RENYSTHGNTLNAKNLHTYLSKVFYKRRSEFNPLWNQVLVAGFDGNNQPFLSSADLLGT
FT                   TFSAPHLATGFGAHLAIPILRRLFPEEKPVEEITKEEAVNALKECLKVLWYRDARSLDK
FT                   FSLAVITKEGVEMHEDQKIEKQSWAFAESIRGYGAQVN"
FT   CDS_pept        join(complement(1391307..1391321),
FT                   complement(1390406..1391170))
FT                   /codon_start=1
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056668"
FT                   /orf_name="AFUA_6G06460"
FT                   /product="Fumarylacetoacetate hydrolase family protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL88500.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG419601"
FT                   /db_xref="HOGENOM:HBG729228"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI000051F5AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG4"
FT                   /transl_table=1
FT                   /translation="MSTFSLFKCLSISSLSGQRLIRFLAKDGQVYYGDAILPVGVSDLA
FT                   KVTKAKVIQGDIFGQHYVTDQVSEVQMLLAPLARKDIRTVRCLGLNYEQHARESNLPIP
FT                   KYPVLFYKPVTSIAGPRDDIPISTMAQEGEGLDYECELVIVIGKEAKDVPESRALDYVL
FT                   GYAVGNDVSHRDWQIKRGGGQWGLGKGFDGWAPFGPGIVSSRLIRHPNALHISTRLNGQ
FT                   VVQSSSTRDMIFSVAKVVAFLSQGTTLLPGDLIFTGT"
FT   CDS_pept        1392828..1393409
FT                   /codon_start=1
FT                   /gene_family="HOG000251751" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751331"
FT                   /orf_name="AFUA_6G06470"
FT                   /product="Heat shock protein Hsp30-like, putative "
FT                   /biological_process="response to stress"
FT                   /protein_id="EAL88501.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG053617"
FT                   /db_xref="HOGENOM:HBG748242"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniParc:UPI000051E7A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG3"
FT                   /transl_table=1
FT                   /translation="MAFPRFSTDLAPLFQLLDDYDTHRTYRPKNKVTPVRTFAPKFDVC
FT                   EFPDGYRLDGELPGVNQSDIEIEFSDPQTIVIKGHVERNYNNTATETGDDSSSTKSRQP
FT                   TVEDETEEGNASSAIASPAKPAEQTVTNSPTQTNYKLWVSERSIGEFQRTFAFPTRVDQ
FT                   DAVKASLRNGILSIFVPKEAAPKLKKIRVE"
FT   CDS_pept        complement(1395319..1396758)
FT                   /codon_start=1
FT                   /gene_family="HOG000181720" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208227"
FT                   /orf_name="AFUA_6G06480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL88502.1"
FT                   /db_xref="HOGENOM:HBG056391"
FT                   /db_xref="UniParc:UPI000051FF3D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG2"
FT                   /transl_table=1
FT                   /translation="MDLGSPISLSRRTSTRPSRQPLLRPATLHRYHHLSYVQSVHPTRS
FT                   YSMHTLPDKGKDCMHDRAFEEAASSNTHFMVDSQGFSLMRRRSLLTKPGVATRRSVKGS
FT                   TVRRLPPSIDQGYEHSFSHVDYPLRDQDVVCTQSSTQVRPPTPSDSEYTHLGNLKLGSL
FT                   RVVNGSASPSPSERSRLDEARGSFAEPDENAGQSGASWRDRDMGQNIADASPTSEWSEN
FT                   ATSRSVRRLVEECLQDASEGQPVKQPLSSLLRIPSLSDSKKFDDFPASPFSFEKSPINI
FT                   YPQGQDPYLSSKEIDDEGISVADDGEIFDHRAMPTATEKPGTMKSGRLHRKADSGYSSA
FT                   NSVRSLQDGCSRASIDSQASRRHSLDYHPFALGDTARTFQPREESSNQLVMRRHVSLQG
FT                   HRASLMAEASTSTMCHEPQETSSYRRSRSSSYSVPQNPSCTYSQNHYCAQFRNIEPIVN
FT                   RTPHSLIRRAEHSDLETAWGL"
FT   CDS_pept        complement(1400770..1401654)
FT                   /codon_start=1
FT                   /gene_family="HOG000181731" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266365"
FT                   /orf_name="AFUA_6G06490"
FT                   /product="U1 small nuclear ribonucleoprotein A, putative "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="EAL88503.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG056392"
FT                   /db_xref="HOGENOM:HBG329394"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051FF3E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG1"
FT                   /transl_table=1
FT                   /translation="MKQAERLGKASRDQRAKGRSKRCTNSVYALERVQQQLHKPLGFSA
FT                   RLYSLNLSISVTSCLSKSCLHEWPPYAVAIRTNLCLLAYRTKRQSPCLGPTANRNCLTE
FT                   IRLYCTNLPDKLRKYDLRLSLYTLFSTYGTVLDVVAMKTEKMRGQAHIVFKDVQASTQA
FT                   MRALQGFEFFGKEMVSHFFFNGLATALNTVNFQKIVYAKGTSDVIARLRGTYNVPTTTA
FT                   TQATGASTDLQKSIFSGPPGSTALPPKPAGQVNGEAQAAHGTKRPREEESDEEEAPMDE
FT                   DSDVPMEASSDED"
FT   CDS_pept        join(1401790..1402012,1402083..1402669,1402727..1402967,
FT                   1403040..1403080)
FT                   /codon_start=1
FT                   /gene_family="HOG000181752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18208228"
FT                   /orf_name="AFUA_6G06500"
FT                   /product="Actin-related protein 2/3 complex subunit 1A,
FT                   putative"
FT                   /function="actin binding"
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="EAL88504.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="HOGENOM:HBG026058"
FT                   /db_xref="HOGENOM:HBG716994"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017383"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000051FCF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG0"
FT                   /transl_table=1
FT                   /translation="MSAPEVHHLFHSPIADHSFSSDKSTLAVARENNVELYQRTGNKFS
FT                   LTDELKGHEKTVTSVDIAPNSGRIVTCSQDRNAYVWEQTPTGWKPTLVLLRINRAATFV
FT                   RWSPSEQKFAVGSGARVIAVCYFEEENDWWISKHLKKPIRSTITTLSWHPNSVLLAAGS
FT                   TDSHARVFSSFIKGIDTRPEPSAWGERLPFNTVCGEFLNDSAGWIHAVCFSPSGNALAF
FT                   TGHDSSVTVVYPSAPEQPPRAMLNITTRLLPFTSLIWNGENEIIAAGHDCEPFRFSGDE
FT                   SGWKLAGAIESKTGAGAGSVRDESALNMFRQMDLKGQTHADTQLKTIHQNTINTIRVYK
FT                   ETGGAVHQFSTSGVDGRVVVWTI"
FT   CDS_pept        join(1403637..1403921,1403990..1404934)
FT                   /codon_start=1
FT                   /gene_family="HOG000181753" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266366"
FT                   /orf_name="AFUA_6G06510"
FT                   /product="Extracellular triacylglycerol lipase, putative "
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="EAL88505.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG056394"
FT                   /db_xref="HOGENOM:HBG329393"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000051E9BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNF9"
FT                   /transl_table=1
FT                   /translation="MRLRLMAWGVSSVMLHKYSLFCLTIFSCLFVVSVDGAILGRDDEG
FT                   RQQIPDELFESLEELSRIVDVSYCVGTTEIRKPFKCLSHCSEFQGFELVTTWNTGPFLS
FT                   DSCGYVTLSHEPSPKRIIVAFRGTYSIANTIIDLSAYPQAYVPYHPEDGKVSDHLQCLN
FT                   CTVHAGFLASWSNARAIVLEHVAVARARYPDYSLVLTGHSLGGAVAALAGVEMQLRGWE
FT                   PQVTTFGEPRIGNKAFVEFLDRIFDLDGLGADAQDTRFRRVTHINDPVPLLPLSEWGYE
FT                   MHAGEIFIAKEELSPLPHDIRLCQGDNDARCIAGTDGAVTRMLNELDDTVLPKQPLAKR
FT                   VQSPHQAVLADVDPHSSADVDEQVQTPFSLPWHLIPSRYRLWELFFAHRDYFWRLGLCV
FT                   PGGDPTGKII"
FT   CDS_pept        join(complement(1406758..1409237),
FT                   complement(1406092..1406698),complement(1405489..1406031))
FT                   /codon_start=1
FT                   /gene_family="HOG000181767" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903632"
FT                   /orf_name="AFUA_6G06520"
FT                   /product="WW domain protein"
FT                   /protein_id="EAL88506.1"
FT                   /db_xref="HOGENOM:HBG024070"
FT                   /db_xref="HOGENOM:HBG056395"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000051FA97"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNF8"
FT                   /transl_table=1
FT                   /translation="MNPNSIHQGDPEGELFLNSASRPPAESPVVGPLRISKRDTPSPAS
FT                   QGSAPLPYPDDRPRLGQMRSSSGSTGSSPTAGESGRHGSPISSVNNLSSMPAGSSATRP
FT                   SEYPAALRPRDGREPKPATLAERRGNTAPKPLPESPGPDAPDREALFGRKYQRLPASSA
FT                   LSSDGMQREEGIAYPDYQQQYWPPPQPSTPSALSTRVGVSQSLQPPSSTINRISSTASN
FT                   STTRAQRGSPPPPETPIVGPGQQPGSDIEARYAASGIAGTSTLAGLHAQSAAAQRRAEP
FT                   YAGQLPRTQQHQFPTQRPWTPTEQPGSQPHGPPTVYQGAEAVESRSPNPPASSYQPPPP
FT                   QPVATPPHAAAQGQQPPRIPPNALEQDLERMRISSSPPPAYSSVSGSAAPQGYPNEKQR
FT                   LSASMGQPALAASHPATMATPTAAAAAPTVSPQDHPAFANEPRQQSPAGFSPQNGTSAG
FT                   RQPTPVQNAPATSVPGSSTLPPASPPPLPEGWIAHLDPNSGQYYYIHLPTQSTQWEFPK
FT                   GPTPLNLNETPLSPVGSVYSSHPLASPGFSTFGKPLASPGIPLTPGLAPGYESLQSPVV
FT                   TGFSGPPPSSGVDLYKVAPTNGVYFGPYLRYTNMDLERGIWLGSILLVTDAAQPPTIHI
FT                   HQSVDLSPNPRQLKPMSIAVHQRWTFYKYEVDLRMEESGPAKWTYAITSHLGCTRYEFL
FT                   VAGRYETNWRFVATSGNDFSLNVNANERSRLGGIGFMWKDIMQKHIEIGGFHAQLCCGG
FT                   QIYADRMWKEIPSLKQWLAISGKEARKNAPWTAAHEEDVSHAYFHYYTSHFDQPYLRES
FT                   FAQVPYVCQIDDHDIFDGFGSYPEHMQSSNMFKNIGRIGIEMYLLFQHHTTLDILRNVN
FT                   TDIDLFTITGTGWHFVKYLGPAVVVVGADCRSERNSHQVIAGPTYQGIFPKVAMLPPSV
FT                   QHCIWMLSVPIIYPRLETAEHIAHTVATGKRAVTGAYNVLGKVTSSVAGVVGAKDMVGS
FT                   GFDSVKRAVGKSGLMGGILSPFGELDLLDELRDQWTHDSKDLERTYLIRTLQGIAHQKS
FT                   LRMTFLSGAVNVCGAGLVHDPAHPKDHKTMYQIISSAVVNSPPPSYIIKLLHSSHKPLY
FT                   IPANGHRSTPSQPTDTKEDMMEIFQTDVTGQTREYRKLMGRRNYVAIVAYDPEVVNTMY
FT                   GQNMSHGSGKLNLAVDFMVQGDGTYGNVIKYGPVIVPSLEHGK"
FT   CDS_pept        join(complement(1410833..1411165),
FT                   complement(1410345..1410761))
FT                   /codon_start=1
FT                   /gene_family="HOG000253031" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266367"
FT                   /orf_name="AFUA_6G06530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27350.1"
FT                   /db_xref="UniParc:UPI0000F51A13"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Q1"
FT                   /transl_table=1
FT                   /translation="MENPNLLPGHGAFQQSVHIQSYRSVFLEDGDSLIALRLYHNTFKL
FT                   AARLGFLAVESRRINLPFPCSHHDQRQREVCEWREALWLLWNSPEAQFLARAQESLPLF
FT                   LQEILWQTSLLYHTSLIFSYTSLWPGQCLGPGAAPQEEVRHHAAAIFSIAESVMAQSKE
FT                   NCWRSVTFPVFLAGSVTSSSDLKVIALDMLSRLEVREIGRNATSIRYLFQVVYERQMQQ
FT                   SQGVGHPGSADWMEILAEHGLSLVASA"
FT   CDS_pept        complement(1411676..1412254)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266368"
FT                   /orf_name="AFUA_6G06535"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27351.1"
FT                   /db_xref="UniParc:UPI0000F51972"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Q2"
FT                   /transl_table=1
FT                   /translation="MHDPLPPFALLVTDEEREGKAETSRPGTYHVIVIPESFTHLPEYI
FT                   ENAAEEELGDTIPSPLCGNIETAQLTNNLGLGDSNVVILRQFKDSKRSSSSQCPSASHS
FT                   PTSDLRESSLSAVTIDATSQNAADDYPILDMLEQESLEAILLSHFRDVVWMQLVPARGI
FT                   FNFAGENALDVDVFDREATNFPPVRFAIP"
FT   CDS_pept        join(complement(1417619..1422544),
FT                   complement(1417323..1417563),complement(1416733..1417097))
FT                   /codon_start=1
FT                   /gene_family="HOG000181789" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056919"
FT                   /orf_name="AFUA_6G06540"
FT                   /product="Proteasome component (Ecm29), putative "
FT                   /function="binding"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="EAL88508.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG056397"
FT                   /db_xref="HOGENOM:HBG329389"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051FF35"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNF6"
FT                   /transl_table=1
FT                   /translation="MASGATSASSEARELSLISKVELRIALADTDEKLEGLLNTYLAPL
FT                   LLKLGSESHAVRSKVIAVCQHINTRVQAPSIQLPVAALLKQFKDQKSQLIRHFDLLYLQ
FT                   QGIDRLSPNARIDILSPLLQGISEIGATNQGAIIFNLVLRLLPLLNLPPKGSEEDTRLK
FT                   STLCLSDQDRSFLSSWFEKLLLLYPAEKGATTCPGLSPAEYTFLNKGLPADETWNPASN
FT                   GGLNLTATKVTALRFLTSGAFTDSERFIPALIASADVNSRVSDLGEEILKRFIPDLEHP
FT                   DVVQKLYSLYFGDGTVDGAQPARPPIQLKILVFLGKSIVATKDTEKVIRLIEEGLLSDK
FT                   ARSSQGLQASKLRTQIFTFTTWVVRMGSPSDLKLMAPKLIAGLWDFIQSQGWPSPAASG
FT                   QRLPASDLSLRGLAYESIGILVPKVDFQVQDDQAQFSDFDLIKWLFTSLSSDDSGPQIF
FT                   VSIEQALGSILNSSVDRWNREFQEQIRPFLVHQMGNLPGDEDPITGFKIVRRSQYAAVR
FT                   FSNRFLPYSDVVARWIDLMAVARGSELNQEVVEEGKKGLHPYWYRLLNPSKDRKWVAST
FT                   AADETEQAWYNFPTFSDATRFLLGSPESARSAVAPALSASEALSGPYRTALPVAIAFLR
FT                   NILLWEALSASGNIIEIDQDWDVKLDVLLTSDEGARRGLKQYMQSSDKEPILLFLTSAL
FT                   TGLTSDKRLGLQRCGEHFVSICSLASNDTVGAMVPQTLALKASVSSTDQEIQNKAAQAL
FT                   GILASHPAFSDADIRSLLSDLSDSVSSWKPAIGEALLKIRGAILAIGYILSRLAFRSAL
FT                   HRASDEQVERFTSTVFDLVENSRDSLLRRSAQVALGLLSLSGILSPAMISDARWKQIKE
FT                   KLTQDAKSESDTAIATLGLLALTFARSSPDHALFKELLTSLYELHEIRSPEIHFTVGDA
FT                   LSSAVVGWNSKSLLRQFDVDEEVPHMTISEKVLAEMTDKIIADCTASKPSLRKSSAIWL
FT                   LCLIKNCGHLAEIQSRLRKCQATFTGILGDRDEVVQETGAQGLGLVYEMGDQSLKDDLV
FT                   RDLIESFTANKSNLGGGKVHADTELFEPGALPTGEGSSINTYKDIMNLASEAGDPTMVY
FT                   RFMSLASNNALWTNRAAFSKLGVSTIFSDSSVNGYLAKSTQIYPKLFRYRFDPNPNVQR
FT                   SMNTIWTALVKDPAVVINTHFDEIMDDLLTSMLAGREWRVRQASCAAIADLMQGRQPEK
FT                   YAKYLDEIFTKAFKLLDDIKESVRVSALKLCQTLTNAIVRTLETSDLETKRANAMLASA
FT                   IPFLLSDKGMESSVQEVQGFAIGTLVQMIRKSPSGPLRAFVPRIIEQFLNSLSSLEPQA
FT                   VNYVHLNADKYGLTGQEIDKMRLSSIRTSPMMEVIERYLIDMLDDASMKEFAPRLEGVL
FT                   RSAVGLPSKVGCSRVLVLLSMRPMLFRPYADRFVQLLSKYVVDRNETVSASYCTSIGYL
FT                   MRLATDDQVLKTINYAKNLYLAAEDANERVISAEILHSTSKLSNDRFMAFAATTLPFVF
FT                   ISKYDTDTHVREVFDNTWQDNVGGTRAVSLYLKEIASLAAENLDSPRWAIKHTAALGIA
FT                   NAIMLLDADLDLATSQSLWPVLEKALAGKTWDGKEAVLKAFMKFASQAQKLWQENKQLS
FT                   DSMKVIAIREAKRNNPIYRPHGLVALGGVARARSDVDFMPDALNIVSRVLDEVTEADAD
FT                   SMDIDSGSGQNSKYVYKICSPFSVFSVVHGTRKVQISLYEELGKLFERFRKWATAGNGQ
FT                   KPEAGELQGPLVALAQKMLCREIDMSIENIRMGRAQAAAAYVALSQQMELDVTQALQDS
FT                   VKTWKDSERSGLVQQVLNQILTDLAVLW"
FT   CDS_pept        join(complement(1427690),complement(1427411..1427604),
FT                   complement(1424124..1427337),complement(1423612..1424066),
FT                   complement(1423035..1423556))
FT                   /codon_start=1
FT                   /gene_family="HOG000181800" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207960"
FT                   /orf_name="AFUA_6G06550"
FT                   /product="SNF2 family helicase/ATPase, putative "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL88509.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT